Toshiba Carrier MMC-AP0181H2UL Скачать руководство пользователя страница 26

Страница: 26 / 178

㧔㧮㧸㨁㧕

㧯㧺㧝㧜㧜㧔㧮㧾㨃㧕

㧔㧮㧸㨁㧕

㧯㧺㧝㧜㧝

㧔㧳㧾㧺㧕

㧯㧺㧝㧜㧟

㧔㨅㧱㧸㧕

㧔㨃㧴㧵㧕

㧯㧺㧝㧜㧠

㧯㧺㧝㧜㧞

㧼㧺㧸㧱㧹㧳

㧮㧾㨃

㧔㨃㧴㧵㧕

㧔㧮㧸㨁㧕

㧮㧸㨁

㧠㧠

㧤

㧵㧺㧲㧾㧭㧾㧱㧰ޓ㧾㧭㨅㧿ޓ㧾㧱㧯㧱㧵㨂㧱㧭㧺㧰ޓ㧵㧺㧰㧵㧯㧭㨀㧵㧻㧺ޓ㧼㧭㧾㨀㧿

㧔㧹㧯㧯㧙㧡㧜㧠㧠㧕

㧳㧾㧺㧒

FLOW SELECTOR UNIT

(Sold sepalat

㪼

ly)

Power Supply

㧟

㧝㧞

㨅㧱㧸

㧥

㧠㧡

㧯㧺㧟㧜㧥㧔㨅㧱㧸㧕

㧔㧮㧸㧷㧕

㧯㧺㧢㧣

HEAT EXCHANGER

㧡

㧟㧟

㧝㧝

㨃㧴㧵

㧾㧱㧰

㧯㧺㧤㧝㧔㧮㧸㧷㧕

㧟㧟

㨅㧱㧸

㧮㧾㨃

㨃㧴㧵

㧞

㧝

㧞

㧝

㧝㧟

㧮㧸㨁

㧟㧟

㧝㧞

㧞

㧼㧺㧷

㧳㧾㨅

㧠㧡

㧡

㧠

㨀㧟㧚㧝㧡㧭ޓ㧞㧡㧜㨂㨪

㧲㧟㧜㧝ޓ㧲㨁㧿㧱

㧔㧹㧯㧯㧙㧝㧡㧝㧜㧕

Control P.C board for indoor unit

㧔㨃㧴㧵㧕

㧲㧭㧺㧰㧾㧵㨂㧱

㧝㧞

㧞

㧝

㧣㧠

㧡

㧢

㧢㧡㧠

㧣

㧟

㧯㧺㧟㧞

㧔㧳㧾㧺㧕

㧔㨃㧴㧵㧕

㧔㨅㧱㧸㧕

㧻㧼㨀㧵㧻㧺

㧞

㧢

㧞㧠

㧟

㧝

㧟㧠
㧞
㧝

㧡

㧴㧭

㧠
㧟
㧞
㧝

㧡㧢

㧝

㧝㧞㧟

㧠
㧟

㧡㧢

㧯㧺㧢㧝

㧯㧺㧤㧜

㧯㧺㧢㧜

㧮㧸㨁

㧡㧤

㧣

㧢

㧣㧤

㨃㧴㧵

㧯㧺㧞㧝㧟㧔㨃㧴㧵㧕

㧼㧻㨃㧱㧾

㧯㧵㧾㧯㨁㧵㨀

㧿㨁㧼㧼㧸㨅

㧰㧯㧣㨂

㧰㧯ޓ㧜㨂

㧰㧯㧝㧞㨂

㧰㧯㧝㧡㨂

$.-

㧳㧾㧺㧒㨅㧱㧸

㧼㧺㧷ޓ㧦ޓ㧼㧵㧺㧷

㧳㧾㧺ޓ㧦ޓ㧳㧾㧱㧱㧺

㧻㧾㧺ޓ㧦ޓ㧻㧾㧭㧺㧳㧱

㧳㧾㧺㧒㨅㧱㧸ޓ㧦ޓ㧳㧾㧱㧱㧺ޓ㧒

㧯㧺㧞㧞

㨅㧱㧸㧸㧻㨃

㨅㧱㧸ޓ㧦ޓ㨅㧱㧸㧸㧻㨃

㧳㧾㨅ޓ㧦ޓ㧳㧾㧭㨅

㧮㧸㧷ޓ㧦ޓ㧮㧸㧭㧯㧷

㧮㧸㨁ޓ㧦ޓ㧮㧸㨁㧱

㧮㧾㨃ޓ㧦ޓ㧮㧾㧻㨃㧺

㨃㧴㧵ޓ㧦ޓ㨃㧴㧵㨀㧱

㧾㧱㧰ޓ㧦ޓ㧾㧱㧰

㧯㧻㧸㧻㧾ޓ㧵㧰㧱㧺㨀㧵㧲㧵㧯㧭㨀㧵㧻㧺

(#0

/1614

㧯㧺㧞㧝㧜

㧢

㧮㧸㨁

(

㧔㨃㧴㧵㧕

㧡

㧴㧮㧿

㧯㧺㧡㧜

㧟
㧞

㧠

㧝

㧞

㧝

㧞

㨃㧴㧵

㨅㧱㧸

㧡

㧢

㧠

㧢㧡

㧠

㧻㧾㧺

㧮㧸㨁

㧮㧾㨃

㧾㧱㧰

㧯㧺㧤㧞

㧟

㨂㧭㧸㨂㧱

㧹㧻㨀㧻㧾

㧼㨁㧸㧿㧱

㧢

㨅㧱㧸

㧡

㧠㧟

㧡㧟

㧠

㧝

㨅㧱㧸

㨃㧴㧵

㧮㧸㧷

㧾㧱㧰

㧯㧺㧠㧠

㧝㧞

㧯㧺㧟㧟

㧠

㧡

㧞

㧟

㧞

㧟

㨅㧱㧸

㨃㧴㧵

㧝

㧡

㧹㧻㨀㧻㧾

㧸㧻㨁㨂㧱㧾

㧝

㧞

㧠㧟

㧔㧮㧸㨁㧕

㧞

(Sold Separately)

㧿㧱㧺㧿㧻㧾㧔㨀㧭㧕

㧮㧸㧷

㧝

㧞

㧝

㧮㧸㧷

㨀㧴㧱㧾㧹㧻

㧔㨀㧯㧶㧕

㧿㧱㧺㧿㧻㧾

㧱㨄㧯㧴㧭㧺㧳㧱㧾

㧴㧱㧭㨀

䰏䰚䯽䎋䎺䎫䎬䎌

䎃

CONTROL

WIRED REMOTE

䎥䎯䎮

䎺䎫䎬

㧮㧸㧷

㧔㨀㧯㧝㧕

㧟

㨀㧲

㧮㧸㧷

㧝

㧞

㧝

㧞

㧮㧸㧷

㧿㧱㧺㧿㧻㧾㧔㨀㧯㧞㧕

㧴㧱㧭㨀㧱㨄㧯㧴㧭㧺㧳㧱㧾

㧮㧸㧷

㨃㧴㧵

㧯㧺㧠㧝

㧝

㧝㧞

㧝

㧞

㧮㧸㧷

㧟

㧿㧱㧺㧿㧻㧾

㧴㧱㧭㨀㧱㨄㧯㧴㧭㧺㧳㧱㧾

㧮㧸㨁

㧯㧺㧠㧜

㧞㧞

㧝㧝

or Indoor unit

May be Outdoor unit

㧝㧚٧KPFKECVGUVJGVGTOKPCNDNQEM

.GVVGTCVKPUKFGKPFKECVGUVJGVGTOKPCNPWODGT

㧞㧚#FQVVGFNKPGCPFDTQMGPNKPGKPFKECVGVJGYKTKPICVUKVG

㧟㧚KPFKECVGUVJGEQPVTQN2%DQCTF

KPFKECVGUVJGEQPVTQN2%DQCTF

3-4. High Wall Type

MMK-AP0073H2UL, AP0093H2UL, AP0123H2UL, AP0153H2UL, AP0183H2UL, AP0243H2UL

Содержание Carrier MMC-AP0181H2UL

Страница 1: ...UL MMU AP0302H2UL MMU AP0362H2UL MMU AP0422H2UL Compact 4 Way Cassette Type MMU AP0071MH2UL MMU AP0091MH2UL MMU AP0121MH2UL MMU AP0151MH2UL MMU AP0181MH2UL Ceiling Type MMC AP0181H2UL MMC AP0241H2UL MMC AP0361H2UL MMC AP0421H2UL High Wall Type MMK AP0073H2UL MMK AP0093H2UL MMK AP0123H2UL MMK AP0153H2UL MMK AP0183H2UL MMK AP0243H2UL PRINTED IN JAPAN Mar 2011 ToMo FILE NO A10 019 Revision 1 Feb 2013...

Страница 2: ... VIEWS EXTERNAL VIEWS 11 3 WIRING DIAGRAM 23 4 PARTS RATING 27 5 REFRIGERATIN GCYCLE DIAGRAM 29 6 CONTROL OUTLINE 30 7 APPLIED CONTROL AND FUNCTION 46 8 TROUBLESHOOTING 77 9 DETACHMENTS 104 10 P C BOARD EXCHANGE PROCEDURES 143 11 EXPLODED VIEWS AND PARTS LIST 153 ...

Страница 3: ...ties and the users due to troubles of the product after work when an incorrect work has been executed Mark Explanation Indicates prohibited items Forbidden items to do The sentences near an illustrated mark describe the concrete prohibited contents Indicates mandatory items Compulsory items to do The sentences near an illustrated mark describe the concrete mandatory contents Indicates cautions Inc...

Страница 4: ...high pressuremay be generated in the refrigeration cycle which may result in a failure or explosion of the product or an injury to your body For an air conditioner which uses R410A never use other refrigerant than R410A For an air conditioner which uses other refrigerant R22 etc never use R410A If different types of refrigerant are mixed abnormal high pressure generates in the refrigerating cycle ...

Страница 5: ...e limit even if therefrigerantleaks If the refrigerant leaks and exceeds the limit density an accident of shortage of oxygen is caused Fortheinstallation moving reinstallationwork followtotheInstallationManual If an incorrect installation is done a trouble of the refrigerating cycle water leak electric shock or fire is caused After repair work has finished check there is no trouble If check is not...

