Redmond RMC-250E User Manual Download Page 6

6

to save a new cooking programme to the memory; to reset to default settings 

(from the standby mode).   

3.  Display.   

4. 

“Start/Keep Warm” button is used to start the selected cooking programme; to 

disable “Keep Warm” in advance.   

5. 

“t°С” button is used to enter the cooking time/temperature adjustment mode 

(in all automatic programmes except “YOGURT”).

6. 

“Menu” button is used to enter the cooking programme selection mode; to reset 

to default settings (from the standby mode).  

7. 

“—” button is used to reduce the hour and minute value in the current time adjust

-

ment mode, cooking time adjustment mode, “Time Delay” adjustment mode; to 

reduce the temperature value (in all automatic programmes except ”YOGURT”); 

to select an automatic cooking programme. 

8. 

“+” button is used to  increase the hour and minute value in the current time 

adjustment mode, cooking time adjustment mode, “Time Delay” adjustment 

mode; to increase the temperature value (in all automatic programmes except 

“YOGURT”); to select an automatic cooking programme. 

9. 

“ОК” button is used to confirm the adjustments when exiting the cooking pro

-

gramme selection mode, time and temperature adjustment mode, and the current 

time adjustment mode.

Display 

A3

1. 

Temperature value indicator (in all automatic programmes except “YOGURT” and 

“EXPRESS”). 

2.  Cooking progress bar indicator. 

3.  Automatic cooking programme indicators.

4. 

Timer / current time indicator / “Time Delay” indicator.

5. 

Current time/”Time Delay” adjustment modes indicator.

6. 

“Cooking time” indicator.

7. 

“Reheat” /”Keep Warm” functions indicator.

REDMOND RMC-250E Multicooker is equipped with a touch control panel and an LCD 

display with 3 backlight colours indicating different modes of operation.

Backlight colour

Mode of operation

BLUE

The “Time Delay” function is in progress, the display shows the Timer 

value and the “Time Delay” indicator.

GREEN

A cooking cycle is in progress, the display shows the cooking time 

countdown, the “Cooking time” indicator is lit.

ORANGE

The “Reheat” function is in progress, the display shows the “Reheat” 

time count up.

I. PRIOR TO FIRST USE

Carefully remove the multicooker and its accessories from the packaging. Dispose of all 

packaging materials. 

Keep all warning labels, including the serial number identification label located on 

the housing. The absence of the serial number will deprive you of your warranty 

benefits! 

After transportation or storage at low temperatures allow the appliance to stay at 

room temperature for at least 2 hours before using.

Wipe the housing of the appliance with a soft, damp cloth, wash inner bowl, and let dry. 

Clean the appliance, to prevent extraneous odours during the first use. 

II. OPERATING THE MULTICOOKER

Before Operating

Place the appliance on a flat, stable, and hard surface away from wallpaper, decorative 

coatings, or any other objects or cabinets that could be damaged by steam, humidity, or 

high temperatures. 

Before operating, make sure that the outer and inner parts of the multicooker have no 

dents, cracks or any other visible damages. There should not be any obstructions between 

the heating element and the bowl. 

To Reset to Default Settings

REDMOND RMC-250E Multicooker is equipped with a non-volatile memory. If a power 

failure occurs the appliance will store the current settings in  the non-volatile memory. 
To reset to default settings press and hold down the “Menu” button. A signal is heard, 

the appliance is reset.

To Adjust Current Time

Plug in the appliance. Press and hold down the “+” or “–” button. “+”, “–”, and the “ОК” 

buttons and current time indicator on display will flash. Use the “+” button to increase 

and the “–” button to reduce the current time value. After the maximum value is reached 

the adjustment starts from the minimum value. Press and hold the corresponding 

button down to scroll through the digits. Select the hour value, press the “ОК”, and select 

the minute value. After the current time is set press the “Reheat/Cancel”.  

To Adjust Cooking Time

REDMOND RMC-250E Multicooker enables to adjust the default cooking time of each 

programme. Adjustment range and interval depend on the selected cooking programme. 

To adjust the cooking time:

1. 

Select an automatic cooking programme by pressing the “Menu” button. The “+”, 

“–”, “Start / Keep Warm”, and “ОК” button indicators will  flash. Press the “+” or “–” 

button repeatedly until the display shows the required cooking programme in-

dicator. As you navigate through the menu the display will show the default 

cooking time of each programme. 

2. 

Press the “ОК” ( the corresponding button indicator and the “Cooking time” in

-

dicator light up) and adjust the cooking time of the selected programme. The 

“+”, “–”, “Start / Keep Warm”, and “t°С” button indicators and the “Cooking time” 

indicator on the display will flash. If the “Time Delay” function is applicable for 

the selected cooking programme The “Time Delay” button indicator will flash. 

Use the “+” button to increase and the “–” button to reduce the time value. Select the 

hour value, press the “ОК”, and select the minute value. Press and hold the correspond

-

ing button down to scroll through the digits. After the maximum value is reached the 

adjustment starts from the minimum value.    

3. 

To cancel the adjustments press the “Reheat/Cancel” and start over. 

To Delay the Programme

The “Time Delay” function enables programmeming the appliance to start cooking at a 

specific time. A cooking cycle can be delayed between 10 minutes and 24 hours in 10 

minute increments.  

1.  Select an automatic programme and adjust the cooking time. Press the “Time 

Delay” button to delay the programme (the button indicator lights up, the display 

will show the “Time Delay” adjustment mode indicator). The “+”, “–”, “ОК”, “Start / 

Keep Warm”, and “t°С” button indicators will flash.  

If the selected programme is “YOGURT”, “t°С” button will not flash (the default tem

-

perature of the programme cannot be adjusted).

2. 

Use the “+” and “–” buttons to adjust the hour value (press the “+” to increase and  

“–” to reduce the value). Press and hold the corresponding button down to scroll 

through the digits. After the maximum value is reached the adjustment starts 

from the minimum value. 

3. 

After the hour value is adjusted press the “Time Delay” button. Use the “+” and 

“–” buttons to adjust the minute value.  

4. 

To cancel the adjustments press the “Reheat/Cancel” and start over. 

“Keep Warm” Function

The function automatically activates at the end of a cooking cycle and keeps the dish 

warm at 75-80°С for up to 24 hours. “Start / Keep Warm” button indicator goes off, 

“Reheat/Cancel” button is flashing slowly. Display shows “Keep Warm” count up. 

Preliminary Deactivation of the “Keep Warm”

To disable “Keep Warm” in the beginning of cooking cycle press and hold down the 

“Start / Keep Warm” button until the “Reheat/Cancel” button indicator goes off. To reac

-

tivate the function repress and hold down the “Start / Keep Warm” button, the “Reheat/

Cancel” button indicator begins to flash slowly. 

