Arjo Ninjo Technical Manual Download Page 38 | Manualshive

Page: 38 / 60

background image

38

•

Option 2

Hold the nozzle and unscrew the nozzle head. Then

insert a screwdriver into the nozzle and position the blade in

ROGLQJWKHVFUHZGULYHU¿UPO\XQVFUHZWKHQR]]OH

001412

Figure 7. Dismantling, option 2

• Take out the nozzle at the back of the chamber and

disconnect the nozzle from the hose. The main pump can be
removed to make this operation easier. Disconnect the hoses

DQGWKHWZR¿[LQJVFUHZVXQGHUWKHSXPSVKHOI0RYHWKH

pump forward and lift it out.

•

$IWHUUHSODFHPHQWUHSDLUUH¿WLQWKHUHYHUVHRUGHU

&KHFNLQJ¿[HGQR]]OHV

This is inspected to prevent the nozzle from becoming clogged
with dirt and deposits, etc. Failure to perform the inspection can
result in poor cleaning results.

Unscrew the nozzle from the chamber and clean it inside and out.
Mount the nozzle back again.

&KHFNLQJQR]]OHDWWDFKPHQWVDQGKRVHFRQQHFWLRQVIRUWKHQR]]OHV

This is done to minimize the risk of leakage from the chamber and
from the hose system’s connections to the nozzles at the back
and on the side of the chamber. Failure to perform inspections can
result in leakage.

Check that the nozzles are properly attached to the inside chamber
wall. Tighten them if loose. For further instructions, see “10.1
Function and leakage inspection”.

6.3.5 Checking temperature sensors (2.4)

This inspection is performed to check that the temperature sensor
is working and that the lead-in on the top of the chamber is tightly
sealed. Failure to perform an inspection can result in inadequate
disinfection and leakage. If the temperature in the machine is off
by more than ± 1°C, the temperature sensor must be recalibrated.

For further instructions, see “10.1 Function and leakage
inspection”.

«
...
36
37
38
39
40
...
»

Summary of Contents for Ninjo

Page 1: ...6001313802_2EN 12 2020 TECHNICAL MANUAL Ninjo ...

Page 2: ...ns must be taken in a Field Safety Corrective Action Technical Advisory Notices are divided in three classes A Field Safety Corrective Action FSCA Information about what technical interventions to be made in order to remedy safety related issues described by the Field Safety Notice FSN B Information about non safety related changes C Information about administrative issues The check must be done t...

Page 3: ...12 2 7 The programs 12 2 7 1 Example of program sequence 13 3 SERVICE PROGRAM 14 3 1 Function 14 3 2 Accessing the service program 15 3 3 Operator password line number 0 15 3 4 Checking or changing a numerical value on a line 16 3 5 Quitting the service program 16 4 LINE INFORMATION 17 4 1 Line 17 4 2 Machine independent variables 20 4 2 1 Program version line 1 20 4 2 2 Serial number line 2 20 4 ...

Page 4: ...8 5 1 Error message 28 5 1 1 Error codes must be acknowledged 28 5 1 2 Information codes acknowledgement not needed 28 5 1 3 Handling codes that require action before restarting the machine 28 5 2 Acknowledging an error message 29 5 3 Resetting the machine 29 5 4 During a power failure 29 5 5 Table of errors and possible actions 30 6 PREVENTIVE MAINTENANCE 31 6 1 Periodic maintenance 31 6 1 1 Cons...

Page 5: ...oses in the dosing pump 6 2 44 6 7 4 Checking the empty container alarm 6 4 46 6 7 5 Checking the check valve 6 5 46 6 8 Drainage connection Item 7 46 6 8 1 Checking drainage connections 7 1 46 6 9 Ventilator Item 8 46 5HSODFLQJ D 3 OWHU 47 6 9 2 Checking fan function and connection 8 2 47 6 9 3 Checking check valve function 8 3 47 6 9 4 Checking hoses to the ventilator 8 4 47 6 10 Test run Item 1...

Page 6: ...completed training through the marketing organization of Arjo The information in this manual describes the machine as dispatched from Arjo There may be differences due to customization for customers or countries The machine is accompanied by the following documentation Instructions for Use Installation manual Quick guide The following documentation is supplied on CD Instructions for Use Installati...

Page 7: ...machine s door switch under any circumstances Always connect the equipment via an RCD residual current device OZD V XVH D JURXQGHG SRZHU VXSSO IRU WKH ÀXVKHU disinfector Leakage in the system due to a worn door seal for example must be repaired without delay Before repair or service work is done the personnel concerned must study the relevant documentation and service manuals Before welding begins...