Страница 6: ... not mix in because pipes are affected by impurities such as water oxide scales oil etc Use the clean pipes Be sure to brazing with flowing nitrogen gas Never use gas other than nitrogen gas 4 For the earth protection use a vacuum pump for air purge 5 R410A refrigerant is azeotropic mixture type refrigerant Therefore use liquid type to charge the refrigerant If using gas for charging composition o...

Страница 7: ...h serve also for R22 are necessary as the general tools 1 Vacuum pump Use vacuum pump by attaching vacuum pump adapter 7 Screwdriver 2 Torque wrench 8 Spanner or Monkey wrench 3 Pipe cutter 9 Hole core drill 4 Reamer 10 Hexagon wrench Opposite side 4mm 5 Pipe bender 11 Tape measure 6 Level vial 12 Metal saw Also prepare the following equipments for other installation method and run check 1 Clamp m...

Страница 8: ...l Dia 1 35 33 31 15 4 17 0 026 10 1 1 2 33 1 37 4 33 1 37 4 11 3 3 9 36 0 39 8 37 2 39 8 46 10 55 15 5 550 480 440 60 1 2 1 4 35 33 31 38 33 31 38 33 31 41 36 5 34 46 40 5 36 5 48 5 40 5 37 5 Figuresin parentheses are for ceiling panels 1 The actual values in an external opeating environment are generally higher than the indicated values due to the contribution from ambient noise Figuresin parenth...

Страница 9: ...y higher than the indicated values due to the contribution from ambient noise 1 2 Compact 4 Way Cassette Type Model name MMU Cooling Capacity kBtu h Heating Capacity kBtu h Electrical Power supply characteristics Power consumption kW Appearance Celling panel Model Height In Unit Width In Dimension Depth In Celling panel Height In Packing Width In Depth In Total Weight Unit Ibs Celling panel Packed...

Страница 10: ... 18 24 8 5 10 5 13 5 17 20 27 230 V 208 230V 1 phase 60Hz 0 018 0 021 0 021 0 043 0 043 0 05 12 6 12 6 12 6 12 6 12 6 12 6 41 3 41 3 41 3 41 3 41 3 41 3 9 0 9 0 9 0 9 0 9 0 9 0 15 7 15 7 15 7 15 7 15 7 15 7 43 9 43 9 43 9 43 9 43 9 43 9 11 9 11 9 11 9 11 9 11 9 11 9 33 33 33 33 33 33 42 42 42 42 42 42 340 270 230 350 280 230 350 280 230 490 390 320 490 390 320 600 440 340 30 30 30 30 30 30 3 8 3 8...

Страница 11: ...11 2 CONSTRUCTION VIEWS EXTERNAL VIEWS 2 1 4 Way Cassette Type MMU AP0072H2UL AP0092H2UL AP0122H2UL ...

Страница 12: ...12 MMU AP0152H2UL AP0182H2UL ...

Страница 13: ...13 MMU AP0212H2UL MMU AP0242H2UL MMU AP0302H2UL ...

Страница 14: ...14 MMU AP0362H2UL MMU AP0422H2UL ...

Страница 15: ...15 2 2 Compact 4 Way Cassette Type MMU AP0071MH2UL MMU AP0091MH2UL MMU AP0121MH2UL ...

Страница 16: ...16 MMU AP0151MH2UL MMU AP0181MH2UL ...

Страница 17: ...e knockout Conduit hole Pipe draw out port Knockout 8 5 216 Gas pipe 4 1 105 6 6 167 8 3 210 26 8 680 5 6 141 4 5 114 7 9 200 Liquid pipe Front side to be positioned horizontally 9 8 250 or more 9 8 250 or more 19 7 500 or more Space required for installation and servicing Knockout hole 3 6 92 Piping hole on the wall 3 9 100 hole Hole for remote controller wires Conduit hole Hole for power supply ...

Страница 18: ...nd servicing Conduit hole Hole for power supply cable Conduit hole Knockout 5 7 145 5 3 135 10 3 262 12 4 316 1 3 32 Hole for remote controller wires Drain port VP20 Inner dia 1 0 26 hose supplied Pipe draw out port Knockout 8 5 216 Gas pipe 8 3 210 26 8 680 5 6 141 4 5 114 19 7 500 or more 3 3 84 6 7 170 7 8 197 Within 2 0 50 7 9 200 Liquid pipe 1 5 39 3 0 75 3 8 94 5 7 146 2 0 52 5 1 130 2 0 50 ...

Страница 19: ...out surface Liquid side Gas side draw out port Knockout Connecting port 8 5 216 Gas pipe Hanging position 3 3 84 6 7 170 12 6 320 3 0 76 8 5 216 2 8 70 2 1 53 2 0 50 60 6 1540 Within 2 0 50 3 8 97 62 8 1595 4 1 105 6 6 167 8 3 210 26 8 680 5 6 141 4 5 114 7 9 200 Liquid pipe 9 8 250 or more 9 8 250 or more 5 7 145 5 3 135 3 5 90 1 3 32 3 6 92 6 7 171 Hole for power supply cable knockout Conduit ho...

Страница 20: ...5 215 8 5 215 9 3 235 9 3 235 0 9 23 5 2 132 30 9 786 5 2 132 1 6 40 12 6 316 1 6 40 1 9 47 8 5 215 5 10 3 262 5 10 3 262 5 6 0 153 5 4 3 109 Hanger Hanger Hanger C enter line Instrallation plate outline S pace required for ins tallation and s ervicing B C A C 6 7 170 or more 33 5 850 or more B F or exchange of cross flow fan 2 0 50 or more A Dis tance C omments K nock out s ystem K nock out s yst...

Страница 21: ...235 9 3 235 0 9 23 5 2 132 30 9 786 5 2 132 1 6 40 12 6 316 1 6 40 1 9 47 8 5 215 5 10 3 262 5 10 3 262 5 6 0 153 5 4 3 109 Hanger Hanger Hanger C enter line Instrallation plate outline S pace required for ins tallation and s ervicing B C A C 6 7 170 or more 33 5 850 or more B F or exchange of cross flow fan 2 0 50 or more A Dis tance C omments K nock out s ystem K nock out s ystem K nock out s ys...

Страница 22: ... 235 0 9 23 5 2 132 30 9 786 5 2 132 1 6 40 12 6 316 1 6 40 1 9 47 8 5 215 5 10 3 262 5 10 3 262 5 6 0 153 5 4 3 109 Hanger Hanger Hanger C enter line Instrallation plate outline S pace required for ins tallation and s ervicing B C A C 6 7 170 or more 33 5 850 or more B F or exchange of cross flow fan 2 0 50 or more A Dis tance C omments K nock out s ystem K nock out s ystem K nock out s ystem Hol...

Страница 23: ...23 3 WIRING DIAGRAM 3 1 4 Way Cassette Type MMU AP0072H2UL AP0092H2UL AP0122H2UL MMU AP0152H2UL AP0182H2UL AP0212H2UL AP0242H2UL AP0302H2UL ...

Страница 24: ...Control䫹Relay 䰜䰙䰢䰒䰟䰐P Parts䫹Name Temp䫹sensor Temp䫹sensor Temp䫹sensor 䰒䰭䰺䫹䰙䰻䱀o䰾䰕䰺䰰䰻䰻䰾䫹temp䫹sensor 䰠䰍䰠䰏䰖䰠䰏䯾䰠䰏䯽䰒䰙 RED RED WHI WHITE YEL YELLOW BLU BLUE BLK BLACK GRY GRAY PNK PINK ORN ORANGE GRN GREEN BRW BROWN Wired Remote Control A A B B 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Indoor Unit Ground Screw COLOR IDENTIFICATION 1 2 1 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 1 1 2 ...

Страница 25: ... BLK WHI WHI 2 2 1 1 CN001 㧔BLU㧕 CN40 CN41 㧔BLU㧕 3 3 BLK BLK BLU BLU 1 2 2 1 1 1 2 3 1 3 1 2 3 1 CN309 㧔YEL㧕 WHI RED RY302 㧰P RY303 Fuse P301 CN66 㧔WHI㧕 3 3 2 1 BLK GRY CN304 CN67 BLK 3 3 3 1 1 1 㧔WHI㧕 CN334 CN68 BLU 1 1 3 2 4 5 4 5 1 1 Control P C Board for Indoor Unit 6 MCC 1402 㧔WHI㧕 2 1 4 5 6 5 3 㨀㧝㧜 4 㧔YEL㧕 CN61 1 2 1 FANDRIVE 4 3 5 2 OPTION CN32 㧔WHI㧕 CN60 2 CN20 㧔BLU㧕㧔RED㧕 3 2 1 5 1 4 CN81...

Страница 26: ...㨅㧱㧸㧸㧻㨃㧳㧾㨅 ޓ 㧦 ޓ 㧳㧾㧭㨅㧮㧸㧷 ޓ 㧦 ޓ 㧮㧸㧭㧯㧷㧮㧸㨁 ޓ 㧦 ޓ 㧮㧸㨁㧱㧮㧾㨃 ޓ 㧦 ޓ 㧮㧾㧻㨃㧺㨃㧴㧵 ޓ 㧦 ޓ 㨃㧴㧵㨀㧱㧾㧱㧰 ޓ 㧦 ޓ 㧾㧱㧰㧯㧻㧸㧻㧾 ޓ 㧵㧰㧱㧺㨀㧵㧲㧵㧯㧭㨀㧵㧻㧺 0 1614 㧯㧺㧞㧝㧜㧢㧢㧮㧸㨁㧔㨃㧴㧵㧕㧡㧴㧮㧿㧯㧺㧡㧜㧟㧞㧠㧝㧝㧞㧝㧞㨃㧴㧵㨅㧱㧸㧡㧢㧠㧢㧡㧠㧻㧾㧺㧮㧸㨁㧮㧾㨃㧾㧱㧰㧯㧺㧤㧞㧟㧟㨂㧭㧸㨂㧱㧹㧻㨀㧻㧾㧼㨁㧸㧿㧱㧢㧢㨅㧱㧸㧡㧠㧟㧡㧟㧠㧝㧝㨅㧱㧸㨃㧴㧵㧮㧸㧷㧾㧱㧰㧯㧺㧠㧠㧝㧞㧯㧺㧟㧟㧠㧠㧡㧡㧞㧟㧞㧟㨅㧱㧸㨅㧱㧸㨅㧱㧸㨃㧴㧵㧝㧡㧹㧻㨀㧻㧾㧸㧻㨁㨂㧱㧾㧝㧞㧠㧟 U2 㧔㧮㧸㨁㧕 U2 㧞 Sold Separately 㧿㧱㧺㧿㧻㧾㧔㨀㧭㧕㧮㧸㧷㧮㧸㧷 ...