“Reheat” Function

To reheat cold food:

1.  Follow steps 1-2 of the “Standard Operating Procedure for Automatic Pro-

grammes”. 

2. 

Press and hold down the “Reheat/Cancel” button. The button indicator will flash 

slowly, the reheating cycle will begin. Display shows “Reheat” count up. The 

appliance will warm the food up to 75°С and will maintain the temperature for 

up to 24 hours. Press the “Reheat/Cancel” button to disable the function if 

necessary (the button indicator goes off).   

“MASTERCHIEF” Function

The function is not applicable for “YOGURT” and “EXPRESS” programmes.

The “MASTERCHIEF” function allows to enter up to 10 time and temperature adjustments 

during a cooking cycle and to save the entire sequence of adjustments to the memory 

of the appliance, replacing the initial programme with the new one. The cooking tem-

perature can be adjusted between 35°C and 170°С in 5°С increments, and the cooking 

time can be adjusted 1 minute and 15 hours in 1 minute increments.

The cooking time of the “FRY” and “DEEP FRY” programmes must not exceed 2 hours, 

to prevent overheating. 
Enabling/disabling the “Keep Warm” function, without changing the cooking time or 

temperature is not considered to be an adjustment. 
The “MASTERCHIEF” function can be an extremely useful tool when following com-

plicated recipes, requiring multi-stage cooking techniques (beef-stroganoff, soups, 

pasta, jams, etc.).

To Adjust Cooking Temperature

1. 

Press the “t°C” button during a cooking cycle. The temperature value indicator 

on the display will begin to flash.

2. 

Adjust the temperature. Use the “+” button to increase and “–” to reduce the 

temperature. Press and hold the corresponding button down to scroll through 

the digits. After the maximum (minimum) value is reached the adjustment starts 

from the beginning.

3. 

To save the adjustments do not press any button for 5 seconds.

To Adjust Cooking Time

1. 

Press the “t°C” button twice during a cooking cycle. The time value indicator on 

the display will begin to flash.

2. 

Adjust the time. To increase the time value in 1 hour increments press the “+” 

button,  in 1 minute increments press the “–“ button. Hour and minute value 

increase irrespective from each other. After the maximum value is reached the 

adjustment starts from the minimum value. Press and hold the corresponding 

button down to scroll through the digits.  

3. 

To save the adjustments do not press any button for 5 seconds.

If the cooking time is set to 00:00, the cooking cycle will be stopped.
Do not enter more than 1 adjustment within a minute, because the appliance will 

only save the last adjustment made. If the recipe requires to change both time and 

temperature, press the “t°C” button after the time or temperature adjustment. The 

appliance will save both adjustments as one.

To Save the Adjusted Programme

Within 3 minutes after a cooking cycle is complete you can save the adjusted programme 

to the memory of the appliance, replacing the initial programme with the new one. 

Display shows a 3-minute count down in 1 second increments.

To save the programme, press the “Time Delay” button. To exit without saving press the 

“Reheat/Cancel”.

To Run the Adjusted Cooking Programme

When an adjusted cooking programme is selected, the display shows “----“ instead of a 

cooking time value.

Summary of Contents for RMC-250E

Page 1: ...Multicooker RMC 250E User manual...

Page 2: ...5 11 18 25 32 39 46 53 59 65 71 77 83 89 95 102 108 115 121 127 133 139 146 154 161 GBR FRA DEU NLD ITA ESP PRT DNK NOR SWE FIN LTU LVA EST ROU HUN BGR HRV SRB SVK CZE POL GRC TUR ARE...

Page 3: ...A1 1 2 3 4 5 7 8 11 9 10 13 6 12 16 15 17 18 14...

Page 4: ...EHEAT CANCEL OK START t C o 1 2 4 3 5 6 7 8 9 A2 Progress Cook time Reheat MULTICOOK STEW BAKE COOK BEANS SOUP FRY RICE GRAIN PASTA STEAM PILAF BABY FOOD COTTAGE CHEESE YOGURT SLOW COOK GAME OATMEAL D...

Page 5: ...ical sensoryormentalca pabilitiesorlackofexperienceandknowledgeiftheyhavebeen givensupervisionorinstructionconcerninguseoftheappliance inasafewayandunderstandthehazardsinvolved Childrenshall notplaywi...

Page 6: ...e minute value Press and hold the correspond ing button down to scroll through the digits After the maximum value is reached the adjustment starts from the minimum value 3 To cancel the adjustments pr...

Page 7: ...g meat fish vegetables poultry and seafood Default time is 15 minutes default temperature is 155 Cooking time of the programme can be adjusted between 5 minutes and 1 hour and 30 minutes in 1 minute i...

Page 8: ...ergent if using any to prevent extraneous odours during cooking If there is a foreign object in the cavity around the central thermal sensor carefully remove it using tweezers trying to avoid pressing...

Page 9: ...programme and switches to Keep Warm Table of Default Settings Programme Recommendations for use Default cooking time Time adjustment range interval Time Delay Preheat time Keep Warm MULTICOOK Adjust c...

Page 10: ...ntil it clicks into place Sealing ring is dirty de formed or damaged in any way Check the sealing ring Replace if necessary VIII PRODUCT WARRANTY We warrant this product to be free from defects for a...

Page 11: ...nctionnement celapourraitpro voquerunesurchauffeetentra nerdesdommagesmat riels Nepasutilisercetappareilenext rieurenraisondel humidit nepasintroduiredecorps trangers l int rieurdel appareil cela peut...

Page 12: ...ainsi que l indicateur du temps de cuisson clignoteront Si la fonction de retardateur est pr vue pour le programme choisi l indicateur du bouton Time Delay clignotera 3 La signification de temps augm...

Page 13: ...outon Menu Les modification r alis es pour ce pro gramme seront supprim es Apr s la suppression du programme modifi le menu fera afficher le programme initial usine Pour annuler tous les programmes mo...

Page 14: ...ns rez la dans l ouverture sp ciale du panier Affaiblissezvotre appui sur la poign e pour qu elle puisse se fixer dans l ouverture sp ciale 3 Suivezles recommandations de votre recette la fin du temps...

Page 15: ...dans la cuve Ne pas fermer le couvercle du multicuiseur lors de la friture si ce n est pas indiqu dans la recette D congeler les aliments surgel s et les goutter avant la friture Lors de la cuisson l...

Page 16: ...uits gratins g teaux en p te avec levure et en feuillet 1 heure 20 min 8 heures 5 min 2 heures COOK BEANS Cuisson des l gumes viandes poissons l gumin euses 40 min 5 min 4 heures 5 min SOUP Pr paratio...

Page 17: ...une mani re r guli re sans carts Conducteur chauffant est tr s sale D connectez l appareil du r seau lectrique laissez le se re froidir Nettoyez le disque chauffant Pendant la cuisson la vapeur sort p...