Page 8: ... s product liability 1 4 Isolator switch The machine must be equipped with a separate isolator switch in the feed power supply The isolator switch must be easily accessible on a wall close to the machine 1 5 Attention symbols There are warnings instructions and advice in this manual that require extra attention The symbols and designs used are Risk of injuries or machine damage ESD sensitive equip...

Page 9: ...2 General 7KH ÀXVKHU GLVLQIHFWRU LV GHVLJQHG IRU FOHDQLQJ DQG GLVLQIHFWLQJ circulation goods such as bedpans and urine bottles In this context disinfection means killing vegetative bacteria fungal spores and viruses but not bacterial spores 2 3 Function 7KH LWHPV DUH FOHDQHG E ÀXVKLQJ ZLWK FROG DQG KRW ZDWHU WKURXJK HG DQG URWDWLQJ QR OHV 7KH ZDWHU LV GUDZQ E D SXPS IURP the machine tank and fed t...

Page 10: ...10 2 4 P I diagram 2 4 1 With ventilator 001403 Figure 1 P I diagram with ventilator ...

Page 11: ...the process safety and reliability can remain high and at the same time the built in service program substantially facilitates troubleshooting and service The dosing of descaler the temperature and the disinfection time can all be altered with great precision to suit different conditions 2 4 4 Simple service and installation Valves and the electrical equipment are easily accessible for inspection ...

Page 12: ... Inspection hole The inspection hole is located in the front right corner of the chamber Take off the front cover and remove the technical unit using a Torx T10 screwdriver to access the inspection area 1 001405 Figure 3 Inspection hole 1 2 7 The programs Main program P1 Economy program for lightly soiled goods P2 Normal program for normally soiled goods Intensive program The intensive program has...

Page 13: ...er P9 Intensive program 2 for hard water P10 Intensive program 3 for hard water 2 7 1 Example of program sequence The illustration below shows an example of the program sequence in a normal program 001406 Figure 4 Example of a program sequence Program sequence Purpose 01 Cleaning OHDQLQJ RI WKH JRRGV E ÀXVKLQJ ZLWK cold mixed and hot water in one or more phases 02 Disinfection 7KH ÀXVKLQJ FKDPEHU ...

Page 14: ...ne at risk There are three authorization levels indicates a line that cannot be changed Level A for users display only code 0000 Level B for users change code 2000 Level C for service personnel change Note You can always view all higher level program lines without the access right code for those levels The code only protects against changes The operator communicates with the service program via th...

Page 15: ...splay Enter the service program keep both buttons pressed for 10 seconds Quit the service program press the buttons for three seconds Increase line number or numerical value For rapid feed hold the button down Decrease line number or numerical value For rapid feed hold the button down Shows the value for a line number saves the numerical value 3 3 Operator password line number 0 The machine has th...

Page 16: ... to store the new numerical value in the memory of the computer If the numerical value has four digits the two digits on the left ÀDVK UVW KDQJH WKHP DQG SUHVV The two digits on the ULJKW QRZ ÀDVK DQG FDQ EH FKDQJHG LQ WKH VDPH ZD KHQ RX KDYH QLVKHG SUHVV once more to show the line number again Numerical value as two digits The line number always appears to the left on the display The numerical va...

Page 17: ...1 1 C 2 F BC 5 Cooling method 2 0 None 1 Internal 2 External fan 3 fan extended BC Lines 6 7 Program selection 6 Program selection button 1 1 1 10 Program No BC 7 Program selection button 2 2 1 10 Program No BC LQHV RVH VL H 8 Dose size descaler 12 0 99 seconds BC 9 Dose size rinse aid 0 0 99 seconds BC 10 Dose size process agent 0 0 99 seconds BC Line nos 13 14 Cooling 13 Internal cooling 0 0 Std...

Page 18: ... errors C 30 Counter for error code F10 0 99 errors C 31 Counter for error code F11 0 99 errors C 33 Counter for error code F13 0 99 errors C Line 37 Display 37 Display during operation 7 1 Temp 2 A0 3 Temp A0 4 Remaining time 5 Time Temp 6 A0 time 7 A0 Temp Time C Lines 40 42 Program statistics 40 Max temperature 5 100 C displayed with chosen temp scale 41 Counter for number of processes 0 99999 ...