Страница 27: ...lead wire length 55 12in 1400 mm Vinyl tube Black Ø6 size lead wire length 55 12 in 1400 mm Vinyl tube Red FS 0218 103 APD 1406 Model MMU Fan motor Moter for horizontal grille Pulse motor Pulse motor valve TA sensor TC1 sensor TC2 sensor TCJ sensor Float switch Drain pump motor SWF 340U60 2 ICF 340 U150 1 MP24ZN3N EFM MD12TF 1 EDM B40YGTF 2 EDM B60 YGTF 1 Lead wire length 12 2 in 310 mm Vinyl tube...

Страница 28: ... wire length 47 24 in 1200 mm Vinyl tube Black Ø6 size lead wire length 47 24 in 1200 mm Vinyl tube Red No 1 2 3 4 5 6 7 Model MMK AP Fan motor for indoor Grille motor Thermo sensor TA sensor Heat exchanger sensor TC1 sensor Heat exchanger sensor TC2 sensor Heat exchanger sensor TCJ sensor PMV motor ICF 340U30 1 Output Rated 30W 280 340V DC MP24Z3T Output Rated 1W 16 poles DC 12 5 in 318 mm 10 kΩ ...

Страница 29: ... Blue 1 Controls super heat in cooling operation 2 Controls under cool in heating operation 3 Recovers refrigerant oil in cooling operation 4 Recovers refrigerant oil in heating operation Connector CN104 2P MMU MMC Yellow MMK White 1 Detects indoor suction temperature Connector CN100 3P Brown 1 Controls PMV super heat in cooling operation Connector CN101 2P MMU MMC Black MMK Blue 1 Controls PMV un...

Страница 30: ...mote controller 1 Based on the operation mode selecting command from the remote controller the operation mode is selected 1 Adjustment range Remote controller setup temperature F C Remarks Air speed rpm Air direction adjustment Wired type Wireless type COOL DRY 64 F 18 C to 84 F 29 C 64 F 18 C 86 C to 30 C HEAT 64 F 18 C to 84 C 29 C 61 F 16 C to 86 F 30 C 6 CONTROL OUTLINE 6 1 4 Way Cassette Type...

Страница 31: ...L HEAT S3 S5 S7 S9 SB SD SF S0 SD SB S9 S7 S5 S3 S0 Controlling operation in case when thermo of remote controller works is same as a case when thermo of the body works If the air speed has been changed once it is not changed for 3 minutes However when the air volume is exchanged the air speed changes When cooling operation has started select a downward slope for the air speed that is the high pos...

Страница 32: ... In heating operation the higher temperature of TC2 sensor and TCJ sensor is compared with temperature of TC1 sensor and then the lower temperature is used to set the upper limit of the fan tap When B zone has continued for 6 minutes the opera tion shifts to C zone In defrost time the control point is set to 10 8 F 6 C ITCJ Temperature of indoor heat exchanger sensor In D and E zones priority is g...

Страница 33: ...or 30 minutes the thermostat is forcedly off In N zone the timer count is interrupted and held When shifting to M zone again the timer count restarts and continues If L zone is detected the timer is cleared and the operation returns to normal operation Reset conditions 1 TC1 54 F 12 C and TC2 54 F 12 C and TCJ 54 F 12 C 2 20 minutes passed after stop P2 Q2 F C L N M value When the power supply is ...

Страница 34: ...me operates the drain pump 2 During operation of the drain pump if the float switch operates the drain pump continuously operates and a check code is issued 3 During stop status of the drain pump if the float switch operates the thermostat is forcedly off and this control operates the drain pump After continuous operation of the float switch for approx 5 minutes this control stops the operation an...

Страница 35: ... 1 Normal thermo OFF During heating the indoor unit goes thermo OFF as the heating temperature setting is reached 2 During heating the fan rotates at a breeze speed UL or lower or remains stationary to prevent cold air from being discharged including defrosting operation 3 Forced thermo OFF HEAT operation is unavailable because at least one indoor unit is operating in COOL DRY mode under priority ...

Страница 36: ...utomatically set to horizontal discharge position when PRE HEAT Heating ready is displayed heating thermo is off For the air direction illustration during normal operation the air direction of the least No among the louvers which are block set is displayed While individual air direction is being set the remote controller operation Illustration of air direction and operation of the real machine are...

Страница 37: ...ntroller screen for approx 3 seconds when SWING FIX button was pushed to select SWING No display for the standard swing Dual swing Cycle swing Louver lock Louver fix For the air direction setup for each discharge port the louver position can be locked during the normal operation An arbitrary air direction of an arbitrary louver can be registered and set by keeping UNIT LOUVER button pushed for 4 s...

Страница 38: ...d 1 The save operation starts when button on the remotecontroller is turned on 2 While the save operation is performed segment goes on the screen of the wired remote controller 3 The request capacity ratio is restricted to approx 75 during save operation 4 If the save operation was validated the contents are held during the operation stop the operation mode change and the resetting of power supply...

Страница 39: ... Remote controller setup temperature F C Wired type Wireless type COOL DRY 64 F 18 C to 84 F 29 C 64 F 18 C 86 C to 30 C HEAT 64 F 18 C to 84 C 29 C 61 F 16 C to 86 F 30 C 2 Using the Item code 06 the setup temperature in heating operation can be corrected Remarks Ta Room temp Ts Setup temp Shift of suction temperature in heating operation Except while sensor of the remote controller is con trolle...

Страница 40: ...nd TCJ 54 F 12 C 2 20 minutes passed after stop Remarks TCJ Temperature of indoor heat exchanger sensor In D and E zones priority is given to remote control ler air speed setup In A zone is displayed TC1 Temperature of indoor heat exchanger sensor value When the power supply is turned on the Forced thermo becomes OFF if the temperature is less than this indicated temperature P2 Q2 TC2 TCJ 41 F 5 C...

Страница 41: ...Stop the indoor fan 1 For 3 minutes after start of operation the operation is forcedly continued even if the unit enters in Thermo OFF condition 2 However the thermostat is OFF giving prior to COOL HEAT selection ready for operation and protective control 1 When the unit stopped from HEAT operation the indoor fan operates with L for approx 30 seconds 1 The filter sign is displayed with LC by sendi...

Страница 42: ... the contents that can be operated by the remote controller at the indoor unit side is possible according to setting at the central controller side 2 Setting contents In case of TCC LINK central control Operation possible Operation impossible In case of wired remote controller type Central control display Goes on in the central control mode Display flashes when an item of the operation prohibited ...

Страница 43: ...fferent during cooling dry and heating operation 4 When the unit stopped or the warning was output the louver is automatically set to full closed position 5 When PRE HEAT is displayed Heating operation started or defrost operation is performed heating thermo is off the louver is automatically set to horizontal discharge position When you push the Hi POWER button during cooling heating or A operati...

Страница 44: ...mperature is thus regulated between the set temperature and the operation suppression zone When the OFF timer is simultaneously set 1 3 5 and 9 hours appear by turns every pushing COMFORT SLEEP button and one of them can be selected for OFF timer Start the air conditioner in the operation mode which you want the remote controller to memorize 1 Push and hold the PRESET button for more than 3 second...

Страница 45: ...em can be selected for OFF timer SLEEP operation Wireless remote controller specific operation 20 21 Save operation 1 The 1 The save operation starts when button on the remotecontroller is turned on 2 While the save operation is performed segment goes on the screen of the wired remote controller 3 The request capacity ratio is restricted to approx 75 during save operation 4 If the save operation w...

Страница 46: ...U MCU External output 280V DC DC5V DC12V DC20V PMV A B A B A B 4 Indoor outdoor communication L1 U1 U1 U2 U2 L2 L1 L1 L2 L2 U1 U2 U1 U2 Display LED Remote controller communication circuit Louver motor Drain pump Indoor fan motor Fan motor control circuit In operation Alarm Getting ready Thermostat ON COOL HEAT FAN Driver TA sensor TCI sensor TC2 sensor TCJ sensor Float input AC synchronization sig...

Страница 47: ...P C board MCC 1402 PMV Louver motor Drain pump Indoor fan motor Power supply circuit Fan motor control circuit External output In operation Alarm Getting ready Thermostat ON COOL HEAT FAN AC synchronization signal input circuit BUS communication circuit TA sensor TCI sensor TC2 sensor TCJ sensor Float input Driver Remote controller communication circuit MCU MCU Indoor outdoor communication Outdoor...

Страница 48: ...onnectable Main Simple wired remote controller Up to 2 sets Function setup Key switch Power circuit EEPROM TC1 sensor TA sensor TC2 sensor TCJ sensor HA Power supply 208 230 1 60 Remote controller communication circuit Start Alarm Ready Thermostat ON COOL HEAT FAN Wireless Remote controller A B setup Fan motor control circuit AC synchronous signal input circuit Display part LCD Display part LED Re...

Страница 49: ...cuit TA sensor TCI sensor TC2 sensor TCJ sensor Float input In operation Alarm Getting ready Thermostat ON COOL HEAT FAN AC synchronization signal input circuit BUS communication circuit External output Indoor outdoor communication Outdoor unit Power source 208 230 1 60 Outdoor unit Outdoor unit Power source Power source Sameas left Sameas left 2 3 Up to 8 units can be connected Emergency operatio...

Страница 50: ... TC2 sensor TCJ sensor Float input In operation Alarm Getting ready Thermostat ON COOL HEAT FAN AC synchronization signal input circuit BUS communication circuit External output Indoor outdoor communication Outdoor unit Power source 208 230 1 60 Outdoor unit Outdoor unit Power source Power source Sameas left Sameas left 2 3 Up to 8 units can be connected Emergency operation SW Wireless remote cont...