Page 18: ...hrendseinesBetriebs dieskannzur ber hitzungundBesch digungsowiezuFehlfunktionendesGer tes f hren DasGer tnichtimFreienverwenden EindringenderFeuchtig keitinGeh useoderFremdgegenst ndek nnenstarkeBesc...

Page 19: ...t k nnen Sie die Startaufschubszeit einstellen indem Sie den Knopf Time Delay dr cken derAnzeiger des Knopfes wird leuchten auf dem Display wird derAnzeiger des Startaufschubregimes dargestellt DieAnz...

Page 20: ...n indem Sie dr cken 5 Falls notwendig stellen Sie die Zeit des Programmstartaufschubs ein 6 Dr cken Sie und halten den Knopf Start KeepWarm DasZubereitungsprozess wird starten dieAnzeiger der Kn pfe S...

Page 21: ...betr gt 2 Stunden Programm BREAD Wird f r Backen von unterschiedlichen Brotarten aus Weizenmehl und mit der Zugabe vom Roggenmehl empfohlen Im Programm ist der Gesamtzyklus der Zubereitung vom G ren...

Page 22: ...assten Rezept Die Auswahl von Zutaten die Scheidenart die Zugabeverh lt nisse die Programmwahl und die Kochzeit sollten dem ausgew hlten Rezept entsprechen Nach dem Garen ist das fertige Gericht zu la...

Page 23: ...S 20 Min 1 S 30 Min 10 Min BABY FOOD Zubereitung von Babynahrung 1 S 10 Min 3 S 5 Min COTTAGE CHEESE Zubereitung vom hausgemachtem Quark 20 Min 10 Min 10 S 10 Min YOGURT Zubereitung von unterschiedli...

Page 24: ...der es be finden sich Fremdk rper unter dem Deckel Stellen Sie sicher dass sich keine Fremdk rper M ll Gr tze Essensst cke zwischen derTopf und dem Heizk rper befinden entfernen Sie sie wenn notwendig...

Page 25: ...eopenluchttegebruiken vocht of kleine voorwerpen in de behuizing kunnen leiden tot schadeaanhettoestel Zorgervoordathettoestel voordatuhetschoonmaakt vande stroomisafgekoppeldenvolledigafgekoeldis Vol...

Page 26: ...ling hervatten vanaf begin van het bereik 4 Om uw instellingen te annuleren druk op de knop Reheat Cancel dan moet het bereidingsprogramma opnieuw geselecteerd worden Functie van uitgestelde start Dez...

Page 27: ...idingsprogramma Voor de bediening van het menu drukt u op de knop of Indicator van de gekozen kokprogramma en de indicatoren van de knop Start Keep warm en zullen knipperen Als het geselecteerde progr...

Page 28: ...or het bakken van verschillende soorten brood van tar wemeel en met toevoeging van roggemeel Het programma is voorzien van volledige bereidingscyclus vanaf het rusten tot afbakken van het deeg Standaa...

Page 29: ...ankelijk van de plaats en productieomstan digheden Wij raden aan om alleen 2 5 UHT melk te gebruiken Indien nodig kunt u de melk verdunnen met water Voor het koken zijn de producten niet goed bewerkt...

Page 30: ...an pizza 25 min 20 min 1 uur 5 min 2 uur BREAD Bakken van brood 2 uur 1 uur 6 uur 10 min DESSERT Bereiding van verschillende desserten 30 min 5 min 3 uur 5 min EXPRESS Snele bereiding van rijst pappen...

Page 31: ...op het binnenste deksel is erg vuil vervormd of beschadigd Controleer de staat van de rubberen afdichting op het binnenste deksel van het apparaat Misschien hij vervangen moet worden VIII GARANTIE Op...

Page 32: ...pparecchio all area aperta penetrazione dell umidit odeglioggettiestraneidentroilcorpodell apparec chiopu portarealsuodanneggiamento Primadipulirel apparecchioassicuratevi chesiastaccatodalla reteelet...

Page 33: ...impostare il tempo di lavoro per il programma selezio nato Gli indicatori dei tasti Start Keep warm t cos come l indica tore del tempo di cottura sul display lampeggiano Se il programma selezio nato...

Page 34: ...matici 1 Preparare gli ingredienti secondo la ricetta metterli nella coppa Assicurarsi che tutti gli ingredienti siano uniformemente distribuiti nella coppa e si trovino al di sotto del contrassegno d...

Page 35: ...o di 5 minuti La partenza ritardata in questo pro gramma non disponibile Il tempo massimo di riscaldamento automatico in questo programma di 2 ore Programma BREAD Il programma indicato per la cottura...

Page 36: ...uta in caldo attivata L uso prolungato della funzione di tenuta in caldo non raccomandato Se nel vostro modello della pentola multifunzionale fornito di disat tivazione anticipata di questa funzione v...

Page 37: ...OOD Cottura dei piatti per bambini 1 ora 10 min 3 ore 5 min COTTAGE CHEESE Preparazione di ricotta di casa 20 min 10 min 10 ore 10 min YOGURT Preparazione di vari tipi di yogurt 8 ore 30 min 12 ore 30...

Page 38: ...o sotto il coperchio vi un ogget to estraneo Verificare se ci sono oggetti estranei detriti cereali pezzettini di cibo tra il coperchio e il corpo dell apparecchio e se neces sario rimuoverli Chiuder...

Page 39: ...argravesda os Antesdelimpiarelaparato aseg resedequeest desenchufado yfr o por completo Se deben seguir estrictamente las instruc cionesdelimpiezadeldispositivo SEPROHIBEsumergirelcuerpodelaparatoenel...

Page 40: ...de las horas al presionarse el bot n el valor del tiempo aumentar al presionarse el bot n se disminuir Para cambiar r pidamente el valor presione ymantenga presionado el bot n Al llegar a la configura...

Page 41: ...diferido parpadear el indicador del bot n Time Delay 4 Establezca el tiempo de cocci n necesario presionando el bot n 5 Si es necesario ajuste el tiempo de inicio diferido del programa 6 Pulseymanten...

Page 42: ...nual de los intervalos de tiempo de cocci n de 20 minutos a 1 hora con paso de incremento de 5 minutos La funci n del inicio diferido no es disponible con este programa El tiempo m ximo del funcionami...

Page 43: ...e cortan las pro porciones en la colocaci n la selecci n de programas y el tiempo de preparaci n deben cumplir con sus recomendaciones Despu s de la preparaci n el plato terminado estuvo demasiado tie...

Page 44: ...tos 1 hora 30 minutos 10 minuto BABY FOOD Preparaci n de alimento para beb 1 hora 10 minutos 3 horas 5 minutos COTTAGE CHEESE Preparaci n de reques n casero 20 minutos 10 minutos 10 horas 10 minutos Y...