Page 19: ...Output 10 Lock door 1 run locking sequence BC 75 Read internal temperature Temperature shown with relevant temp scale 76 Read external temperature Temperature shown with relevant temp scale Lines 77 78 Calibrating temperature sensors not available for AH1036512 77 Calibrating internal temperature See Calibrating temperature sensors C 78 Calibrating external temperature See Calibrating temperature ...

Page 20: ... for internal use only and must not be activated for end users The line is used to run a demo on the machine 0 Normal no demo 1 Demo Default value is 0 Running a demo 1 requires authorization level C RQ JXUDWLRQ 7HPSHUDWXUH VFDOH OLQH The line is used to alter between C and F The display shows temperatures in the selected unit 1 Celsius 2 Fahrenheit Default value is 1 Changing the settings require...

Page 21: ...ram for button 2 i e The following program can be connected to any chosen button The programs have a numerical value when they are connected to different buttons 01 Economy program 02 Normal program 03 Intensive program 1 04 Intensive program 2 05 Intensive program 3 06 Economy program hard water 07 Normal program hard water 08 Intensive program 1 hard water 09 Intensive program 2 hard water 10 In...

Page 22: ...QW OLQH The line is used to set the dosing time for process agent 0 99 seconds in one second steps 0 process agent not activated Default value is 0 Changing the settings requires authorization level B or C 4 7 Cooling QWHUQDO FRROLQJ OLQH The line is used to set the water quantity and temperature for internal cooling Setting Water quantity Temperature 0 Standard 3 liters HW approx 80 C 1 Standard ...

Page 23: ... 91 C Changing the settings requires authorization level C LVLQIHFWLRQ WLPH OLQH The line is used to set the time for thermal disinfection 0 1800 seconds in one second steps Default value is 60 Changing the settings requires authorization level C 3UHKHDWLQJ VWHDP JHQHUDWRU OLQH The line is used to set the time for preheating the steam generator 0 90 seconds 0 Shut down Default value is 50 Changing...

Page 24: ...orization level C UURU VWDWLVWLFV OLQHV The lines are counters for error codes Counter codes can show 0 to 99 errors Line Error code Meaning 21 F1 Temperature sensor error 24 F4 Door logic error 27 F7 Disinfection temperature not reached within 900 sec 28 F8 Door open unlocked during process 29 F9 Settings error E2 error 30 F10 RXOG QRW OO HPSW WDQN 31 F11 Leakage drain blocked 33 F13 Internal sof...

Page 25: ...hanged 1XPEHU RI SURJUDPV VWDUWHG OLQH The line shows the total number of programs started 00000 99999 since the machine was installed This value cannot be changed 3URJUDP WLPH WRWDO OLQH The line shows the total duration 00000 99999 hours of all programs run since the machine was installed This value cannot be changed 4 12 Function test 5HDGLQJ LQSXWV OLQHV The lines show the status of the digita...

Page 26: ... either 00 Output not active 01 Output active Then press to control the output 5HDGLQJ WHPSHUDWXUH OLQH The line shows the current temperature sensor value in the chosen temperature scale This value cannot be changed Display range 1 100 C 34 212 F in 1 intervals 5HDGLQJ LQGHSHQGHQW WHPSHUDWXUH OLQH The line shows the current temperature sensor value in the chosen temperature scale This value canno...

Page 27: ... RQ UP E SUHVVLQJ 0L UDWLR IRU ZDWHU OLQH QXPEHU The lines are used to set the mix ratio between the hot water and WKH FROG ZDWHU IRU WKH YDULRXV ZDWHU OOLQJ SKDVHV GXULQJ D SURJUDP cycle LQH LV XVHG WR VHW WKH PL UDWLR IRU WKH UVW OOLQJ SKDVH OLQH IRU WKH VHFRQG OOLQJ SKDVH HWF 0 cold water only 50 half cold water and half hot water 100 hot water only Standard value for line 91 is 0 line 92 is 50...

Page 28: ... Replace CPU card F10 RXOG QRW OO HPSW WDQN 1RW OOHG DIWHU V RU HPSWLHG DIWHU ULQVLQJ F11 Leakage HDNDJH VHQVRU LQ RYHUÀRZ LV DFWLYH RU WDQN level active in standby Leakage sensor is an RSWLRQ RQ WKH ÀRRU F13 Internal software error Reset the machine 5 1 2 Information codes acknowledgement not needed Warning Meaning Measure U1 Lime binding agent low Top up lime binding agent U2 Process agent low l...