Страница 51: ... Indoor fan motor 4 Power supply circuit Fan motor control circuit TA sensor TCI sensor TC2 sensor TCJ sensor Float input Driver Remote controller communication circuit In operation Alarm Getting ready Thermostat ON COOL HEAT FAN AC synchronization signal input circuit BUS communication circuit External output Indoor outdoor communication Outdoor unit Power source 208 230 1 60 Outdoor unit Outdoor...

Страница 52: ...onnected Emergency operation SW Wireless remote controller kit Sensor P C board Power supply circuit Remote controller communication circuit Buzzer Sensor circuit Display LED Function setting SW Indoor outdoor communication Outdoor unit Power source 208 230 1 60 TA sensor TCI sensor TC2 sensor TCJ sensor Float input Driver Remote controller communication circuit AC synchronization signal input cir...

Страница 53: ...DC12V Indoor outdoor communication CN40 blue DC fan return CN334 white HA T10 CN61 yellow DC12V Remote controller CN41 blue DC20V Remote controller communication LED D504 green High ceiling adjustment SW SW501 TC1 sensor CN100 brown DC5V Float SW CN34 red DC12V Drain pump CN504 white DC12V Indoor outdoor cum central control communication D503 yellow Remote controller power source LED D403 red EXCT...

Страница 54: ...1 DC5V DISP CN72 DC5V TA sensor CN104 DC5V EXCT CN73 DC5V TC2 sensor CN101 DC5V External error imput CN80 TC1 sensor CN100 DC5V TCJ sensor CN102 DC5V Remote controller CN41 Indoor Outdoor communication Also used for communication of the central control system CN40 Drain pump output CN68 Remote controller power supply LED D203 Optional power supply CN309 AC 208 230V Power supply CN67 Microcomputer ...

Страница 55: ...er in heating operation HEAT or heating under AUTO mode ON while indoor fan ON air cleaner in use or via interlock wiring Specification Remarks Generates test code L30 and automatically shuts down air conditioner only if condition persists for 1 minute Used for indoor operation check prescribed operational status output such as indoor fan H or drain pump ON to be generated without communication wi...

Страница 56: ...play output Wireless receiver CN213 DC 5V Option power supply CN309 AC 208 230V Indoor Outdoor communication CN40 HA T10 CN61 DC 12V Option output CN60 DC 12V CHK CN71 DC 5V DISP CN72 DC 5V External error input CN80 DC 12V EXCT CN73 DC 5V Remote controller power LED D203 TA sensor CN104 DC 5V Remote controller CN41 DC 20V TCJ sensor CN102 DC 5V Microcomputer operation LED D02 TC2 sensor CN101 DC 5...

Страница 57: ...f ON with operation of indoor unit and OFF with stop The setup of single operation by FAN button on remote controller is executed from remote controller DN 31 ON during defrosting of outdoor unit ON when Real thermo ON Comp ON ON when operation mode is cooling line Cool Dry Cooing Heating AUTO cooling ON when operation mode is heating line Heat Cooling Heating AUTO heating ON when indoor fan is ON...

Страница 58: ...y in the display part disappears and status becomes the normal stop status 7 3 Functions at test run Cooling Heating test run check The test run for cooling heating can be performed from either indoor remote controller or outdoor interface P C board 1 Start Finish operation of test run Test run from indoor remote controller Wired remote controller Refer to the below item of Test run of the wired r...

Страница 59: ...tton Temperature set button After checking the receiving sound Pi After checking the receiving sound Pi immediately push Temperature set button to immediately push Temperature set button to set to 66 F 19 C set to 84 F 29 C After checking the receiving sound Pi After checking the receiving sound Pi immediately push Temperature set button to immediately push Temperature set button to set to 64 F 18...

Страница 60: ...er one of float SW or fan motor is abnormal 2 Restricted to the normal time if short circuiting DISP pin CN72 on the indoor P C board in addition to short circuit of CHK pin CN71 on the indoor P C board the minimum opening degree 30pls can be set to the indoor PMV only When open DISP pin the maximum opening degree 1500pls can be obtained again Howtoclear Open CHK pin While the system is operating ...

Страница 61: ...ed one of the indoor unit Nos under group control is displayed in turn Then the fan and louver of the selected indoor unit move 3 Use the button to select the CODE No DN code of the desired function 4 Use the button to select the desired SET DATA associated with the selected function 5 Push the button The display changes from flashing to steady To change the selected indoor unit go back to step 2 ...

Страница 62: ...ader unit of group 0099 Unfixed 19 Louver type Air direction adjustment 0000 No louver 0001 Swing only According to type 0002 1 way Air Discharge Cassette type Under Ceiling type 0003 2 way Air Discharge Cassette type 0004 4 way Air Discharge Cassette type 28 Automatic restart of power failure 0000 None 0001 Restart 0000 None 2A Selection of option error input CN70 0000 Filter input 0002 None 0001...

Страница 63: ...ault 0001 High ceiling 1 0003 High ceiling 3 9 10 3 0 10 10 3 3 11 10 3 6 11 6 3 5 10 10 3 3 11 6 3 5 12 6 3 8 12 6 3 8 12 6 3 8 11 10 3 6 12 10 3 9 13 9 4 2 14 9 4 5 13 9 4 2 14 5 4 4 15 1 4 6 15 1 4 6 14 9 4 5 Type DN code 10 1 Default value stored in EEPROM mounted on service P C board Indoor Unit Capacity DN code 11 1 Default value stored in EEPROM mounted on service P C board Value Type Model...

Страница 64: ...ion signal Output during normal operation 3 Error signal Output during alarm Serial communication error or indoor outdoor protective device operation 2 Wiring diagram using remote control interface TCB IFCB 4UL Input IFCB 4UL No voltage ON OFF serial signal Output No voltage contact for operation error display Contact capacity Below Max AC240V 0 5A 1 2 3 4 5 6 CN61 T10 YEL 1 2 3 4 1 2 3 4 5 6 CN13...

Страница 65: ...trol are displayed succes sively In this time the fan of the selected indoor unit only turns on 3 Using the setup temp or button specify the CODE No 31 4 Using the timer time or button select the SET DATA At shipment 0000 0000 0000 0000 0000 The setup data are as follows SET DATA 0000 0001 Handling of operation of air to air heat exchanger or ventilating fan Unavailable At shipment Available 5 Pus...

Страница 66: ...ut from the card switch box When the card switch box does not perform the above contact operation convert it using a relay with b contact 2 Operation Handle the wired remote controller switch in the following procedure Use the wired remote controller switch during stop of the system 1 Push concurrently SET CL TEST buttons for 4 seconds or more 2 Using the setup temp or button specify the CODE No 2...

Страница 67: ...000 to Individual 0001 0001 0001 0001 0001 to Header unit and 0002 0002 0002 0002 0002 to follower unit 10 Push SET button OK when display goes on 11 Push TEST button Setup completes The status returns to the usual stop status Note 1 When setting the line address from the remote controller do not use Address 29 and 30 As they are addresses which cannot be set to the outdoor unit if they are set th...

Страница 68: ...oor units in group control stop Procedure The indoor unit numbers in the group control are successively displayed and fan louver and drain pump of the corresponding indoor unit are turned on Follow to the procedure during operation 1 Push VENT and TEST buttons simultaneously for 4 seconds or more Unit No is displayed Fans and louvers of all the indoor units in the group control operate 2 Every pus...

Страница 69: ...LOUVER SWING FIX button Ø 3 Determine the selected line address using SET button The address of the indoor unit connected to the refrigerant piping of the selected outdoor unit is dis played and the fan and the louver are on Ø 4 Every pushing UNIT LOUVER button button at left side the indoor unit No in the identical piping is displayed one after the other Only fan and louver of the selected indoor...

Страница 70: ... a group the fan and louvers of the selected unit will be energized Ø 3 Push the TEMP buttons repeatedly to select 13 13 13 13 13 for CODE No Ø 4 Push the TIME buttons repeatedly to change the value indicated in the SET DATA sec tion 5 Push the SET SET button to save address Ø 6 Push left and of the UNIT LOUVER UNIT LOUVER button repeatedly to select another indoor unit addresses to change Repeat ...

Страница 71: ... AC AC AC AC Address Change are displayed Ø 2 Select line address using UNIT LOUVER SWING FIX button Ø 3 Push the SET button The address of the indoor unit connected to the refrigerant piping of the selected outdoor unit is displayed and the fan and the louver are on First the current indoor address is displayed Line address is not displayed Ø 4 TIME button push up down the indoor address of the S...

Страница 72: ...art in the following figure is counted as 0005 0005 0005 0005 0005 0004 0004 0004 0004 0004 0003 0003 0003 0003 0003 0002 0002 0002 0002 0002 0001 0001 0001 0001 0001 0000 0000 0000 0000 0000 with 5 seconds interval When 0000 0000 0000 0000 0000 appear the error was cleared However counting from 0005 is repeated on the display screen 4 When pushing TEST button the status becomes normal How to clea...

Страница 73: ...l up the service monitor mode The service monitor goes on and firstly the temperature of the CODE No 00 00 00 00 00 is displayed Ø 2 Push TEMP button to change CODE No CODE No to the CODE No to be monitored For display code refer to the following table Ø 3 Push UNIT LOUVER button to change to item to be monitored The sensor temperature of indoor unit or outdoor unit in its refrigerant line and the...

Страница 74: ...or unit individual data 2 4 50 60 Compressor 1 revolutions 10 rps 0642 64 2rps 51 61 Compressor 2 revolutions 10 rps 52 62 Compressor 3 revolutions 10 rps 53 63 Outdoor fan mode 1 mode 0058 58 mode 54 64 Compressor IPDU 1 heat sink temperature 1 F 0075 75 F 24 C 55 65 Compressor IPDU 2 heat sink temperature 1 F 56 66 Compressor IPDU 3 heat sink temperature 1 F 57 67 Outdoor fan IPDU heat sink temp...

Страница 75: ... first half during communication with remote controller Header unit of group In the group indoor unit D504 flashes for 5 seconds with 0 2 second interval at the latter half during communication between header and follower unit Goes on for 0 1 second goes off for 0 1 second High wall type wireless remote controller A B selection Using 2 wireless remote controllers for the respective air conditioner...

Страница 76: ...d louver of the selected indoor unit operate Procedure 3 1 Using temp setup TEMP buttons specify CODE No 33 CODE No 33 Fahrenheit display 2 Using timer TIME buttons change the line address from 0001 to 0000 3 Push SET button In this time the setup finishes when the display changes from flashing to lighting Procedure 4 After check of the changed contents push TEST button Setup is determined When pu...