Page 45: ...o Compruebe si hay alg n objeto polvo cereales trozos de comida entre la tapa yel cuerpo del dispositivo elim nelos Siempre cierre la tapa de la multiolla hasta que haga clic La goma que sella la tapa...

Page 46: ...izaroaparelhoaoarlivre ahumidadeouat a introdu odemateriaisestranhosnoseuinteriorpodemcausar s riosdanos Antesdelimparoaparelho verifiqueseest desligadoecomple tamentefrio Deveseguircriteriosamenteasr...

Page 47: ...n cio do programa Este recurso permite atrasar o in cio do programa de culin ria no campo de 10 minutos a 24 horas com passo de incremento de 10 minutos 1 Depois de ter seleccionado o programa autom t...

Page 48: ...o desejado Para navegar pelo menu aperte a tecla ou O indicador do programa selec cionado assim como os indicadores dos bot es Start Keep warm e OK v o piscar Se o programa seleccionado prev a fun o d...

Page 49: ...este programa n o est dispon vel O tempo m ximo de aquecimento autom tico neste programa de 2 horas Programa BREAD O programa recomendado para cozinhar diferentes tipos de p o de farinha de trigo com...

Page 50: ...leite evapora se A qualidade e propriedades do leite pode depender do lugar e condi es da sua produ o Recomendamos utilizar somente leite ultrapasteurizado com um teor de gordura at 2 5 Se necess rio...

Page 51: ...Fritura em leo 30 min 5 min 1 hora 1 min PIZZA Prepara o de pizza 25 min 20 min 1 hora 5 min 2 horas BREAD Panifica o 2 horas 1 hora 6 horas 10 min DESSERT Prepara o de v rias sobremesas 30 min 5 min...

Page 52: ...o e se necess rio remov los Feche sempre bem a tampa da multicoze dura at ouvir um clique A borracha de selo na tampa interna da uni dade est demasiado suja deformada ou dani ficada Verifique o estado...

Page 53: ...nopsynafenvoksen Emballagen film skum etc kanv refarligeforb rn Farefor kv lning Holddetutilg ngeligtforb rn Deterforbudt atforetageindividuelreparationafenhedeneller ndringafdensstruktur Reparationer...

Page 54: ...automatisk program og tilberedningstiden kan du indstille fors inkelsestiden ved at trykke p Time Delay knap for forsinket start lyser p sk rmen Knapindikatorer Start Keep Warm og t vil blinke N r du...

Page 55: ...dardertidsindstillingenforprogram met RICE GRAIN 35 minutter Det er muligt at indstille tilberedningstiden manuelt in denfor et interval fra 5 minutter til 4 timer med trin p 5 minutter Program PASTA...

Page 56: ...n mulige rsager og m der at overvinde dem RETTEN ER IKKE HELT F RDIG Mulige rsager L sning Hvis du har glemt at lukke l get af enheden eller lukke det stramt s tilberedningstemperatur var ikke h j nok...

Page 57: ...met og multikoger tr der i tilstand Auto varme Oversigtstabel for tilberedningsprogrammer fabriksindstillinger Program Tips for brug Tilberedningstiden som standard Interval af kogetid indstillingstri...

Page 58: ...get Ut t forbindelse imellem sk l og det indre l g Sk len er placeret sk vt inde i huset S t sk len ret og j vnt uden sk vheder L get lukker ikke t t eller der en fremmed genstand under l get Kontrol...

Page 59: ...tviklingshemming samt personer med man glendeerfaringogkunnskapers lengedeerunderoppsyn eller harf ttoppl ringisikkerbrukavapparatet ogerinnforst ttmed fareneknyttettilbrukenavdet Barnm ikkelekemedapp...

Page 60: ...et vil varsellampe for knappen Time Delay blinke 3 Ved trykk p knappen vil tidsverdien ke mens ved trykk p knappen vil den reduseres Etter ha valgt timersverdien trykk p knappen s velg minuttersverdi...

Page 61: ...i programmet COOK BEANS er 40 minutter Manuell innstilling avtilberedningstid er milig i tidsomfang fra 5 minutter opp til 4 timer med et endringstrinn p 5 minutter Programmet SOUP Anbefales for tilb...

Page 62: ...apparatet 1 Ta indre aluminiumlokk av trekk ventilen lett og ta den av 2 Vask ventilen grundig under rennende vann 3 T rk ventilen og sett p plass Under matlaging kan dannes kondensat som i denne mode...

Page 63: ...k bekreftede oppskrifter som er tilpasset modellen Velg m l og tilbered ingrediensene i overensstemmelse med anbefalingene i oppskriften Deigen sto for lenge f r den ble bakt Melet ble ikke siktet ell...

Page 64: ...en st r ikke jevnt i apparatet Sett bollen jevnt uten skjevhet Varmeplaten er meget forurenset Koble apparatet fra str mmen la den bli avkj lt Rengj r varmeplaten Det g r damp fram under lok ket under...

Page 65: ...r ansvarigf rs danapersonerss kerhetgeranvisningartilldem somhandlaromhurmananv nderdennaapparat Det rn dv n digtut vatillsyn verbarnunder8 rf ratthindraattdeleker medapparaten desstillbeh rsamtmedde...

Page 66: ...orn f r Time Delay knappen t nda 3 Tryck p knappen f r att ka tidsv rde och knappen att minska det Efter att ha angett tid kan du trycka p knappen f r att ange minuter F r att snabbt ndra v rden tryck...

Page 67: ...tandard utg r matlagningstid i SOUP programmet 1 timme Handinst llning r m jlig vid tidsinter vallet mellan 20 minuter och 6 timmar med justeringsdelning i 5 minuter FRY programmet Programmet r avsett...

Page 68: ...dlig f rorening har skett r det n dv ndigt att reng ra ytan avinte kammaren f r att undvika m jliga avbrott eller brytande av apparaten F re reng ringen av multikokarens kammare kontrollera att den r...

Page 69: ...f r l nge F rs k att ta ut baket fr n multikokaren direkt efter det har bakats klart Vid behov kan man l mna baket kvar i multikokaren f r en kort tid p autouppv mning BAKET HAR INTE STIGIT UPP gg med...

Page 70: ...t obeh rigt f rem l Sk len st r inte rakt och j mnt Placera sk len rakt utan att den kroknar Uppv rmande element r f rorenat Koppla ut apparaten fr n eln t och l t det kallna Reng r up pv rmande eleme...

Page 71: ...silloin josheovatsaanetohjaustalaitteenturvallisesta k yt st jajoshetajuavatvaarat jotkaliittyv tlaitteenk ytt n Lapseteiv tsaaleikki laitteenkanssa S ilyt laitejavirtajohto poissaalle8 vuotiaidenlaas...