Page 29: ...ressed at the same time for 5 seconds 5 3 Resetting the machine WARNING 2QO WR EH FDUULHG RXW E DXWKRUL HG VWDII Resetting the machine works in the same way as if the power had been switched off with the difference that the machine does not restart So there is no zeroing of the machine To reset a machine proceed as follows Press and and hold Then press and keep pressing the buttons for 20 seconds ...

Page 30: ...rking Error in relay K02 to steam generator Error in the electronics unit The lime deposits in the dosing pump are hindering delivery of detergent because The check valve on the steam generator is not working The dosing pump is not working hose needs replacing Air leak A yellow green or red lamp does not light up The respective bulb has blown Test the function by cutting the power and then turning...

Page 31: ...ermined in each individual case Arjo recommends that the stated maintenance operations be performed at intervals according to the service table 6 1 1 Consumables The following consumables are necessary for preventive maintenance and are not covered by product warranty For article numbers see the spare parts list Consumables Maintenance area O Ring Steam generator 4 Sealing Steam generator 4 Descal...

Page 32: ... 1 4 Check that the door lock and breaker are functioning properly 5 1 5 Check that a goods placement sign and quick help instructions have been put up 1 1 6 Check error codes and the number of processes 2 2 The chamber 2 1 Check that the rotating nozzles are moving freely Clean as required 20 2 2 KHFN WKDW WKH HG QR OHV DUH QRW FORJJHG ZLWK grime and deposits Clean as required 20 2 3 Check for le...

Page 33: ...sage amount Adjust if necessary 10 30 6 3 Replace hose in the dosing pump 5 6 4 Check that the empty container alarm works Clean or replace as necessary 5 6 5 Check the function of the check valve in the steam generator 5 7 Drainage connection 7 1 KHFN WKDW WKH GUDLQDJH FRQQHFWLRQ LV UPO attached and that it is not leaking 5 8 Ventilator Option 8 1 5HSODFH 3 OWHU 10 8 2 Check the fan for proper op...

Page 34: ...unit is intact free of errors and installed as per the instructions 2 Check that all cables are connected to the terminal block for the technical unit 3 Check fuses F01 13 A C 230 V Fuses on the machine except the steam generator 4 Check the connection points for the pump 5 Check the connections on the steam generator 6 Check that there are no non insulated unconnected cables by the technical unit...

Page 35: ...DXWLRQ DV VRPH FRPSRQHQWV DUH sensitive to ESD The disinfector has the following fuses F01 13 A C 230 V which protects parts of the heavy current components of the machine F2 500 mA Slow Primary side which protects the primary side of the transformer for the electronics unit F1 2 5 A Fast which protects the secondary side of the PCBA 1 2 3 Figure 5 Placement of fuses 1 F01 2 F2 3 F1 ...

Page 36: ...se of checking the panel decal is so that the machine has the esthetically and hygienically correct appearance and that users select the correct functions KHFN WKDW WKH SDQHO GHFDO LV UPO LQ SODFH LQ WKH ULJKW location and it is not torn or cracked 2 Check that the symbols on the display are clear and legible 6 2 5 Checking door lock 1 4 The purpose of checking the door lock is to ensure that the ...

Page 37: ...sure that the area between the nozzle and the chamber is tight Failure to check the nozzles can result in impaired cleaning Install the blue nozzle head and clean it on the inside and outside Check that the nozzle rotates freely without any friction Mount the nozzle head back again Check that the nut that attaches the nozzle to the chamber wall is tight The nozzle must be removed for cleaning This...

Page 38: ...ber and clean it inside and out Mount the nozzle back again KHFNLQJ QR OH DWWDFKPHQWV DQG KRVH FRQQHFWLRQV IRU WKH QR OHV This is done to minimize the risk of leakage from the chamber and from the hose system s connections to the nozzles at the back and on the side of the chamber Failure to perform inspections can result in leakage Check that the nozzles are properly attached to the inside chamber...

Page 39: ...HFNLQJ WKH RYHUÀRZ FRQQHFWLRQ This inspection is done to ensure that no water is leaking out from WKH RYHUÀRZ FRQQHFWLRQ 7KH LQVSHFWLRQ LV LPSRUWDQW WR SUHYHQW leakage both during a normally functioning process and any major leakage if the usual drain becomes clogged For further instructions see 10 1 Function and leakage inspection 6 3 9 Internal cleaning of the chamber 2 8 WARNING Concentrated de...

Page 40: ...e there is an increased risk of a breakdown or false alarm KHFN WKH OHYHO VHQVRU IXQFWLRQ E HQVXULQJ WKDW WKH ÀRDWV DUH not stuck but move freely in the level sensor 6 4 3 Checking inlet valves 3 3 WARNING All supply lines must be closed when working on the pipe system In order to ensure a proper supply of water the valves at the water connection points must be inspected every year If this is not ...

Page 41: ...code appears If error code F7 displays repeatedly the steam generator may require cleaning according to the instructions below Cleaning the steam generator If the water is hard above about 6 dH there is a risk of limescale deposits forming on the elements of the steam generator The elements should be checked and cleaned once or twice a year WARNING 2QO WR EH FDUULHG RXW E DXWKRUL HG VWDII WARNING ...

Page 42: ... WKH WDQN 7KHQ W WKH FODPSLQJ ULQJ Tighten carefully to avoid damaging the O ring 5H W WKH LQVXODWLRQ DQG VHFXUH LW ZLWK DGKHVLYH WDSH Fit the cover to the ball valve making sure that the ball valve is closed Install the steam generator on the pipe system The gasket between the steam generator and the pipe system of the machine must be replaced 5H W WKH KRVH DQG QRQ UHWXUQ YDOYH If there is leakag...

Page 43: ...ng with strong chemicals can damage the O rings in the pump causing leakage Careless handling of the pump during repairs can damage the ceramic shaft seal resulting in leakage For further instructions see 10 1 Function and leakage inspection 6 7 Dosing system Item 6 The dosing system is a very important part of the process and the following inspections help ensure proper functioning Deviations can...

Page 44: ...e of the steam generator must be inspected Regarding the dosage amounts see the container for the respective agent The hose between the dosing pump and the container must be checked yearly and replaced every other year 6 7 2 1 Setting dosage amounts WARNING 2QO WR EH FDUULHG RXW E DXWKRUL HG VWDII The pumps in the various systems cannot be adjusted All adjustments are done by varying the running t...

Page 45: ... XSZDUGV while spinning the impeller by hand at the same time When the hose is free from the impeller install the new hose 6HFXUH RQH RI WKH KRVH LQJV DQG SUHVV GRZQ WKH KRVH while spinning the impeller by hand at the same time When the hose is down in the pump housing put back the RWKHU KRVH LQJ DV ZHOO DQG UH W WKH FRYHU Note Do not take out the impeller 1 2 3 4 000219 Figure 10 Dosing pump 1 Im...

Page 46: ...5 Checking the check valve 6 5 Check that the valve is not clogged and that it opens and closes 1 001414 Figure 11 The steam generator s check valve 1 6 8 Drainage connection Item 7 The drain removes contaminated water and any potential leakage ZLOO HQG XS LQ WKH PDFKLQH DQG RXW RQ WKH ÀRRU E WKH PDFKLQH 6 8 1 Checking drainage connections 7 1 Tighten the connections Replace any cracked or defecti...

Page 47: ... out of operation Check the fan and clean if needed Any leakage can lead to impaired performance Leaking connections must be sealed tightened See item 10 1 for further instructions 6 9 3 Checking check valve function 8 3 The check valves perform an important function in the ventilation process Clean the contact surfaces and replace broken parts as needed 6 9 4 Checking hoses to the ventilator 8 4 ...

Page 48: ...LQ V DQG GUDLQ V connections for leaking water If there is a leak tighten the KRVH FODPS RU WKH FODPS WKDW KROGV WKH RYHUÀRZ GUDLQ OLQH to the chamber and recheck for leakage during the process Check the main pump so that it is not making any noises during operation Check that the main pump connections are tight and no water is leaking from the pump house Check that the hose connections at the bac...

Page 49: ...t temperature checks a measuring point close to the machine s temperature sensor is recommended 6 10 2 Checking panels 10 2 Check the panel lights by switching off the power with the isolator switch and switching the power on again All the lamps on the panel must light up and the acoustic signal must sound ...

Page 50: ...50 7 REPAIRS AND ADJUSTMENT 7 1 Remove top Remove the top by twisting the two locking screws quarter of a turn Then pull the top forward and lift it off 2 1 1 001420 Figure 13 Removing the top ...

Page 51: ...ing the door in the event of a power failure Remove the cover from the machine to access the locking mechanism Slide the locking mechanism to the side Then open the door 003811 Figure 14 Opening the door manually ...

Page 52: ...is about 550 ml When it is empty close the ball valve and put it back and close the cover 7 3 2 Draining the main pump WARNING Take care when pulling out the plug Unscrew the plug on the lower front edge of the pump and drain all the water from the pump The amount of water in the main pump is about 400 ml Replace the plug and make sure it isn t leaking The illustration below shows the freestanding...

Page 53: ...XW E DXWKRUL HG VWDII 1 2 002923 Figure 16 Components in the nozzle 1 Nozzle head 2 Rotating nozzle Option 1 8VH D HG ZUHQFK VL H PP WR ORFN WKH QXW between the nozzle and the rotating nozzle Then unscrew the nozzle by hand 001411 Figure 17 Dismantling option 1 ...

Page 54: ... removed to make this operation easier Disconnect the hoses DQG WKH WZR LQJ VFUHZV XQGHU WKH SXPS VKHOI 0RYH WKH pump forward and lift it out IWHU UHSODFHPHQW UHSDLU UH W LQ WKH UHYHUVH RUGHU 7 5 Replacing a temperature sensor WARNING 2QO WR EH FDUULHG RXW E DXWKRUL HG VWDII WARNING The machine is connected to the electricity supply and some components are live Remove the old temperature sensor by...

Page 55: ...QFH RU PRUH LQIRUPDWLRQ see Reading the temperature lines 75 76 and Calibrating the temperature sensor lines 77 78 7 7 Overheat protection WARNING 2QO WR EH FDUULHG RXW E DXWKRUL HG VWDII WARNING The machine is connected to the electricity supply and some components are live Note HIRUH UHVWDUWLQJ WKH PDFKLQH DOZD V QG RXW ZK WKH overheat protection tripped ...

Page 56: ...he steam generator is reset automatically To make sure that the overheat protection does not trip immediately the steam generator should be allowed to cool down before a new process is started 1 001419 Figure 20 The steam generator s overheat protection 1 The fuse may have tripped because the temperature sensor is faulty because of incorrect operation because of foaming additive or because the wat...

Page 57: ...ioning A01 F2 F01 U01 K02 K03 Y01 Y02 X50 B05 M06 A02 S01 S02 S04 M05 B01 B06 E01 M17 A01 F2 M02 M03 M04 A02 K02 K03 F01 Y01 E01 Y02 X50 M01 B05 B01 S01 S02 M05 M01 M02 M03 M04 B02 B03 B04 001422 Figure 21 Components in the machine ...

Page 58: ...04 Level sensor rinse aid M17 Cooling fan B05 Level sensor tank S01 Limit switch door closed B06 Temperature sensor Pt 1000 two sensors in one sensor body S02 Limit switch door locked S04 Door switch locked E01 Electric element in steam generator T01 Transformer option F01 2 pin C13 fuse U01 Power supply 24VDC F2 Fuse on the CPU board Y01 Solenoid valve cold water K02 Power relay electric element ...

Page 59: ...Intentionally left blank ...

Page 60: ...re ergonomic patient handling personal hygiene disinfection diagnostics and the effective prevention of pressure ulcers and venous thromboembolism we help professionals across care environments to continually raise WKH VWDQGDUG RI VDIH DQG GLJQL HG FDUH YHU WKLQJ ZH GR ZH GR ZLWK SHRSOH LQ PLQG ArjoHuntleigh AB Hans Michelsensgatan 10 211 20 Malmö Sweden www arjo com ...

Reviews:

No comments

Related manuals for Ninjo

Brand: Manfrotto Pages: 2

Brand: Panasonic Pages: 252

WV7220D - CCTV ACCESSORIES

Brand: Panasonic Pages: 10

WV-NS202 - i-Pro Network Camera

Brand: Panasonic Pages: 2

Brand: Panasonic Pages: 2

Brand: Panasonic Pages: 12

Brand: Panasonic Pages: 3

Brand: Panasonic Pages: 8

Brand: Panasonic Pages: 4

BB-HGW700A - Network Camera Router

Brand: Panasonic Pages: 32

Brand: Panasonic Pages: 19

Brand: Panasonic Pages: 59

Brand: Zacuto Pages: 4

Brand: i-PRO Pages: 2

Brand: E-Mu Pages: 52

Brand: 2easy Pages: 17

Brand: 2DI Pages: 38

Brand: 2DI Pages: 3

Brands by name

0 1 2 3 4 5 6 7 8 9 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Popular brands

Load more brands