Страница 77: ...d it just be the 3 minute delay period 3 minutes after compressor shutdown Could it just be the air conditioner having gone thermo OFF Could it just be the air conditioner operating in fan mode or put on the timer Could it just be the system going through initial communication 2 An indoor fan would not start Could it just be cold air discharge prevention control which is part of heating 3 An outdo...

Страница 78: ...ion between indoor header and follower unit Periodic communication between indoor header and follower units cannot be maintained F01 ALT Indoor heat exchanger temperature sensor TCJ error Heat exchanger temperature sensor TCJ has been open short circuited F02 ALT Indoor heat exchanger temperature sensor TC2 error Heat exchanger temperature sensor TC2 has been open short circuited F03 ALT Indoor he...

Страница 79: ...een set as master remote controller in two remote controller control alarm and shutdown for header unit and continued operation for follower unit Check code Display of receiving unit Typical fault site Description of error TCC LINK central control Outdoor 7 segment display Indicator light block Sub code Flash C05 No indication when main remote controller also in use Faulty central control communic...

Страница 80: ...nt line E20 Connection to other refrigerant line found during automatic address setting Indoor unit from other refrigerant line is detected while indoor automatic address setting is in progress E23 E23 Outdoor outdoor communication transmission error Signal cannot be transmitted to other outdoor units E25 E25 Duplicated follower outdoor address There is duplication in outdoor addresses set manuall...

Страница 81: ...e temperature sensor TD2 has been detected H16 01 TK1 oil circuit error 02 TK2 oil circuit error 03 TK3 oil circuit error 04 TK4 oil circuit error 05 TK5 oil circuit error H16 Oil level detection circuit error No temperature change is detected by temperature sensor for oil level detection TK1 5 despite compressor having been started H25 H25 Outdoor discharge temperature sensor TD3 wiring error Wir...

Страница 82: ...t P13 P13 ALT Outdoor liquid backflow detection error State of refrigerant cycle circuit indicates liquid backflow operation P15 01 TS condition 02 TD condition P15 ALT Gas leak detection Outdoor suction temperature sensor TS1 detects sustained and repeated high temperatures that exceed standard value P17 P17 ALT Outdoor discharge TD2 temperature error Outdoor discharge temperature sensor TD2 dete...

Страница 83: ...ted H03 01 Compressor 1 02 Compressor 2 03 Compressor 3 H03 Current detection circuit error Abnormal current is detected while inverter compressor is turned off P04 01 Compressor 1 02 Compressor 2 03 Compressor 3 P04 ALT Activation of high pressure SW High pressure SW is activated P07 01 Compressor 1 02 Compressor 2 03 Compressor 3 P07 ALT Heat sink overheating error Temperature sensor built into ...

Страница 84: ...rformed when system at rest 1 Invoke the SERVICE CHECK mode by pressing the buttons simultaneously and holding for at least 4 seconds The letters SERVICE CHECK light up and the check code 01 is displayed indicating the error history This is accompanied by the indoor unit No to which the error history is related and a check code 2 To check other error history items press the button to select anothe...

Страница 85: ...rloading E19 Error in number of outdoor header units E20 Detection of refrigerant piping communication error during automatic address setting E23 Faulty transmission in outdoor outdoor communication E25 Duplicated follower outdoor address E26 Faulty reception in outdoor outdoor communication dropping out of outdoor unit E28 Outdoor follower unit error E31 IPDU communication error P01 Indoor AC fan...

Страница 86: ...discharge temperature sensor TD1 H06 Abnormal drop in low pressure sensor Ps reading Protective shutdown of outdoor unit H07 Abnormal drop in oil level H08 Error in temperature sensor for oil level detection circuit TK1 TK2 TK3 TK4 or TK5 H15 Wiring installation error or detachment of outdoor discharge temperature sensor TD2 H16 Oil level detection circuit error Error in outdoor unit TK1 TK2 TK3 T...

Страница 87: ...st run in progress Setting incompatibility automatic cooling heating setting for model incapable of it and heating setting for cooling only model Light block Check code Cause of fault Operation Synchronized blinking Timer Ready Operation Timer Synchronized blinking Ready Alternate blinking Operation Timer Ready ...

Страница 88: ...ation error detected at indoor end Stop of corresponding unit There is no communication from remote controller including wireless or network adaptor Check remote controller and network adaptor wiring E04 Indoor unit Indoor outdoor communication circuit error detected at indoor end Stop of corresponding unit Indoor unit is not receiving signal from outdoor unit Check order in which power was turned...

Страница 89: ...c address setting is started while automatic address setting for equipment in other refrigerant line is in progress Outdoor automatic address setting is started while automatic address setting for indoor units is in progress Perform automatic address setting again after disconnecting communication cable to that refrigerant line E15 E15 I F Indoor unit not found during automatic address setting All...

Страница 90: ...ted to other outdoor units for at least 30 seconds continuously Check power supply to outdoor units Is power turned on Check connection of tie cables between outdoor units for bad contact or broken wire Check communication connectors on outdoor P C boards Check for defect in outdoor P C board I F Check termination resistance setting for communication between outdoor units E25 E25 I F Duplicated fo...

Страница 91: ... of corresponding unit Sensor resistance is infinity or zero open short circuit Check connection of TC1 sensor connector and wiring Check resistance characteristics of TC1 sensor Check for defect in indoor P C board F04 F04 I F TD1 sensor error All stop Sensor resistance is infinity or zero open short circuit Check connection of TD1 sensor connector Check resistance characteristics of TD1 sensor C...

Страница 92: ...r TE1 TL All stop During compressor operation in HEAT mode TE1 continuously provides temperature reading higher than indicated by TL by at least specified margin for 3 minutes or more Check installation of TE1 and TL sensors Check resistance characteristics of TE1 and TL sensors Check for outdoor P C board I F error F16 F16 I F Outdoor pressure sensor wiring error Pd Ps All stop Readings of high p...

Страница 93: ... wiring particularly for open phase Check connection of connectors terminals on A3 IPDU P C board Check conductivity of case heater Check for refrigerant entrapment inside compressor Check for defect in outdoor P C board A3 IPDU Check outdoor MG CTT H03 H03 01 Compressor 1 side 02 Compressor 2 side 03 Compressor 3 side IPDU Current detection circuit error All stop Current flow of at least specifie...

Страница 94: ...heck connection of TK1 sensor connector Check resistance characteristics of TK1 sensor Check for defect in outdoor P C board I F All stop Sensor resistance is infinity or zero open short circuit Check connection of TK2 sensor connector Check resistance characteristics of TK2 sensor Check for defect in outdoor P C board I F All stop Sensor resistance is infinity or zero open short circuit Check con...

Страница 95: ...for disconnection of TK3 sensor Check resistance characteristics of TK3 sensor Check for connection error involving TK1 TK2 TK3 TK4 and TK5 sensors Check for faulty operation in SV3E or SV3F valve Check for clogging in oil equalizing circuit capillary and faulty operation in check valve Check for refrigerant entrapment inside compressor No temperature change is detected by TK4 despite compressor h...

Страница 96: ... Indoor unit Connection of group control cable to stand alone indoor unit Stop of corresponding unit There is at least one stand alone indoor unit to which group control cable is connected Check indoor addresses L08 L08 Indoor unit Indoor group addresses not set Stop of corresponding unit Address setting has not been performed for indoor units Check indoor addresses Note This code is displayed whe...

Страница 97: ...n external device 2 Check for defect in indoor P C board When external device is not connected to CN80 connector 1 Check for defect in indoor P C board I F Extended IC error Continued operation There is part failure in P C board I F Check outdoor P C board I F P01 Indoor unit Indoor fan motor error Stop of corresponding unit Check the lock of fan motor AC fan Check wiring P03 P03 I F Discharge tem...

Страница 98: ... phase sequence All stop Open phase is detected when power is turned on Inverter DC voltage is too high overvoltage or too low undervoltage Check for defect in outdoor P C board I F 01 Compressor 1 side 02 Compressor 2 side 03 Compressor 3 side Inverter DC voltage Vdc error compressor MG CTT error P07 P07 01 Compressor 1 side 02 Compressor 2 side 03 Compressor 3 side IPDU I F Heat sink overheating...

Страница 99: ...s side liquid side to confirm full opening Check PMVs PMV1 2 for clogging Check resistance characteristics of TS1 sensor Check for defect in 4 way valve Check SV4 circuit for leakage 02 TD condition I F Gas leak detection TD condition All stop Protective shutdown due to sustained discharge temperature TD1 TD2 or TD3 at or above 226 F 108 C Check for insufficiency in refrigerant quantity Check PMVs...

Страница 100: ...f high pressure protection All stop Pd sensor detects pressure equal to or greater than 522psi 3 6MPa Check for defect in Pd pressure sensor Check service valves gas side liquid side to confirm full opening Check for defect in outdoor fan Check for defect in outdoor fan motor Check outdoor PMVs PMV1 2 4 for clogging Check indoor outdoor heat exchangers for clogging Check for short circuiting of ou...

Страница 101: ...ck fan motor Check connection of fan motor connector Check for defect in fan IPDU P C board All stop Sub code C Higher temperature than the specified value is detected during operation of the fan Check fan motor Check for defect in fan IPDU P C board All stop Sub code D The resistance value of the sensor is infinite or zero open or short circuit Check for defect in fan IPDU P C board All stop Sub ...

Страница 102: ...r defect in central control communication line Check termination resistance setting Check power supply for devices at other end of central control communication line Check defect in P C boards of devices at other end of central control communication line C12 General purpose device I F Blanket alarm for general purpose device control interface Continued operation Error signal is input to control in...

Страница 103: ...ics 0 10 20 10 20 30 40 50 Characteristic 1 Temperature C Indoor TA sensor Resistance kΩ 50 0 100 150 200 5 0 10 15 20 20 30 10 0 10 20 30 40 50 60 70 80 90 100 Characteristic 2 Temperature C Indoor TC1 TC2 TCJ sensors Resistance kΩ 10 C or lower Resistance kΩ 10 C or higher ...