Page 72: ...it Maksimiarvon saavuttamisen j lkeen ajan laskenta alkaa uudestaan Jos painat painikkeen vapauttamatta arvot muuttuvat nopeammin 4 Voit peruuttaa kaikki asetukset Reheat Cancel painikkeella mink j lk...

Page 73: ...a valimistuaineita kulhossa aika ajoin ja noudattamalla keittokirjan ohjeita tarkasti Ennen kuin k yt t FRY ohjelmaa seuraavan kerran anna keittimelle j hty kunnolla RICE GRAIN ohjelma T t ohjelmaa k...

Page 74: ...tila ei ollut tarpeeksi korkea El avaa monitoimikeittimen kantta ruoanlaiton aikana ilman tarvetta Sulje kansi kunnes se napsahtaa Varmista ett mik n ei est laitteen kannen tiivist sulkeutumista ja et...

Page 75: ...Oletuksena oleva kypsent mis aika Minimi ja maksimiaika aikav li K ynnistyksen lykk ys Ty arvojen saavuttaminen L mp tilan yll pito MULTICOOK Erilaisten ruokien valmistaminen jolloin kypsen t misaika...

Page 76: ...ittimen kannen ja rungon v liss joku vieras esine roska suurimo ruokaa yms ja poista se Sulje keittimen kansi aina naksahduksen asti Sis kannen kumitiiviste on likainen viallinen tai ep muodistunut Ta...

Page 77: ...supranta galimus pavojus Vaikamsnegalima aistiprietaisu Prietais irtinkloka bel laikykitevaikams jaunesniems kaip 8 met neprieinamoje vietoje Suaugusi j nepri i rimivaikainegalivalytiprietaisoar juon...

Page 78: ...ijungs jo ir gaminimo laiko indikatorius ir nustatyki te pasirinktos programos veikimo laik Ekrane mirks s mygtuk Sart Keep warm t ir gaminimo laiko indikatoriai Jeigu pasirinktoje programoje yra numa...

Page 79: ...rograma COOK BEANS Programa skirta dar ov ms m sai uvims ir pupoms virti Pagal nutyl jim suprogra muotas programos COOK BEANS gaminimo laikas 40 min Taip pat galimas rankinis gaminimo laiko nustatymas...

Page 80: ...kondensatas kuris iame modelyje kaupiasi specialiame latake esan iame aplinkduben ant gaminio korpuso Kondensat paprast nuvalyti virtuviniu rank luos iu Stipriai u siter us darbinei kamerai kad priet...

Page 81: ...av kepin i karto kai tik jis pagaminamas Esant poreikiui gamin trumpam galite palikti daugiafunk ciame puode esant jungtam automatiniam pa ildymui KEPINYS NEI KILO Blogai i plakti kiau iniai su cukrum...

Page 82: ...s tinklo ir leiskite jam atv sti Nuva lykite kaitinimo element Gaminant maist i po dang io kyla garai Pa eista dubens ir daugiafunkcio puodo vidinio dang io jung ties hermeti kumas Dubuo prietaiso kor...

Page 83: ...er cesdro uizman to anuunapzin sbriesmas saist tasart sizmanto anu Ne aujiet b rniemrota tiesarier ci Glab jietier ciunstr vasvadub rniem kuri jaun ki par 8 gadiem nepieejam viet Ier ces t r anu un ap...

Page 84: ...ie ot pogu laika vien bas palielin sies spie ot pogu samazin sies P c stundu vien bu izv les nospiediet pogu p c tam izv lieties min u vien bas Lai pa trin tu vien bu main anos nospiediet un turiet no...

Page 85: ...soli 5 mi n tes Programma SOUP Paredz ta da du pirmo dienu gatavo anai Ier c iestat tais gatavo anas laiks prog rammai SOUP ir 1 stunda Ir iesp jama manu la gatavo anas laika iestat ana diapa zon no...

Page 86: ...em l dz atskan klik is Tvaika v rstu ir ieteicams t r t p c katras ier ces izmanto anas reizes 1 No emiet iek jo alum nija v ku un viegli pavelciet v rstu aiz izvirz juma atvienojiet to 2 R p gi nomaz...

Page 87: ...o i receptei Neizv lieties gatavo anai produktus kuri satur daudz mitruma vai izmantojiet tos p c iesp jas maz k daudzum Gatavais izstr d jums ir p r k ilgi tur ts aizv rt multikatl Iz emiet izstr d j...

Page 88: ...t tam atdzist Likvid jiet sve erme us vai da i as Trauks ier ces korpus ir uzst d ts nel dzeni Uzst diet trauku l dzeni Sild anas disks ir oti net rs Atvienojiet ier ci no elektrot kla aujiet tam atdz...

Page 89: ...vadseadetkasutadaainultj relevalveallja v i juhul kuineidoneelnevaltseadmeohutuskasutamisesinstruee ritudjanadonteadlikudseadmekasutamisegaseotudohtudest Lapsedeitohiseadmegam ngida Hoidkeseadetjasell...

Page 90: ...s ttivad selle indikaator ning toiduvalmistusaja indikaator ning sisestage valitud programmi toiduvalmistusaeg Nuppude Start Keep warm ja t C indikaatorid ning toiduvalmistusaja indikaator hakkavad e...

Page 91: ...us 20 minutit kuni 8 tundi Programm BAKE Soovitatav biskviitide vormiroogade p rmi ja lehttaignapirukate ning eri sorti leibade k psetamiseks Vaikimisi on programmi BAKE puhul toiduvalmistusaeg 1 tund...

Page 92: ...se korral peske rav etavat kaant kasutades n udepesuvahendit 3 Asetage alumiiniumkaas v ljaulatuvat plastotsa pidi soonde ning hitage see aluskaanega vajutage alumistele fiksaatoritele kuni kostub kl...

Page 93: ...e n htud koostisained P dke mitte kasutada liiga mahlaseid vedelaid koostisaineid v i v hendage nende koguseid miinimumini J tsite valmis k psetise multikeetjasse seisma P dke k psetis kohe p rast val...

Page 94: ...tuda Eemaldage k rvalised kehad v i osakesed Sisepott ei ole paigaldatud multikeetja korpusesse otse Paigaldage sisepott otse nii et see ei oleks viltu K tteketas on tugevalt m rdunud L litage seade...

Page 95: ...eap Copiilor nv rst de8ani imaimult precum ipersoanelecu handicap senzoriale sau psihice sau lipsa de experien i cuno tin e potutilizadispozitivulnumaisubsupravegherea i sau n acel caz dac au fost ins...

Page 96: ...area din timp a func iei de nc lzirii automate dup pornirea progra mului ine i ap sat c teva secunde butonul Start Keep warm p n c nd butonul indi catorului Reheat Cancel se va stinge Pentru a reporni...

Page 97: ...inter valul de p n la 1 or sau de 5 minute pentru intervalul mai mare de 1 or 1 Urma i indica iile pct 1 4 din sec iunea Instruc iuni generale privind utilizarea programelor automate 2 Ap s nd butonul...

Page 98: ...lului Sterilizarea vaselor a obiectelor de uz personal Pasteurizarea produselor lichide nc lzirea m nc rii pentru copii IV ACCESORIILE SUPLIMENTARE Accesoriile suplimentare nu intr n pachetul livrat a...

Page 99: ...BUCATELE SE ARD Castronul a fost r u sp lat dup preg tirea m nc rii anterioare Acoperirea non stick a castronului este d unat nainte s ncepe i a g ti asigura i v c castronul este bine sp lat i acoper...

Page 100: ...erselor produse n abur Produs Greutate g cant Cantitatea de ap ml Timpul de preg tire min 1 File de porc vit cubice de 1 5 2 cm 500 500 20 2 File de miel cubice de 1 5 2 cm 500 500 20 3 File de pui cu...

Page 101: ...nterior al aparatului Posibil aceasta trebuie nlocuit VIII RESPONSABILIT ILE DE GARAN IE Acest produs este garantat pentru o perioad de 2 ani de la data cump r rii n timpul perioadei de garan ie produ...

Page 102: ...ztassa a meleg t elemhelyzet t amikorak sz l k ramos tvavan A k sz l k fedel t lez rni tilos amennyiben a korong form j meleg t elemfels poz ci bavan ll tva Ne ll tsaak sz l ketapuhafel letre netakarj...

Page 103: ...s jra kezd dik A m dos t s felgyors t s hoz n h ny m sodpercig tartsa lenyomva a meg nyomott gombot Az ra rt k kiv laszt sa ut n nyomja meg az OK gombot miut n llitsa be a perc rt ket Az aktu lis id b...

Page 104: ...osit ssal 1 r s intervallun l vagy 5 perces l p sm dosit ssal 1 r n l hosszabb intervallun l 1 Automatikus programok haszn lat n l k vesse az Alapvet m veletek az au tomatikus programok alkalmaz s n l...

Page 105: ...t tani Az ed nyt mosogat g pben is lehet tiszt tani Az ed ny tiszt t s t k vet en t r lje sz razra az ed ny teljes fel let t Az ed ny bels alum nium fedel t minden f z s ut n meg kell tiszt tani tiszt...

Page 106: ...a f z ed nyben tlags t skor kavarja az telt maximum 5 7 percenk nt T l hossz f z si id t ll tott be Cs kkentse a f z si id t vagy k vesse az adott modellhez adapt ltat recept javaslatait A S TEM NY NE...

Page 107: ...n A f t test szennyez d t Kapcsolja le a k sz l ket a h l zatr l v rja meg am g a k sz l k kih l Tiszt tsa meg a f t testet telk sz t s k z ben a fed l al l g z j n ki A multicooking fedele nem l g me...

Page 108: ...STEW 3 BAKE 4 COOK BEANS 5 SOUP 6 FRY 7 RICE GRAIN 8 PASTA 9 STEAM 10 PILAF 11 BABY FOOD 12 COTTAGE CHEESE 13 YOGURT 14 SLOW COOK 15 GAME 16 OATMEAL 17 DEEP FRY 18 PIZZA 19 BREAD 20 DESSERT 21 EXPRES...

Page 109: ...Time Delay 4 Reheat Cancel 75 80 24 Start Keep warm Cancel Reheat Start Keep warm Reheat Cancel Reheat Cancel Reheat Cancel 1 1 2 2 Reheat Cancel 75 24 Reheat Cancel MASTERCHIEF MASTERCHIEF YOGURT EX...

Page 110: ...Keep warm Reheat Cancel 7 Start Keep warm Reheat Cancel 8 Reheat Cancel MULTICOOK MULTICOOK 75 Start Keep warm Reheat Cancel 100 35 170 5 140 2 15 2 15 1 1 5 1 1 1 4 2 t t Start Keep warm Time Delay 3...

Page 111: ...2 30 SLOW COOK SLOW COOK 5 3 12 10 GAME GAME 3 1 12 10 OATMEAL OATMEAL 10 5 4 1 1 5 1 MULTICOOK 95 DEEP FRY REDMOND RMC 250E DEEP FRY 30 5 1 1 1 1 5 2 3 4 Start Keep warm Reheat Cancel PIZZA PIZZA 25...

Page 112: ...112 2 5 5 7 REDMOND STEW SOUP...

Page 113: ...30 SLOW COOK 5 3 12 10 GAME 3 1 12 10 OATMEAL 10 5 1 1 1 4 5 DEEP FRY 30 5 1 1 PIZZA 25 20 1 5 2 BREAD 2 1 6 10 DESSERT 30 5 3 5 EXPRESS 20 ml 1 1 5 2 500 500 20 2 1 5 2 500 500 20 3 1 5 2 500 500 15...

Page 114: ...114 VIII 2 13 6 7 8 5 2012 19 EU...

Page 115: ...za djecu mla uod8godina i enjeiodr avanjeure ajanesmijeobav ljatidjecabeznadzoraodraslih Materijalizapakiranje folija penoplastit d gubitiopasnizadjecu Opasnostodgu enja uvajteganamjestunedostupnomza...

Page 116: ...snite gumb Reheat Cancel onda je potrebno ponovno da izaberete program pripreme Odlaganje starta programa Ova funkcija vam omogu uje da odlo ite po etak izvr enja programa pripreme u raz dobljeu od 10...

Page 117: ...pr enje proizvode sa otvorenim poklopcom Da biste izbjegli zagorjevanje jela preporu ujemo da pratite upute iz knjige recepata i povremeno promije ate sadr aj posude Prije ponovnog kori tenja programa...

Page 118: ...eno je kori tenje vla nog sun era srednje tvrdo e ili sinteti ke etke Uz redovnu upotrebu aparata vremenom se mo e potpuno ili delimi no izmjeniti boja grejnog diska Samo po sebi to nije znak neis pra...

Page 119: ...kom kuhinjskom ure aju kra e vrijeme sa uklju enom funkcijom automatskog grijanja TIJESTO SE KOD PE ENJA NIJE PODIGLO Jaja i e er nisu bili dobro izlupani Koristite provjereni za doti ni model prilago...

Page 120: ...ti nost spoja posude i unutarnjeg p o k l o p c a vi enamjenskog aparata Posuda nije ravno postavljena u ku i te aparata Stavite posudu ravno Poklopac nije vrsto zatvoren ili je ispod poklopca upao st...

Page 121: ...ecasenesmejuigratiure ajem uvajtepriborinjegovkablvan doma ajadecemanjeod8godina i enjeiodr avanjeure ajamoraju seobavljatistrogopodnadzoromodraslih Materijalzapakovanje plastika polisteren mo ebitiop...