Страница 104: ... suction grille inward and then hang down the suction grille 2 Remove hook of the strap connecting the panel and the suction grille and then remove the suction grille 2 Attachment 1 Hook the suction grille to the panel 2 Attach hook of the suction grille strap to the panel as before 3 Close the suction grille slide the knobs outward and then fix the panel Remarks Suction grille Knobs of the suctio...

Страница 105: ...achment 1 Attach the hinge unit of the electric parts box cover 2 Close the electric parts cover and slide it hook claw of the electric parts box claw of the electric parts box cover and the Dharma doll hole and then insert pin of the bell mouth into hole of the electric parts box cover 3 Tighten the fixing screws A and B and then fix the electric parts box cover 4 Following to work of Attachment ...

Страница 106: ...irst 2 Attachment 1 Hook the strap of the adjust corner cap securely to the pin of the ceiling panel 2 Insert the 2 claws A of the adjust corner cap into rectangular holes of the ceiling panel in the direction of the arrow 3 Press the adjust corner cap so that the 3 claws B on the back of the cap are fitted Remarks Pulling direction Pulling direction Pulling direction Pin Knob Adjust corner cap Cl...

Страница 107: ...through hole of the panel fixing bracket and then slide the panel fixing bracket inward 3 Tighten in the panel fixing screw to fix the ceiling panel 4 Following to work of Attachment of 3 attach the adjust corner cap as before 5 Connect the louver connector CN510 White 20P as before and then fix the lead wire with clamp 6 Following to work of Attachment of 2 mount the electric parts box cover and ...

Страница 108: ...range CN333 Fan motor power supply 5P White CN334 Fan motor position detection 3P White CN82 PMV 6P Blue NOTE Unlock the lock of the housing part and then remove the connector 3 Unlock the locks of the card edge spacer 6 positions and then remove the control P C board 2 Attachment 1 Fix the control P C board to the card edge spacer 6 positions 2 Connect the connector removed in the above Detachmen...

Страница 109: ...p inside turn it to the arrow mark CLOSE direction until the position where Clashed sound is heard and it cannot be turned more over Position where mark of the drain pan matches with mark of the drain cap inside and then fix it NOTE When attaching the drain cap inside remove dirt attached to the packing And tighten in it noting so that the cap is not slantingly set If attaching the drain cap as du...

Страница 110: ...V 6P Blue NOTE Unlock the lock of the housing part and then remove the connector 4 Remove the fixing screws A and B and then remove the electric parts box Fixing screw A M4 0 39 10 mm 3 pcs Fixing screw B M4 0 31 8 mm 1 pc 5 Remove the fan motor lead TC sensor and TCJ sensor from clamp of the bell mouth 6 Remove the fixing screws for the fan guard and then hang down it from the clamps M4 0 39 10 m...

Страница 111: ... the fixing screws and then remove the motor lead holding bracket M4 0 31 8 mm 2 pcs 11 Cut the bundling band and then remove it from the clamp 12 Remove the fixing nut and then remove the fan motor M6 nut 3 pcs 2 Attachment 1 Fix the parts as before in order of fan motor motor lead holding bracket turbo fan nut cap bell mouth fan guard NOTE Fix the motor lead to the clamp without slack as before ...

Страница 112: ...e connector of the drain pump lead wire through the wiring taking out port 2 Connect the drain hose to the drain pump as before NOTE Insert the drain hose up to the end of the drain pump connecting part apply band to the white mark position of the hose and then set the band knob upward 3 Return the drain pump to the indoor unit and then mount it as before using the fixing screws A M4 0 39 10 mm 3 ...

Страница 113: ... Remove the wiring box by removing the fixing screw M4 0 39 10 mm 1pc 4 Remove the fixing screws to remove the drain pan M4 0 39 10 mm 4 pcs 2 Attachment 1 Fix parts as before in order of drain cap drain pan bell mouth wiring box 2 Following to works of Attachment of 7 and works from 2 to 4 attach parts as before 3 Attach the wiring cover and then attach the electric parts box cover as before 4 Fo...

Страница 114: ...otor 3 Peel the butyl rubber adhered to the main unit of the pulse motor valve PMV until PMV can be seen and then loosen the nuts fixing PMV motor with double spanner to remove PMV motor 2 Attachment 1 Mount PMV motor and relay connector as before NOTE Control the tightening torque for the PMV body and PMV motor to 5 8 0 7ft lbs 7 84 0 98Nm Remarks ...

Страница 115: ...e at indoor unit side 4 Remove the fixing screws and then remove the piping cover M4 0 39 10 mm 3 pcs 5 Remove the drain hose from the drain pump and remove the fixing screws A to remove the drain pump stand M4 0 31 8 mm 3 pcs 6 While pushing the heat exchanger remove the fixing band fixing screws B and the heat exchanger M4 0 31 8 mm 3 pcs 2 Attachment 1 Mount the heat exchanger with the fixing b...

Страница 116: ... grille to remove the suction grille 2 Attachment 1 Hook shaft of the suction grille to the panel 2 Hook strap of the suction grille to the original position of the panel 3 Close the suction grille and slide the hooks outward to fix it 1 Detachment 1 Perform work of procedure 1 1 2 Take off screws Ø4 0 39 10mm 3 pcs fixing the electric parts cover 3 Remove the electric parts cover from the tempora...

Страница 117: ...driver otherwise the mechanism of adjust corner cover may be damaged and not be removed 1 Detachment 1 Perform works of procedure 2 1 and 3 1 2 Remove the flap connector CN33 White 5P connected to the control P C board and then take off the lead wire from the clamp NOTE Remove the connectors after unlocking the lock of the housing 3 Take off screws M5 4 pcs fixing the ceiling panel 4 Push the temp...

Страница 118: ... Fan motor power supply 5P White CN334 Fan motor position detection 5P White NOTE Remove the connectors after unlocking the lock of the housing 3 Unlock the lock of the card edge spacer 6 positions and then remove the control P C board 2 Attachment 1 Fix the control P C board to the card edge spacer 6 positions 2 Connect the connectors as original before being removed in item 1 NOTE For drawing of...

Страница 119: ...ring and control wiring 5 Attach the wire cover A and wire cover B Ø4 0 31 8mm 3 pcs 6 Take off 2 screws which fix the electricparts box and then remove the electric parts box 2 Attachment 1 Tighten screws Ø4 0 31 8mm 2 pcs fixing the electric parts box 2 Connect the connectors as original before being removed in item 1 3 Attach the wire cover B 4 Connect the power supply wiring remote control wir...

Страница 120: ...h screws Ø4 0 31 8mm 4 pcs 2 Perform wiring as original before being removed NOTE Pinch lead wire of the drain pump and float switch with lead wire fixing claws of the bell mouth and perform wiring along the guide 1 Detachment 1 Perform work of procedure 8 1 2 Take off the nut M6 nut 1 pc of the turbo fan NOTE Use a box wrench for attachment and detachment of the turbo fan If using a monkey wrench...

Страница 121: ...ss preventing agent as paints to the nut after tightening 2 Attach the fan motor lead wire holder NOTE For the fan motor lead wire fix the lead wire holding bracket along concave part of the ceiling panel There is no catch in of lead wire and ceiling panel When fixing the lead wire bracket tighten fan motor earth together with the lead wire For this work do not use an electric screwdriver Take not...

Страница 122: ... drain pan with screws Ø4 0 31 8mm 4 pcs 1 Detachment 1 Perform work of procedure 11 1 2 Pick up the hose band and slide it from the pump connecting part to remove the drain hose 3 Take off screws Ø4 0 31 8mm 3 pcs fixing the drain pump assembly and then move hooking claw 1 position of the main body from the drain pump assembly to remove the drain pump assembly 2 Attachment 1 Fix the drain pump as...

Страница 123: ...or lead Blue Heat insulation pipe Gas pipe Insert the sensor lead wires Red Blue Black from the positions in the figure Sensor lead Black PMV motor Fix the head of bind band and lead wire at inner side of the position in the figure so that they do not stick out to outside Details of A part 2 76 70 3 15 80 No 13 Part name PMV Pulse Motor Valve Procedure 1 Detachment 1 Perform work of procedure 11 1...

Страница 124: ... heat exchanger remove fixing band and fixing screws Ø4 0 31 8mm 3 pcs and then remove the heat exchanger 2 Attachment 1 Mount parts in order heat exchanger fixing band piping cover drain pan bell mouth electric parts box as original NOTE Arrange wires as original 2 Attach the removed connectors and wires as original 3 Connect the refrigerant pipe as original and then perform vacuuming Remarks 2 f...

Страница 125: ...ide and then hang down the suction grille 2 Remove hinge of the suction grille from the main unit to remove the suction grille Remove the hinge while pushing the claw at the center part with a minus driver etc 2 Attachment 1 Attach hinge of the suction grille to the square hole of the main unit Check that the claw is surely hooked on 2 Close the suction grille and then slide the button to the pane...

Страница 126: ...tric parts cover by removing screws 2 positions which fix the cover M4 0 39 10 mm 2 pcs 2 Attachment 1 Insert the electric parts cover into back side of the electric parts box and then fix it with screws 2 positions M4 0 39 10 mm 2 pcs NOTE Be careful that wires are not caught in the electric parts cover 2 Attach the fan guard as before and then fix it with screws 2 positions 3 Carry out work of A...

Страница 127: ...mporarily at the rear side of the electric parts box to the sheet fittings part of the main unit 2 Attachment 1 Insert the square hole of the electric parts box into the claw of the main unit 2 Attach screws M4 0 39 10 mm 2 pcs to the electric parts box 3 Connect the power supply wire and the remote control wire and control wires as before 4 Carry out works of Attachment of 1 and 2 Remarks Screw C...

Страница 128: ... sensor 3P Brown CN101 TC2 sensor 2P Black CN102 TCJ sensor 2P Red CN104 Room temperature sensor 2P Orange CN333 Fan motor power supply 5P White CN334 Fan motor position detection 5P White CN82 PMV 6P Blue 3 Release locks of the card edge spacers 6 positions and then remove the control P C board 2 Attachment 1 Fix the control P C board with the card edge spacers 6 positions 2 Connect the connector...

Страница 129: ...chment NOTE The following description is detachment method of AP036 to AP042 class as repre sentative 1 Carry out works of Detachment of 2 and 1 2 2 Remove the hooking claws at both sides of the fan case bottom 3 Pull out and remove the fan case bottom from the partition panel 4 Remove the bearing from the main unit by removing the bolts 2 positions which fix the bearing M8 0 47 12 mm 2 pcs SP300 ...