Page 122: ...zna enje vremena e se pove ati prilikom pritiska na taster smanji e se Kada izaberete sate pritisnite taster zatim izaberite zna enje minuta Za brzu izmenu zna enja pritisnite i dr ite eljeni taster N...

Page 123: ...reme u rasponu od 20 minuta do 6 sati sa kora kom pode avanja od 5 minuta Program FRY Preporu uje se za pr enje povr a mesa morskih plodova ivine U programu FRY vreme pripreme je 15 minuta temperatura...

Page 124: ...jivo uklonite kako bi isklju ili pojavu ne eljenog mirisa prilikom naredne pripreme hrane Ukoliko strana tela upadnu u udubljenje oko centralnog senzora pa ljivo ih izvadite pincetom ne vr e i pritisa...

Page 125: ...elu multi kuvala Kod nekih modela multi kuvala firme REDMOND u programima STEW SOUP pri nedostatku te nosti u posudi uklju uje se sistem za tite od pregrevanja ure aja U ovom slu aju program spremanja...

Page 126: ...opca izlazi para N a r u e n a j e hermeti nost spoja posude i unutra njeg p o k l o p c a vi enamenskog aparata Posuda nije ravno post avljena u ku i te aparata Stavite posudu ravno Poklopac nije vrs...

Page 127: ...hra sospotrebi om Udr ujtepr stroj anap jac k belmimodosahudet mlad chako8rokov istenie a dr ba zariadenia nesm vykon va deti bezdozoru dospelej osoby Obalov materi l film pena at m eby predetinebezpe...

Page 128: ...racovn as pre zvolen program Kontrolky tla idiel Start Keep warm t ako aj kontrolka asu pr pravy na displeji bud miha V pr pade ak v zvolen program m funkciu odlo en ho tartu za ne sa miha kontrolka t...

Page 129: ...ogram COOK BEANS Odpor a sa na varenie zeleniny m sa ryby a strukov n Predvolen as pr pravy v programe COOK BEANS je 40 min t M ete ru ne nastavi as pr pravy v rozsahu 5 min t a 4 hod ny s krokom zmen...

Page 130: ...obr sku V pr pade diln ho za pinenia treba o isti povrch pracovnej komory aby nedo lo k po kodeniu alebo poruch m pr stroja Pred isten m pracovnej komory multifunk n ho hrnca resve te sa e je odpojen...

Page 131: ...zatvorenom multifunk nom hrnci Pok ste sa odstr ni kol zmultifunk n ho hnca Akje to nutn m ete necha produkty na kr tku dobu v re ime automatick ho ohrevu KOL SA NEDVIHOL Vajcia s cukrom boli zle vy a...

Page 132: ...adn Odstra te cudz predmet alebo astice N doba v pr stroji bola nerovne umiestnen Umiestnite n dobu rovno aby nedo lo do zo ikmenia Nahrievacie teleso je za p nen Odpojte pr stroj od elektrickej siete...

Page 133: ...en mnabezpe n pou v n tohotop stroje avp pad maj lip edstavuopotenci ln mnebezpe spojen m spou v n mp stroje D tisinesm hr tsp strojem Skladujte p strojvm st nedostupn mprod timlad 8let i t n aob sluh...

Page 134: ...e odlo en ho startu pak bude blikat indik tor tla tka Time Delay 3 Zma knut m tla tka dojde ke zv en hodinov ch hodnot zma knut m tla tka pak ke sn en Po ukon en nastaven hodinov ch hodnot zma kn te t...

Page 135: ...en ru n v roz mez 5 minut a 4 hodiny s postupem nastaven 5 minut Program SOUP Doporu uje se pro p pravu r zn ch v var a pol vek P edvolen doba va en vprogramu SOUP trv 1 hodinu M ete si nastavit dobu...

Page 136: ...se e je odpojen od elektrick s t a pln vychladl Bo n st ny pracovn komory povrch topn podlo ky a kryt centr ln ho termick ho sn ma e je um st n uprost ed topn podlo ky doporu uje se istit vlhkou niko...

Page 137: ...oporu en m vybran ho receptu T sto dlouho st lo s kyp c p sadou Nepros li jste mouku nebo patn prom sili t sto Jsou chyby ve vlo en ch ingredientech V mi vybran recept se nehod k pe en v tomto modelu...

Page 138: ...ikmen Topn t leso oh vac prvek je za pin n Odpojte p stroj od elektrick s t nechte p stroj vychladnout O ist te topn t leso oh vac prvek B hemva en unik p ra mimo v ko Byla poru ena t snost spojen mi...

Page 139: ...dmiot wpostronnych do wn trzakorpusuurz dzeniamo edoprowadzi dojegopowa negouszkodzenia Przed rozpocz ciem czyszczenia urz dzenia upewnij si e jest onood czoneodsiecielektrycznejica kowicieostyg o Uwa...

Page 140: ...le ynacisn przycisk Reheat Cancel po czym nale y wybra program gotowania ponownie Op niony start programu Dana funkcja pozwala od o y rozpocz cie wykonania programu gotowania w zakresie od 10 minut do...

Page 141: ...kontrolna przycisku Time Delay 4 Naciskaj c przycisk ustaw potrzebny czas przygotowywania 5 W razie potrzeby ustaw czas op nionego startu programu 6 Naci nij i przytrzymaj przycisk Start Keep warm Ro...

Page 142: ...o programu maksymalny czas dzia ania podgrzewania automatycznego wynosi 2 godziny Program BREAD Zalecanyjest do pieczenia r nych gatunk w chleba zm ki pszennej i zdodaniem maki ytniej Program przewidu...

Page 143: ...ie potrzebymleko mo na troch rozcie czy wod pitn Sk adniki przed gotowaniem nieprzygotowane lub przygotowane nieprawid owo le wymyte itd Nie by yzachowane proporcje sk adnik w lub nieprawid owo wybran...

Page 144: ...otowywanie ry u kasz na sypko 20 min Przytoczona jest u redniona temperatura robocza elementu grzejnego Zalecany czas przygotowywania r nych produkt w na parze Produkt Waga g Ilo szt Ilo wody ml Czas...

Page 145: ...ty jest 2 lata gwarancj liczon od daty zakupu W ci gu ca ego okresu gwarancyjnego producent zobowi zuje si do usuni cia wad fabrycznych spowodowanych nieodpowiedni jako ci materia w lub b dem w produ...

Page 146: ...146 8 8...

Page 147: ...K 15 GAME 16 OATMEAL 17 DEEPFRY 18 PIZZA 19 BREAD 20 DESSERT 21 EXPRESS 1 MASTERCHIEF 2 24 3 4 24 5 24 1 RB C422 1 1 1 1 1 1 1 1 1 1 1 100 1 1 1 1 1 A1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 A2...