Страница 130: ...pling with the hexagon socket head screws A groove is provided on the shaft in order to match the mounting position with the coupling Mount the coupling by aligning the single face of coupling to the groove and then fix it NOTE Use a torque wrench for fixing with 3 6 ft lbs 4 9Nm or more 6 Position the fan so that the fan locates at the center against the fan case top and then fix it with the hexa...

Страница 131: ...h earth wire and then fix them with the screws 2 Connect the connectors as before which were removed in works of Detachment 3 Carry out work of Attachment of 3 and 5 Remarks 1 Detachment 1 Carry out work of Detachment of 1 2 Remove screws of the side cover One side M4 0 47 12 mm with washer 1 pc 3 Slide the side cover toward discharge direction to remove the side cover 2 Attachment 1 Slide the sid...

Страница 132: ...e drain pan at discharge side If you remove the panel forcibly it may be broken 6 When removing base of the sensor part as shown in the following figure wrap the tip of minus driver with vinyl tape insert it into the groove at the side face under the circle mark of the cover and then remove the base by winkling out 2 Attachment 1 Mount the panel by sliding from discharge side along the drain pan 2...

Страница 133: ... pc AP036 toAP042 Step screw 2 pcs The peeled off insulator is used at attachment work 5 Remove the drain pan while sliding it to discharge side 2 Attachment 1 Insert the drain cap surely up to the end of the drain pan 2 Slide the drain cap from discharge side and then hang it surely to the sheeted hooking section at the fan side 3 Attach step screw removed in the Detachment work and adhere the in...

Страница 134: ...he heat exchanger 7 Take off screws of the heat exchanger at the opposite side of the heat exchanger support while holding the heat exchanger and then remove the heat exchanger Ø4 x 0 31 8mm 2 pcs 2 Attachment 1 Fix the heat exchanger sensors and piping cover as before 2 Perform the work procedure 2 9 3 Connect wire of the refrigerant as before and then perform vacuuming Remarks 1 Detachment 1 Car...

Страница 135: ...r 2 Insert the shaft at opposite side of the above 1 into the shaft hole 3 Insert the central shaft into the louver holder 1 Detachment 1 Carry out work of Detachment of 10 2 Remove the set screws 4 positions and heat exchanger support M4 0 39 10 mm 4 pcs 3 Pull out the sensor is inserted into pipe of the heat exchanger TC1 sensor Blue Tube color TC2 sensor Black Tube color TCJ sensor Red Tube col...

Страница 136: ...de How to assemble the front panel 1 Push 3 center positions and 2 lower center positions of the air outlet and then hang the hanging hooks 4 pcs at the top side of the front panel to the rear plate 2 Tighten four screws Incomplete hanging or incomplete pushing may cause a dewdrops or generation of a fluttering sound 3 Push PUSH part under the front panel and remove hooks of the front panel from t...

Страница 137: ...osition before removing 9 Disengage the display unit by simply pushing at the top of the display unit 10 Remove the fixing screw that secures the electric parts box assembly LED assembly and remove the assembly Same as reassembly pace Addition of the following cautions Cautions in reassembling Mount the electric parts box to the main unit in the reverse order to the removing procedure Determine th...

Страница 138: ...s do not use a monkey wrench In case that the clearance to the ceiling is 4 3 110mm use a spanner with length by 5 9 150 mm or shorter 1 Perform work of item c 2 Perform work of item d 3 Remove the bundling band of PMV motor lead wire 4 Pull off butyl of PMV main unit until the position shown in the right photo 5 Using a spanner remove PMV Caution in reassembling Determine PMV motor lead wire draw...

Страница 139: ...ear side of the main unit 3 Remove 2 fixing screws at the left side of the end plate of the heat exchanger Remarks 4 Remove 2 fixing screws on the heat exchager fixing holder to separate the heat exchager from the back body AP0243 to AP0153 5 Remove 4 fixing screws on the heat exchager fixing holder to separate the heat exchager from the back body AP0123 to AP0073 AP0243 to AP0153 AP0123 to AP0073...

Страница 140: ... the item f 2 Remove the 2 screws used to secure the bearing base 3 Remove the bearing base Remarks Caution at assembling If the bearing is out from the housing push it into the specified position and then incorporate it in the main body Bearing base Bearing 2 screws ...

Страница 141: ...osen the set screw of the cross flow fan 3 Remove 2 fixing screws of the motor cover and them remove the motor cover 4 Remove 2 more fixing screws of the motor band and remove the motor band Remarks 5 Pull the fan motor outward Set screw 2 screws on motor cover 2 screws on motor band ...

Страница 142: ...ping 5 mm from wall of rear plate of the main unit Holding the set screw install the cross flow fan so that U groove of the fan motor comes to the mounting hole of the set screw Perform positioning of the fan motor as follows When assembling the fan motor the fan motor must be installed in such a way that the fan motor leads will be taken out is positioned at the bottom front After assembling the ...

Страница 143: ...ducting a test operation etc Replacement procedure Method 1 If it is possible to turn on the indoor unit and read the setting data from the P C board to be replaced via a wired remote controller Reading EEPROM data Procedure 1 Replacing P C board and turning on power Procedure 2 Writing EEPROM data in new EEPROM Procedure 3 Resetting power supply applicable to all indoor units connected to remote ...

Страница 144: ...el 3 The button allows you to move the CODE No DN code up down by one place 3 4 First change the CODE No DN code from 10 to 01 To set filter sign lighting time Jot down the setting data displayed 5 Change the CODE No DN code using the button Again jot down the setting data displayed 6 Repeat step 5 until all the setting data has been jotted down See the CODE No list CODE No DN code go from 01 to F...

Страница 145: ...r unit being serviced Case 2 a Remove the CN41 connectors of all other indoor units in the same group b Turn on the indoor unit and proceed to Procedure 3 Be sure to restore the temporarily removed group control wiring and CN41 connectors to their initial states after Procedure 3 has been completed CN34 red SW501 J01 J02 MCC 1402 MCC 1570 CN41 CN34 AP007 AP030 AP036 AP042 Cut Present factory defau...

Страница 146: ... if the setting data are displayed 8 Push the button to bring the system back to normal off state 6 4 Next write any setting changes made on site after installation such as address settings in the EEPROM Perform the tasks specified in step 1 again 5 Use the button to set the CODE No DN code to 01 To set filter sign lighting time 6 Check the value displayed with the value jotted down in Procedure 1...

Страница 147: ...ling select 0000 Standard 60 Timer setting wired remote controller 0000 Available F0 Swing mode 0001 Standard F1 Louver fixing position Flap No 1 0000 Not fixed 4 way type only F2 Louver fixing position Flap No 2 0000 Not fixed 4 way type only F3 Louver fixing position Flap No 3 0000 Not fixed 4 way type only F4 Louver fixing position Flap No 4 0000 Not fixed 4 way type only Type Code No 10 Setup ...

Страница 148: ...ata to EEPROM Procedure 3 Ø Power reset If in group operation reset the power for all indoor units which are connected to the remote controller Method 2 Before replacement the setup data can not be read out by the wired remote controller Replace service P C board power ON Procedure 2 Ø Write the data such as option input selection setup to EEPROM Procedure 3 According to the customers information ...

Страница 149: ...umper line cut or setting of DIP switch on the former P C board should be reflected on the service P C board Refer to the following table about DIP switch setting and drawing of P C board parts layout 2 It is necessary to set Indoor unit to be exchanged Remote controller 1 1 Based upon the system configuration turn on power of the indoor unit with one of the following items 1 Single Individual ope...

Страница 150: ... content Terminator resistor for central control Remote controller A B selection Custom Multi model selection No use MMK AP 3H2UL series 1 1 ON OFF At shipment OFF Without terminator OFF A selection OFF OFF A B A B A B Indoor unit P C board Remote controller Group wire Group wire Case 1 Remove the group wire of the terminal blocks A and B of the changed indoor unit and then install the remote cont...

Страница 151: ...ature buttons set 01 01 01 01 01 to the CODE No DN 2 Setup of lighting time of filter sign 6 The contents of the displayed setup data in this time should be agreed with the contents in the previous memorandum in 1 1 If data disagree change the displayed setup data to that in the previous memorandum by the timer time buttons and then push SET button OK when the display goes on 2 There is nothing to...

Страница 152: ...atic restart from power cut Option input selection CN80 Thermo output selection T10 e Input selection T10 c Sensor selection Timer set Wired remote controller Louver selection of cooling Memo Be sure to set as 0008 At shipment 0001 150 hour 0000 Standard 0099 Unfixed 0002 3 6 F 2 C 0000 Standard 0000 Heat pump 0008 High wall type According to capacity type 0099 Unfixed 0099 Unfixed 0099 Unfixed 00...

Страница 153: ...153 11 EXPLODED VIEWS AND PARTS LIST 1 1 4 Way Cassette Type MMU AP0072H2UL AP0092H2UL AP0122H2UL ...

Страница 154: ...DRAIN PAN ASSY DRAIN REFRIGERATION CYCLE ASSY REFRIGERATION CYCLE ASSY MOTOR PMV EDM MD12TF 3 VALVE PMV EDM B25YGTF 3 REMOTE CONTROLLER SX UA01UE REMOTE CONTROLLER WX TA01UES HOSE DRAIN 25A GUARD FAN BAND HOSE CLAMP DOWN CLAMP UP CLAMP WIRE NUT FLARE 1 4 IN SOCKET 3 8 SOCKET 1 4 NUT FLARE 3 8 IN RUBBER CUSHION SCREW FIX PANEL MOTOR FAN SWF 340U60 2 COVER ASSY CAP NUT PUMP ASSY MDP 1401 SWITCH ASSY...

Страница 155: ... 403 404 405 406 2 1 1 1 1 1 2 1 1 1 1 1 2 1 1 1 1 1 43050425 43F50426 43150320 43160574 43160626 4316V447 Sensor Ass y Service TC F6 Sensor Service TA Sensor Ass y Service TG F4 Terminal 4P Terminal Block 2P 20A P C Board Ass y MCC 1570 0072H2UL 0092H2UL 0122H2UL Model Name MMU AP ...

Страница 156: ...156 MMU AP0152H2UL AP0182H2UL AP0212H2UL AP0242H2UL AP0302H2UL ...

Страница 157: ...0 2 241 43119500 COVER ASSY 242 43139166 CAP NUT 244 43177010 PUMP ASSY MDP 1401 245 43151299 SWITCH ASSY FLOAT FS 0218 102 246 43179145 LID ASSY OUTSIDE 247 43170254 SOCKET ASSY DRAIN 248 43197155 WASHER 249 43097212 NUT 250 43107215 HOLDER SENSOR 251 43047609 BONNET 252 43147195 BONNET 1 2 IN 253 43194029 BONNET 254 43149355 NUT FLARE 3 8 IN 255 43049697 BONNET 256 43019904 HOLDER SENSOR TS 257 ...

Страница 158: ...5 Sensor Ass y Service TC F6 402 43F50426 Sensor Service TA 403 43150320 Sensor Ass y Service TG F4 404 43160574 Terminal 4P 405 43160626 Terminal Block 2P 20A 406 4316V447 P C Board Ass y MCC 1570 0152H2UL 0182H2UL 0212H2UL 0242H2UL 0302H2UL Model Name MMU AP 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 ...

Страница 159: ...159 MMU AP0362H2UL AP0422H2UL ...

Страница 160: ... CUSHION 238 43197199 WASHER 239 4312C058 MOTOR FAN ICF 340U150 1 241 43119500 COVER ASSY 242 43139166 CAP NUT 244 43177010 PUMP ASSY MDP 1401 245 43151299 SWITCH ASSY FLOAT FS 0218 102 246 43179145 LID ASSY OUTSIDE 247 43170254 SOCKET ASSY DRAIN 248 43197155 WASHER 249 43097212 NUT 250 43107215 HOLDER SENSOR 251 43047609 BONNET 253 43194029 BONNET 254 43149355 NUT FLARE 3 8 IN 256 43019904 HOLDER...

Страница 161: ...tion No 401 43050425 Sensor Ass y Service TC F6 402 43F50426 Sensor Service TA 403 43150320 Sensor Ass y Service TG F4 404 43160574 Terminal 4P 405 43160626 Terminal Block 2P 20A 250V 406 4316V447 P C Board Ass y MCC 1570 Model Name MMU AP0362H2UL MMU AP0422H2UL 2 2 1 1 1 1 1 1 1 1 1 1 ...

Страница 162: ...08 43101358 Cover Panel Ass y 309 43407148 Plate Fix Panel 310 43407149 Plate Fix Panel 311 43407150 Hook 312 43407154 Cap AXIS 313 43403010 Cover Ass y Motor 314 43403011 Cover Ass y 315 43403012 Cover Ass y 316 43407155 Fix Motor 317 43407156 Fix Motor 318 43460125 Lead Motor 319 43400077 Panel Front Model Name RBC U31PG W UL 1 1 4 2 2 4 3 1 2 2 2 4 2 1 1 2 2 1 1 319 312 315 317 313 314 305 304 ...

Страница 163: ...Location Part No Description No 353 43459011 P C Board Ass y Remote Receiver 354 43462010 Cover WRS 355 43461006 Sheet 356 43108018 Cover Panel WRS 357 43160599 Lead Model Name RBC AX31U W UL 1 1 1 1 1 354 357 353 355 356 ...

Страница 164: ...164 11 2 Compact 4 way Cassette Type MMU AP0071MH2UL AP0091MH2UL AP0121MH2UL AP0151MH2UL AP0181MH2UL ...

Страница 165: ... 43179135 BAND HOSE 232 43149314 SHEET PMV 233 43139137 RUBBER CUSHION 234 43162056 COVER E BOX 235 43177015 PUMP DRAIN ADP 1406 236 43151289 SWITCH FLOAT FS 0218 103 237 43179126 RUBBER PUMP DRAIN 238 43166013 REMOTE CONTROLLER SX TA01UE 239 43166015 REMOTE CONTROLLER SX UA01UE 240 43166014 REMOTE CONTROLLER SX TB01UE 241 43166016 REMOTE CONTROLLER WX TA01UES 245 43119514 GUARD FAN 246 43149355 N...

Страница 166: ... Service TA 403 43050320 Sensor Ass y Service TG F4 404 43160574 Terminal 4P 405 43160626 Terminal Block 2P 20A 250V 406 4316V445 P C Board Ass y MCC 1402 Model Name MMU AP 0071MH2UL 0091MH2UL 0121MH2UL 0151MH2UL 0181MH2UL 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 ElectricParts ...

Страница 167: ...ER 304 43497012 SCREW 305 43100322 COVER PANEL ASSY 306 43107259 GRILLE CATCH 307 43122089 COVER JOINT FOR JOINT 308 43122090 COVER JOINT FOR MOTOR 309 43122091 JOINT KIT A 310 43122092 JOINT KIT B 311 43122093 LOUVER 312 43107261 OUTLET AIR FORM 313 43100369 PANEL 314 43107262 FIX MOTOR 315 43107263 FIX MOTOR 316 43160580 LEAD MOTOR Model Name RBC UM11PG W UL 1 2 1 4 4 2 3 1 2 2 4 4 1 1 1 1 ...

Страница 168: ...168 11 3 Ceiling Type MMC AP0181H2UL AP0241H2UL AP0361H2UL AP0421H2UL ...

Страница 169: ... DISTRIBUTOR ASSY 220 43147739 DISTRIBUTOR ASSY 221 43147740 DISTRIBUTOR ASSY 222 43179136 BAND HOSE 223 43125131 BEARING SHAFT 224 43125162 COUPLING 225 43047685 NUT FLARE 1 4 IN 226 43149355 NUT FLARE 3 8 IN 227 43049776 SOCKET 3 8IN 228 43149351 SOCKET 1 4IN 229 43047688 NUT FLARE 1 2 IN 230 43149352 NUT FLARE 5 8 IN 231 43149353 SOCKET 1 2IN 232 43149354 SOCKET 5 8IN 233 43060029 FILTER N0ISE ...

Страница 170: ...NET 1 2 IN 262 43194029 BONNET 263 43049697 BONNET 264 43019904 HOLDER SENSOR TS 265 43149314 SHEET PMV 266 43196010 BUSHING 267 43162050 BUSHING 56DIA 268 43139153 SPACER BEARING 269 43197189 SCREW FIX DRAIN PAN 270 43147664 STRAINER 271 43166013 REMOTE CONTROLLER SX TA01UE 272 43166014 REMOTE CONTROLLER SX TB01UE 273 43166015 REMOTE CONTROLLER SX UA01UE 274 43166016 REMOTE CONTROLLER WX TA01UES ...

Страница 171: ...50426 Sensor Service TA 403 43150320 Sensor Ass y Service TG F4 404 43160574 Terminal 4P 405 43160626 Terminal Block 2P 20A 250V 406 4316V445 P C Board Ass y MCC 1402 Model Name MMC AP0181H2UL AP0241H2UL AP0361H2UL AP02421H2UL 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 405 404 403 402 401 4 406 ...

Страница 172: ...0093H2UL AP0123H2UL CAUTION For orders of the service parts for High Wall type air conditioners please check the service parts on Web site of TOSHIBA CARRIER THAILAND CO Ltd and then place an order for parts to TOSHIBA CARRIER THAILAND CO Ltd ...

Страница 173: ...49044 Cover PMV 220 43T82010 Plate Installation 222 43T21032 Motor Fan ICF 340U30 1 223 43T07023 Holder Sensor 224 43T09045 Louver Horizontal 225 43T22011 Bearing Base 232 43T85510 Owner s Manual 233 43T15002 Display 234 43T00057 Panel Ass y 235 43T62032 Clamp Base Ass y 236 43T47044 Pipe Inlet 237 43T46031 Body PMV EDM 25YGTCTH 1 238 43T03018 Body Ass y Back 240 43T44037 Evaporator Ass y 241 43T3...

Страница 174: ...174 MMK AP0153H AP0183H AP0243H ...

Страница 175: ... Guide 219 43T49044 Cover PMV 220 43T82010 Plate Installation 221 43T03017 Body Ass y Back 222 43T21032 Motor Fan ICF 340U30 1 223 43T07023 Holder Sensor 224 43T09045 Louver Horizontal 225 43T22011 Bearing Base 226 43T44034 Evaporator Ass y 227 43T44035 Evaporator Ass y 228 43T47039 Pipe Outlet 229 43T47040 Pipe Outlet 230 43T46032 Body PMV EDM 40YGTCTH 1 231 43T47041 Pipe Inlet 232 43T85510 Owner...

Страница 176: ...lock 4P 1A 405 43T69320 Sensor TA 406 43T69906 P C Board Ass y MCC 1510 407 43T69084 P C Board Ass y MCC 5044 408 43T21397 Louver Motor MP24Z3T Model Name MMK AP 402 401 405 403 404 406 408 407 ElectricParts 0073H2UL 0093H2UL 0123H2UL 0153H2UL 0183H2UL 0243H2UL 1 1 1 1 1 1 2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 ...

Страница 177: ... recent increase in the number of high concentration buildings however the installation of multi air conditioner systems is on the increase because of the need for effective use of floor space individual control energy conservation by curtailing heat and carrying power etc Most importantly the multi air conditioner system is able to replenish a large amount of refrigerant compared with conventiona...

Страница 178: ...7 AP009 and AP012 type Revision 3 Oct 2014 Page 165 Change of service part number of PMV motor Revision 2 Sep 2014 Page 8 9 4 Way Cassette weight changed Compact 4 Way Cassette weight changed Page 15 16 Compact 4 way Cassette CONSTRUCTION VIEWS changed Page 12 13 14 4 Way Cassette CONSTRUCTION VIEWS changed TOSHIBA CARRIER CORPORATION 72 34 Horikawa cho Saiwai ku Kawasaki shi Kanagawa 212 8585 JAP...

Результаты поиска

Содержание Carrier MMC-AP0181H2UL

Отзывы:

Похожие инструкции для Carrier MMC-AP0181H2UL

Бренды по названию

Популярные бренды

Toshiba Carrier MMC-AP0181H2UL, Руководство по обслуживанию

Результаты поиска

Содержание Carrier MMC-AP0181H2UL

Отзывы:

Похожие инструкции для Carrier MMC-AP0181H2UL

Бренды по названию

Популярные бренды