Page 148: ...rt Keep warm Reheat Cancel Start Keep warm Reheat Cancel 1 1 2 2 Reheat Cancel 75 24 Reheat Cancel MASTERCHIEF MASTERCHIEF YOGURT EXPRESS MASTERCHIEF 10 MASTERCHIEF 35 170 5 1 15 1 FRY DEEP FRY 2 MAST...

Page 149: ...1 20 6 5 FRY FRY 15 155 5 1 30 1 FRY RICE GRAIN RICE GRAIN 35 5 4 5 PASTA PASTA 10 2 30 1 1 2 1 6 3 4 6 8 STEAM STEAM 30 5 2 5 1 600 1000 ml 2 2 8 PILAF PILAF 1 20 1 30 10 BABY FOOD BABY FOOD 1 10 3 5...

Page 150: ...150 BREAD 2 1 6 10 DESSERT DESSERT 30 5 3 5 EXPRESS EXPRESS 20 1 2 6 8 3 5 III IV REDMOND RMC 250E REDMOND www multicooker com V 15 STEAM 1 2 3 1 2 3 VI...

Page 151: ...151 GRC RMC 250E 2 5 5 7 REDMOND STEW SOUP MULTI COOK 15 2 1 1 1 15 5 STEW 1 20 8 5 BAKE 1 20 8 5 2 COOK BEANS 40 5 4 5 SOUP 1 20 6 5...

Page 152: ...12 10 OATMEAL 10 5 1 1 1 4 5 DEEP FRY 30 5 1 1 PIZZA 25 20 1 5 2 BREAD 2 1 6 10 DESSERT 30 5 3 5 EXPRESS 20 ml 1 1 5 2 500 500 20 ml 2 1 5 2 500 500 20 3 1 5 2 500 500 15 4 180 6 450 3 500 20 30 5 500...

Page 153: ...153 GRC RMC 250E 140 145 150 155 160 165 170 VII 1 4 VIII 2 13 6 7 8 3 5 2012 19 EE...

Page 154: ...YASAKTIR G R VE G VENL K Kurallarauygunkullan m lkkullan mdan ncekullanmak lavuzunu dikkatliceokuyunuz B ylecekendinizivecihaz n z olu abilecekza rarlardan korumu oluruz Cihaz sadece monte edilmi vaz...

Page 155: ...cakl k derecesinin o andaki s renin ya da zaman n ayarlan mas Ekran yap s A3 1 Pi irme programlar nda s cakl k derecesinin de er g stergesi YOGURT ve EXPRESS hari 2 Pi irme program n n al ma s recini...

Page 156: ...ayarlay n z 5 Gereksinim duyulmas durumunda Time Delay program n n s resini ayarlay n z 6 Start Keep Warm d mesini bas n z ve d meyi bas l tutunuz Pi irme program ba lam olacak Start Keep Warm ve Reh...

Page 157: ...OTTAGE CHEESE Program Program lor peynir haz rlanmas i in tavsiye edilmektedir COTTAGE CHEESE progra m nda varsay lan pi irme s resi 20 dakikad r COTTAGE CHEESE program nda pi irme s resi 10 dakika il...

Page 158: ...iricinin kapa n a may n z Kapa t k sesi gelinceye kadar kapat n z Cihaz kapa n tam kapanmas na hi bir eyin engel olmad ndan ve i kapakta bulunan s k t rma lasti in bozuk olmad ndan emin olunuz Hazne v...

Page 159: ...imi Ba lamayi erteleme ali ma parametrelerine ula ma Otomatik sicak tutma MULTICOOK S cakl k derecesi ve pi irme s resi se me imk nl e itli yemek haz rlama 15 dakika 2 dakika 1 saat 1 dakika 1 saat 15...

Page 160: ...mi Cihaz elektrik ebekesinden ekiniz so umaya b rak n z Is t c diski temizleyiniz Yemek pi irilirken cihaz n kapa n n alt ndan buhar k makta ok fonksiyonlu pi iricinin pi irme haznesi ile i kapa aras...

Page 161: ...3 BAKE 4 4 COOK BEANS 5 5 SOUP 6 6 FRY 7 7 GRAIN RICE 8 8 PASTA 9 9 STEAM 10 10 PILAF 11 11 BABY FOOD 12 12 COTTAGE CHEESE 13 13 YOGURT 14 14 SLOW COOK 15 15 GAME 16 16 OATMEAL 17 17 DEEP FRY 18 18 P...

Page 162: ...MOND RMC 250E OK OK Reheat Cancel REDMOND RMC 250E 1 1 Start OK KeepWarm 2 2 OK t C Start Keep Warm TimeDelay 3 3 OK 4 4 Reheat Cancel 10 24 10 1 1 Time Delay t C Start Keep Warm OK t C YOGURT 2 2 3 3...

Page 163: ...140 15 2 15 1 5 1 1 1 1 4 1 2 2 t C t C Time Delay Start Keep Warm OK 3 3 8 5 STEW STEW 8 20 1 5 BAKE 1 BAKE 5 8 20 2 COOK BEANS COOK 4 5 40 BEANS 5 SOUP SOUP 6 20 1 5 FRY 155 15 FRY 1 30 1 5 FRY RICE...

Page 164: ...30 1 1 5 1 2 2 3 3 4 4 Start Keep Warm Reheat Cancel PIZZA 1 20 25 PIZZA 5 2 3 BREAD 6 1 2 BREAD 10 DESSERT 5 30 DESSERT 5 3 EXPRESS 20 EXPRESS 8 6 2 1 5 3 III IV www multicooker com REDMOND RMC 151E...

Page 165: ...15 1 15 MULTICOOK 5 8 20 1 STEW 2 5 8 20 1 BAKE 5 4 5 40 COOK BEANS 5 6 20 1 SOUP 1 30 1 5 15 FRY 5 4 5 35 RICE GRAIN 1 30 2 10 PASTA 5 2 5 30 STEAM 10 30 1 20 1 PILAF 5 3 10 1 BABY FOOD 10 10 10 20 C...

Page 166: ...500 1 5 1 5 1 20 500 500 1 5 1 5 2 15 500 500 1 5 1 5 3 20 30 500 3 450 6 180 4 15 500 500 5 5 500 500 6 20 500 4 7 15 500 500 1 5 1 5 8 20 500 500 1 5 1 5 9 30 500 500 1 5 1 5 10 15 500 500 11 5 500...

Page 167: ...13 5 19 EU 2012 REDMOND All rights reserved 2015 Reproduction transfer distribution translation or other reworking of this document or any part thereof without prior written permission of the legal ow...

Page 168: ...Produced by Redmond Industrial Group LLC One Commerce Plaza 99 Washington Ave Ste 805A Albany New York 12210 United States www redmond company www multicooker com Made in China RMC 250E UM 3...

Reviews: