background image

OWNER MAINTENANCE

  6-7

ways wash thoroughly after any contact. Keep
used oils out of reach of children. It is illegal
to pollute drains, water courses and soil. Use
only authorized waste collection facilities
including civic amenity sites and garages for
the disposal of used oil and oil filters. If in
doubt, contact the local authority for dis-
posal instructions.

SG050A1-E

ENGINE COOLANT CHECKING
AND REPLACING
WARNING:

Do not remove the radiator cap when the
engine is hot, since the system is pressurized
and coolant may be ejected from the radiator
resulting in scalding.

SG050B1-E

Coolant recommendations

Only ethylene glycol based coolant with a corro-
sion inhibitor suited to aluminium alloy engine
components should be used in the cooling sys-
tem. No further additives or inhibitors should be
used. The coolant specific gravity should be
checked as prescribed in the maintenance sched-
ule to ensure adequate frost and corrosion pro-
tection. In addition, the engine coolant must be
replaced at the specified interval since the corro-
sion inhibitor properties deteriorate with time.
It is important to note that whilst an increase in the
concentration of anti freeze gives an increase in
the level of frost protection, a solution which is in
excess of 65% anti freeze will result in reduced
frost protection and engine overheating. There-
fore the recommended concentration of 50%
should not be exceeded for general use.
The use of methanol based anti freeze com-
pounds may result in engine overheating and will
invalidate the vehicle warranty.

NOTE:

It is imperative that vehicles fitted with an air
conditioning system have a coolant concen-
tration of the recommended strength at all
times. The use of the air conditioning system
when the cooling system is filled with water
only will result in the heater matrix freezing
and subsequently bursting.

SG050C1-E

Engine Coolant Level

The  engine coolant level may be observed
through the side of the plastic coolant reservoir
(expansion tank) when the engine is cold. If the
level is below the "LOW" mark, add coolant of the
correct concentration until the level is between
the "LOW" and "Full" marks. If the level falls
below the "LOW" mark on a regular basis despite
being topped up, consult a Hyundai dealer.

SG050D1-E

To Change the Engine Coolant

The engine coolant should be changed at those
intervals specified in the vehicle maintenance
schedule in Section 5.

NOTE:

Care should be taken to ensure that coolant
is not allowed to spill onto the paintwork
since the finish may become damaged. If
coolant spillage occurs, the affected area
should be rinsed thoroughly with water.

1. Park the vehicle on level ground and ensure

that the parking brake is firmly applied, and
the engine allowed to cool.
DO NOT ATTEMPT THIS OPERATION
WHILST THE ENGINE IS HOT SINCE
BURN-ING OR SCALDING MAY RESULT.

2. Prepare a suitable receptacle to collect the

displaced coolant and position this under the
radiator drain tap.

HGK187

Содержание 2003 Coupe Tiburon

Страница 1: ...uld be considered a part of the car and remain with it when it is sold for the use of the next owner OWNER S I D ORIGINAL ADDRESS DATE OF SALE SUBSEQUENT ADDRESS TRANSFER DATE NAME STREET TOWN COUNTY P CODE NAME STREET TOWN COUNTY P CODE ...

Страница 2: ...s your responsibility to see that all maintenance operations specified by the manufacturer are carried out at the appropriate intervals When the vehicle is used in severe driving conditions more frequent maintenance is required for some operations Maintenance requirements for severe operating conditions are also included in Section 5 ...

Страница 3: ...rovement may be carried out This manual applies to all Hyundai models and includes descriptions and explanations of optional as well as standard equipment As a result you may find material in this manual that does not apply to your specific vehicle Please note that in Coupe Tiburon models are equipped with Right Hand Drive RHD The explanations and illustrations for some operations in RHD models ar...

Страница 4: ...ransmitted in any form or by any means without the prior written permission of Hyundai Motor Company A040A01A AAT FOREWORD Thank you for choosing Hyundai We are pleased to welcome you to the growing number of discriminating people who drive Hyundais The advanced engineering and high quality construction of each Hyundai we build is something of which we re very proud Your Owner s Manual will introd...

Страница 5: ...HYUNDAI 2 1 3 WHAT TO DO IN AN EMERGENCY 3 1 4 CORROSION PREVENTION APPEARANCE CARE 4 1 5 VEHICLEMAINTENANCEREQUIREMENTS 5 1 6 DO IT YOURSELFMAINTENANCE 6 1 7 EMISSIONCONTROLSYSTEMS 7 1 8 CONSUMERINFORMATION 8 1 9 VEHICLESPECIFICATIONS 9 1 10 INDEX 10 1 1 2 3 4 5 6 7 10 8 9 ...

Страница 6: ...mage are not covered by the vehicle manufacturer s warranty A080A01S AAT TWO WAY RADIO OR CELLULAR TELEPHONE INSTALLATION Your vehicle is equipped with electronic fuel injection and other electronic components It is possible for an improperly installed adjusted two way radio or cellular telephone to adversely affect electronic systems For this reason we recommend that you carefully follow the radi...

Страница 7: ...ion may result in harm serious injury or death to you or other persons if the warning is not heeded Follow the advice provided with the warning CAUTION This indicates that a condition may result in damage to your vehicle or its equipment if the caution is not heeded Follow the advice provided with the caution NOTE This indicates that interesting or helpful information is being provided ...

Страница 8: ...uirements Using imitation counter feit or used salvage parts are not cov ered under the Hyundai New Vehicle Limited Warranty or any other Hyundai warranty In addition any damage to or failure of Genuine Hyundai Parts caused by the installation or failure of an imitation counterfeit or used sal vage part is not covered by Hyundai Motor Company 3 How can you tell if you are purchas ing Hyundai Genui...

Страница 9: ...e Methanol Fuelscontainingmethanol woodalcohol should notbeusedinyourHyundai Thistypeoffuelcan reduce vehicle performance and damage com ponents of the fuel system CAUTION Your Hyundai s New Vehicle Limited War ranty may not cover damage to the fuel sys tem and performance problems that are caused by the use of methanol or fuels con tainingmethanol B010E01A AAT Gasolines for Cleaner Air Tohelpcont...

Страница 10: ... SSA1030B A code number is stamped on the key number plate that came with the keys to your Hyundai This key number plate should be kept in a safe place notinthevehicle Thekeynumbershould alsoberecordedinaplacewhereitcanbefound in an emergency If you need additional keys or if you should lose your keys your authorized Hyundai dealer can make new keys if you can supply the key num ber B880A01A GAT I...

Страница 11: ...ovidedbyHyundaiforsecurityreasons If you need additional keys or if you should lose your keys your authorized Hyundai dealer can make new keys B880D01GK GAT Limp Home Procedures In case the immobilizer system is out of order you cannot start the engine without the limp home procedures with ignition key The following procedure is how to start the en gine with the function of the limp home 0 1 2 3 a...

Страница 12: ...ttheredmarkonthe switch is not visible then close the door NOTE o Whenlockingthedoorthisway becareful not to lock the door with the ignition key left in the vehicle o To protect against theft always remove the ignition key close all windows and lock all doors when leaving your vehicle unattended B040D01S AAT Locking From the Inside To lock the doors from the inside simply close the door and push t...

Страница 13: ...e sure that the engine hood and tail gate are closed 3 Lock the doors using the transmitter of the keyless entry system After completion of the steps above the turn signal light will blink once to indicate that the system is armed NOTE 1 If any door tail gate or engine hood re mainsopen thesystemwillnotbearmed 2 If this happens rearm the system as de scribedabove 3 Once the system is armed only th...

Страница 14: ...Replacing the battery When the transmitter s battery begins to get weak it may take several pushes on the button to lock or unlock the doors and the LED will not light Replace the battery as soon as possible Battery type CR2032 Replacementinstructions 1 Carefully separate the case with a blade screwdriver as shown in the illustration HGK122 Screwdriver HGK121 Battery 2 Remove the old battery from ...

Страница 15: ...vided on the arm rest of the driver s door To disable the passenger s power window push the window lock switch To revert to normal operation push in on the window lock switch again B050A02GK CAUTION Nevertrytooperatethemainswitchandsub switch in opposing directions at the same time If this is done the window will stop and cannot be opened or closed Auto Down Window Driver s Side If Installed TheAu...

Страница 16: ...k is reclined B080D02A AAT Adjustable Headrests Headrestsaredesignedtohelpreducetheriskof neckinjuries Toraisetheheadrest pullitup To lower it push it down while pressing the lock knob WARNING o For maximum effectiveness in case of an accident theheadrestshouldbeadjusted so the top of the headrest is at the same height as the top of the occupant s ears HGK049 Lock Knob B080A01A AAT ADJUSTABLE FRON...

Страница 17: ...er s Seat Only If Installed To raise or lower the front part of the seat cush ion turn the knob forward or rearward HGK052 SOFT FIRM HGK050 B100A01Y AAT SEAT WARMER If Installed The seat warmer is provided to warm the front seats during cold weather With the ignition key in the ON position push either of the switches towarmthedriver sseatorthepassenger sseat During mild weather or under conditions...

Страница 18: ...pulling up the walk in device lever 1 the seatback is reclined and returned to the original position WARNING Don tdrivewiththepassengersideseatback reclined It is dangerous to move it while driving Be sure the seatback is caterred firmly before driving B130A01GK AAT REAR SEAT ENTRY Walk in device The driver and front passenger s seatbacks should be tilted to enter the rear seat HGK053 2 1 Bypullin...

Страница 19: ...jects than could otherwise be accommodated Never allow passengers to sit on top of the folded down seat back while the car is moving as this is not a proper seating position and no seat belts are available for use This could result in injury in case of an accident or sudden stop Objects carried on the folded downseatbackshouldnotextendhigherthan the top of the front seats This could allow cargo to...

Страница 20: ...allseatbeltsbeinspected periodically for wear or damage of any kind Parts of the system that are damaged should be replaced as soon as possible B160C01A AAT Keep Belts Clean and Dry Seat belts should be kept clean and dry If belts become dirty they can be cleaned by using a mildsoapsolutionandwarmwater Bleach dye strong detergents or abrasives should not be usedbecausetheymaydamageandweakenthe fab...

Страница 21: ... when the vehicle is moving o Themisadjustmentofheightoftheshoul derbeltcouldreducetheeffectivenessof the seat belt in a crash Tofastenyourseatbelt pullitoutoftheretractor andinsertthemetaltabintothebuckle Therewill be an audible click when the tab locks into the buckle Theseatbeltautomaticallyadjuststotheproper lengthonlyafterthelapbeltisadjustedmanually so that it fits snugly around your hips If...

Страница 22: ...the vehiclemayhelpprovideagoodshoulder belt fit The lap belt portion of the lap B210A01A AAT To Release the Seat Belt Theseatbeltisreleasedbypressingtherelease buttoninthelockingbuckle Whenitisreleased the belt should automatically draw back into the retractor If this does not happen check the belt to be sure it is not twisted then try again FUA1090R B230A03A GAT CHILD RESTRAINT SYSTEM If Installe...

Страница 23: ...eat in ordertoraisethechild sseatingheightso thattheseatbeltwillproperlyfitthechild o Neverallowachildtostanduporkneelon the seat o Never use an infant carrier or child safety seat that hooks over a seatback it may not provide adequate security in an acci dent o Neverallowachildtobeheldinaperson s armswhiletheyareinamovingvehicle as this could result in serious injury to the child in the event of ...

Страница 24: ...t seat should be of appropriate size for the child and should be installed in accordance with the manufacturer s instructions It is further re quiredthattheseatbeplacedinthevehicle srear seat since this can make an important contribu tion to safety Your vehicle is provided with two childrestrainthookholdersforinstallingthechild seat or infant seat B230B01Y Cover Child Restraint Hook Holder Bolt Ho...

Страница 25: ... ask your Hyundai dealer in this respect B230D02GK ISOFIX Anchor ISOFIX Anchor Position Indicator On each side of the rear seat between the cushionandbackrest arelocatedapairofISOFIX anchoragepointstogetherwithatoptethermount ing on the luggage compartment During the installing the seat has to be engaged at the anchorage points in a way you can hear it click ing checkbypulling andhastobefixedwitht...

Страница 26: ...leforforward facing universal cat egory restraints approved for use in this mass group L1 Suitablefor RömerISOFIXGR1 approved for use in this mass group Approval No E1 R44 03301133 X Seatpositionnotsuitableforchildreninthis mass group N A No seating position is provided WARNING o There is no center rear seating position o Do not install a child restraint seat at the center of the rear seat using t...

Страница 27: ...bag warning light 2 Seat belt pre tensioner assembly 3 SRS control module WARNING To obtain maximum benefit from a pre tensioner seat belt 1 The seat belt must be worn correctly 2 The seat belt must be adjusted to the correctposition ly or if the occupant tries to lean forward too quickly the seat belt retractor will lock into posi tion Incertainfrontalcollisions thepre tensioner will activate and...

Страница 28: ...e the glove box The Hyundai SRS consists of airbags installed underthepadcoversinthecenterofthesteering wheelandthepassenger ssidefrontpanelabove the glove box The purpose of the SRS is to provide the vehicle s driver and or the front pas senger with additional protection than that of fered by the seat belt system alone in case of a frontal impact of sufficient severity NOTE Besuretoreadinformatio...

Страница 29: ...makesuretheyarealwaysproperlybelted and that the seat is moved back as far as possible o Formaximumsafetyprotectioninalltypes of crashes all occupants including the drivershouldalwaysweartheirseatbelts whether or not an airbag is also provided at their seating position to minimize the risk of severe injury or death in the event ofacrash Donotsitorleanunnecessarily close to the airbag while the veh...

Страница 30: ...e ON position If the SRS SRI does not come on or illuminates continuously when the ignition key is turned to ON or continuously remains onafterflashingforabout6secondswhen the ignition key is turned to the ON position or after the engine is started comes on while driving the SRS is not workingproperly Ifthisoccurs haveyour vehicle immediately inspected by your Hyundaidealer o Beforeyoureplaceafuse...

Страница 31: ... an umbrella bag etc between the front door and the frontseat Suchobjectsmaybecomedan gerous projectiles and cause injury if the supplementalsideimpactairbaginflates Your Hyundai is equipped with a side impact airbag in each front seat The purpose of the airbagistoprovidethevehicle sdriverand orthe front passenger with additional protection than that offered by the seat belt alone The side impact ...

Страница 32: ... a child restraint system in the front passenger seat position A child restraint system must never be placedinthefrontseat Theinfantorchild could be severely injured by an airbag deployment in case of an accident o Extreme Hazard Do not use a reward facing restraint on a seat protected by an airbag in front of it o Modification to SRS components or wir ing including the addition of any kind of bad...

Страница 33: ... Steering Wheel Tilt Lever 16 Horn and Driver s Airbag 17 Cruise Control Switch If installed 18 Heating and Cooling Controls 19 Ashtray 20 Cigarette Lighter 21 Shift Lever 22 Audio System If installed 23 Multi Guage If installed 24 Parking Brake Lever 25 Glove Box 26 CenterConsole CAUTION When installing a container of liquid air freshener inside the vehicle do not place it near the instrument clu...

Страница 34: ...r 9 Traction Control Indicator Light If installed 10 Door Ajar Warning Light 11 Odometer Trip Odometer Reset Knob 12 Charging System Warning Light 13 SRS Airbag Warning Light 14 Seat Belt Warning Light 15 High Beam Indicator Light 16 Oil Pressure Warning Light 17 Malfunction Indicator Light If installed 18 Low Fuel Warning Light 19 Parking Brake Brake Fluid Level Warning Light 20 Trip Computer Res...

Страница 35: ...sition B260D01A AAT Turn Signal Indicator Lights The blinking green arrows on the instrument panel show the direction indicated by the turn signals Ifthearrowcomesonbutdoesnotblink blinks more rapidly than normal or does not illuminate at all a malfunction in the turn signal system is indicated Your dealer should be con sulted for repairs B260G01A AAT Low Oil Pressure Warning Light CAUTION If the ...

Страница 36: ...ould slow the vehicle and bring it to a completestopinasafelocationofftheroadway The brake fluid level warning light indicates that the brake fluid level in the brake master cylinder is low and hydraulic brake fluid conforming to DOT3orDOT4specificationsshouldbeadded Afteraddingfluid ifnoothertroubleisfound the carshouldbeimmediatelyandcarefullydrivento aHyundaidealerforinspection Iffurthertrouble...

Страница 37: ... properly so that the exhaust gas regulation values are not satisfied Thislightwillalsoilluminatewhentheignitionkey isturnedtothe ON position andwillgooutafter engine starting If it illuminates while driving or does not illuminate when the ignition key is turnedtothe ON position takeyourcartoyour nearestauthorizedHyundaidealerandhavethe system checked B260E01HP GAT Seat Belt Warning Light If Insta...

Страница 38: ...ine coolant temperature gauge should stay in the normal range If it moves across the dial to H Hot pull over and stopassoonaspossibleandturnofftheengine Then open the hood and after the engine has cooled check the coolant level and the water pump drive belt If you suspect cooling system trouble have your cooling system checked by a Hyundai dealer as soon as possible B300A01A GAT SPEEDOMETER Your H...

Страница 39: ...Thetripcomputermaynotregisteradditional fueliflessthan6litersoffuelareaddedtothe vehicle o When the battery has been reinstalled after beingdischargedordisconnected drivemore than32kmforanaccuratedistancetoempty HGK056 1 Odometer The odometer records the total driving distance inkilometersormiles andisusefulforkeepinga record for maintenance intervals NOTE Anyalterationoftheodometermayvoidyour war...

Страница 40: ...ripmeteraccordingtodrivingcon ditions o Thedistancetoemptycanvaryaccording to the driving conditions driving pattern or vehicle speed 2 AVERAGE SPEED o Thismodeindicatestheaveragespeedtrav elled since the last average speed reset o To reset the average speed to zero press and hold the reset switch for more than 1 second while the average speed is being displayed HGK057A B330C01GK GAT MULTI GAUGE I...

Страница 41: ...ivingsituation Volt gauge It shows moment volt change and makes for diver correspond to low volt situation HGK231 B340B01A AAT Lane Change Signal To indicate a lane change move the lever up or down to a point where it begins flashing B340C03E AAT Headlight Switch HGK038 HGK039 B340A01A AAT COMBINATION TURN SIGNAL HEADLIGHT AND HIGH BEAM SWITCH Turn Signal Operation Pullingdownonthelevercausesthetu...

Страница 42: ... tions of snow or ice Accumulated snow and ice should be removed manually If there is only a light layer of snow or ice operate the heaterinthedefrostmodetomeltthesnowor ice before using the wiper B340F01A GAT Daytime Running Lights If Installed Your Hyundai is equipped with daytime running lights The daytime running lights are used to improve visibility for oncoming traffic Your ve hicle daytime ...

Страница 43: ...ld Thewashercontinuestooperateuntilthe lever is released NOTE o Do not operate the washer more than 15 seconds at a time or when the fluid reser voir is empty o In icy or freezing weather be sure the wiper blades are not frozen to the glass prior to operating the wipers o Inareaswherewaterfreezesinwinter use windshieldwasherantifreeze B350B01O AAT Windshield Washer Operation HGK044 B350C01S AAT Ad...

Страница 44: ...r window defroster auto matically turns itself off after about 15 minutes To restart the defroster cycle push in the switch again after it has turned itself off CAUTION Donotcleantheinnersideoftherearwindow glass with an abrasive type of glass cleaner or use a scraper to remove foreign deposits from the inner surface of the glass as this maycausedamagetothedefrosterelements NOTE The ignition must ...

Страница 45: ...pment other than the Hyundai genuine parts in the socket B430A01GK AAT FRONT ASHTRAY Thefrontashtraymaybeopenedbypushingand releasing the ashtray door at its top edge To remove the ashtray in order to clean it the metalashreceptacleshouldbeliftedoutfromthe ashtraydoor Donotattempttoremovetheentire ashtraydoorassemblyordamagewillresult To reinstall it place it in the proper position and press it do...

Страница 46: ...ined according to the list HGK157 B450A01GK GAT DRINK HOLDER If Installed HGK149 Thedrinkholderisusedforholdingcupsorcans To use the passenger s drink holder push the drinkholder WARNING Donotplaceobjectsotherthancupsorcans in the drink holder Such objects can be thrownoutintheeventofasuddenstoporan accident possiblyinjuringthepassengersin thevehicle Driver s Passenger s Switch position Loadingcon...

Страница 47: ...N o Do not open the sunroof in severely cold temperatureorwhenitiscoveredwithice or snow o Periodically remove any dirt that may have accumulated on the guide rails B460D03GK AAT Manual Operation of Sunroof If the sunroof does not electrically operate HGK032 1 Removethecaplocatedintherearroofpanel by using a coin or screw driver 2 Insert the hexagonal head wrench provided with the vehicle into the...

Страница 48: ... over headconsole Push the end of the cover to open the spectacle case WARNING Do not open the spectacle case while the vehicleismoving Therearviewmirrorofthe vehiclecanbeblockedbyanopenspectacle case 1 2 3 B460E02GK GAT Resetting the Sunroof System Ifthebatteryhasbeenrecharged disconnected or if the sunroof is operated with the hexagonal head wrench manually you may need to reset the sunroof To d...

Страница 49: ...ror 2 Now adjust the mirror angle by depressing theappropriateperimeterswitchasillustrated CAUTION o Do not operate the switch continuously for an unnecessary length of time o Scraping ice from the mirror face could causepermanentdamage Toremoveany ice use a sponge soft cloth or approved deicer WARNING Be careful when judging the size or distance ofanyobjectseeninthepassengersiderear viewmirror It...

Страница 50: ...e rearview mirrors while the vehicle is moving This could result in loss of control and an accident which could cause death serious injury or property damage Sensor Theoutsiderearviewmirrorheaterisactuatedin connection with the rear window defroster To heat the outside rearview mirror glass push in the switch for the rear window defroster The rearviewmirrorglasswillbeheatedfordefrosting or defoggi...

Страница 51: ... when the headlights are turnedon B530A01A AAT PARKING BRAKE HGK178 Alwaysengagetheparkingbrakebeforeleaving the car This also turns on the parking brake indicator light when the key is in the ON or START position Before driving away be sure that the parking brake is fully released and the indicator light is off o Toengagetheparkingbrake pulltheleverup as far as possible o Toreleasetheparkingbrake...

Страница 52: ...vingaway If it is not latched the hood could fly open while the vehicle is being driven causing atotallossofvisibility whichmightresult in an accident o Do not move the vehicle with the hood in theraisedposition asvisionisobstructed and the hood could fall or be damaged B570A01GK GAT HOOD RELEASE 1 Pull the release knob to unlatch the hood HGK106 Hood Release Lever HGK098 B550A01S GAT HIGH MOUNTED...

Страница 53: ...verallow sparks or open flames near the filler area If you need to replace the filler cap use a genuineHyundaireplacement part If you open the fuel filler cap during high ambient temperatures a slight pressure sound maybeheard Thisisnormalandnot a cause for concern Whenever you open the fuel filler cap turn it slowly HGK103 B560A01A AAT REMOTE FUEL FILLER LID RELEASE The fuel filler lid may be ope...

Страница 54: ...ck of each sun visor WARNING Do not place the sun visor in such a manner that it obscures visibility of the roadway traffic or other objects HGK227 WARNING Do not close an open tailgate rear hatch whileaperson s issittinguprightontherear seat Thetailgateortailgateglassmaycontact theheadofapersonsittinguprightontherear seat Closingthetailgateontoaperson shead may cause serious injuries including de...

Страница 55: ...uggagecompartment Use the luggage net on the floor or at the back of the luggage compartment to prevent objects fromsliding WARNING Avoid eye injury DO NOT overstretch AL WAYS keep face and body out of recoil path DO NOT use when strap has visible signs of wear or damage B600A01HP AAT STEERING WHEEL TILT LEVER If installed To adjust the steering wheel 1 Pullthelevertowardyouandholdittounlock 2 Rai...

Страница 56: ... position Auto matic transaxle o Decrease the vehicle speed lower than the memorized speed by 20 km h 12 mph o Decrease the vehicle speed to less than 40 km h 25 mph o Release the main switch WARNING To avoid accidental cruise control engage ment keepthecruisecontrolmainswitchoff when not using the cruise control B660C01GK B660B01E GAT To Set the Cruise Speed B660B01GK 1 Push in the cruise control...

Страница 57: ...trol will energize after approxi mately 3 seconds This delay is normal B660F01E AAT To Reset at a Slower Speed B660B01GK 1 Push the control switch downward to SET COAST and hold it The vehicle will decel erate 2 Whenthedesiredspeedisobtained release the control switch While the control switch is pushed the vehicle speed will gradually de crease WARNING o Keep the main switch off when not using the...

Страница 58: ...s are located on each side of thedashboard Tochangethedirectionoftheair flow move the knob in the center of the vent up and downandside to side Thesideventknobs control the amount of outside air entering the vehicle through the side vents The vents are opened when the vent knob is moved to the up position The vents are closed when the vent knob is moved to the down position Keep these vents clear ...

Страница 59: ...GK006 This is used to turn the blower fan on or off and to select the fan speed Thisblowerfanspeed andthereforethevolume of air delivered from the system may be con trolled manually by setting the blower control between the 1 and 4 positions 1 2 3 4 5 6 1 Air Conditioning switch 2 Air intake control switch 3 Rear window defroster switch 4 Air flow control switch 5 Fan speed control switch 6 Temper...

Страница 60: ...ontrol is recirculation mode With the Fresh mode selected air enters the vehicle from the outside and is heated or cooled according to the function selected With the Recirculation mode selected air from within the passenger compartment will bedrawn throughtheheatingsystemandheatedorcooled according to the function selected NOTE o It should be noted that prolonged opera tionoftheheatingin Recircula...

Страница 61: ...ir to be discharged through the face level vents HGK022 Bi Level Air is discharged through the face vents and the floorvents Thismakesitpossibletohavecooler airfromthedashboardventsandwarmerairfrom the floor outlets at the same time HGK021 If the Floor Defrost mode is selected the A C will turn on automatically and Fresh mode will be activated Defrost Level Air is discharged through the windshield...

Страница 62: ...ow ice or other obstructions o To prevent interior fog on the windshield set the air intake control to the fresh air position turn on the air conditioning system and adjust temperature control to desired temperature fan speed to the desired posi tion o Set the temperature control to warm o Setthefanspeedcontroltoposition 3 or 4 NOTE When the A C is operated continuously on the floor defrost level ...

Страница 63: ... to Fresh mode o Setthetemperaturecontrolto Cool Cool providesmaximumcooling Thetemperature may be moderated by moving the control toward Warm o Adjust the fan control to the desired speed For greater cooling turn the fan control to one of the higher speeds or temporarily select the Recirculation position on the air intakecontrol B740C01S AAT Dehumidified Heating Fordehumidifiedheating o Turn on t...

Страница 64: ...henmovingslowly asinheavytraffic shift toalowergear Thisincreasesengine speed which in turn increases the speed of the air conditioningcompressor o On steep grades turn the air conditioner off to avoid the possibility of the engine over heating o During winter months or in periods when the air conditioner is not used regularly run the air conditioner once every month for a few minutes Thiswillhelp...

Страница 65: ...ooling Controls TYPE A Without Air Quality System TYPE B With Air Quality System 1 TemperatureControlButton 2 Defroster Switch 3 DisplayWindow 4 Air Conditioning Switch 5 Rear Window Defroster Switch 6 Fan Speed Control Switch 7 Air Flow Control Switch 8 AUTO Automatic Control Switch 9 OFF Switch 10 Air lntake Control Switch 11 AmbientTemperatureSwitch 12 Air Quality System Switch If installed HGK...

Страница 66: ...re to increase by 0 5 C 1 F The temperature will decrease to the mini mum17 C 62 F bypushingonthe button Each push of the button will cause the tem perature to decrease by 0 5 C 1 F G280A01GK Photo sensor HGK014 NOTE Never place anything over the sensor which is located on the instrument panel to ensure better control of the heating and cooling system NOTE Ifthebatteryhasbeendischargedordiscon nec...

Страница 67: ...automatically Press the AUTO button in order to convert to automatic control of the system Pressing the button displays the ambient temperature on the display OUTSIDE TEMP B995A01Y GAT AMBIENT SWITCH HGK009 B670C01GK AAT Air Intake Control Switch Without A Q S HGK008 1 Thisisusedtoselectfreshoutsideairorrecircu lation inside air To change the air intake control mode Fresh mode Recirculationmode pu...

Страница 68: ...S control to OFF Withthe Recirculation modeselected airfrom withinthepassengercompartmentwillbedrawn throughtheheatingsystemandheatedorcooled according to the function selected NOTE o It should be noted that prolonged opera tion of the heating system in recircula tion mode will give rise to fogging of the windshield and side windows and the air within the passenger compartment will become stale In...

Страница 69: ...l When selecting the Face mode the indicator light will come on causing air to be discharged through the face level vents Bi Level When selecting the Bi Level mode the indica torlightwillcomeonandtheairwillbedischarged through the face vents and the floor vents This makes it possible to have cooler air from the dashboard vents and warmer air from the floor outlets at the same time Floor Level When...

Страница 70: ...core Blower fan Heater core B760A03GK GAT AIR CONDITIONER FILTER IN FRONT OF BLOWER UNIT If Installed Outside air Filter Inside air Inside air Floor Defrost Level When selecting the Floor Defrost mode the indicator light will come on and the air will be dischargedthroughthewindshielddefrostnozzle the floor vents side defroster nozzle side venti lator B980F01E GAT Defrost Switch When the Defrost bu...

Страница 71: ... radio station closeness of other strong radio stations or the presence of buildings bridges or other large obstructions in the area AM broadcasts can be received at greater dis tancesthanFMbroadcasts ThisisbecauseAM radio waves are transmitted at low frequencies These long low frequency radio waves can follow the curvature of the earth rather than travelling straight out into the atmosphere In ad...

Страница 72: ...SSAR013A o Station Swapping As an FM signal weak ens another more powerful signal near the same frequency may begin to play This is because your radio is designed to lock onto the clearest signal If this occurs select another station with a stronger signal o Multi PathCancellation Radiosignalsbeing received from several directions can cause distortionorfluttering Thiscanbecausedby a direct and ref...

Страница 73: ...O GAT STEREO RADIO OPERATION H250 If Installed H250A01GK 1 POWER ON OFF VOLUME Control Knob 5 BAND Selector 4 TUNE SEEK Select Button 7 SCAN Button 6 PRESET Buttons 2 BASS BALANCE Control Knob BASS BAL 3 TREBLE FADER Control Knob TREB FAD ...

Страница 74: ... the band for AM FM or FM2 o Select the desired station to be stored by seek or manual tuning o Determine the preset station select button you wish to use to access that station o Press the station select button for more than two seconds A select button indicator will show in the display indicating which select button you have depressed The frequency display will flash after it has been stored int...

Страница 75: ...DAI 1 67 7 SCAN Button Whenthescanbuttonispressed thefrequency will increase and the receivable stations will be tuned in one after another receiving each sta tion for 5 seconds To stop scanning press the scan button again ...

Страница 76: ...S OF YOUR HYUNDAI 1 68 H240C01O GAT CASSETTE TAPE PLAYER OPERATION H250 If Installed H250A01GK 3 TAPE PROGRAM Button 2 AUTO MUSIC SELECT Button 4 EJECT Button 1 FF REW Button 6 TAPE SLOT 5 DOLBY SELECT Button ...

Страница 77: ...eginn ing of the next music segment o Pressing the button will start replay at the beginning of the music just listened to 3 TAPE PROGRAM Button This allows you to play the reverse side of the tape by merely depressing the program button An arrow will appear in the display to show tape direction NOTE WhentapeoperationisabnormalorER8fault code is displayed press the eject button more than 5 seconds...

Страница 78: ...FEATURES OF YOUR HYUNDAI 1 70 H250A01GK B250A01GK GAT CD AUTO CHANGER H250 If Installed 1 CD CHANGER Select Button 4 FF REWButton 3 TRACK UP DOWN 5 REPEAT Button 2 DISC Select Button 6 SCAN Button ...

Страница 79: ...t DC battery system with negativeground o This unit is made of precision parts Do not attempt to disassemble or adjust any parts o Whendrivingyourvehicle besuretokeep the volume of the unit set low enough to allowyoutohearsoundscomingfromthe outside CAUTION Do not insert warped or poor quality discs into the CD changer as damage to the unit mayoccur TUNE DISC 3 TRACK UP DOWN o The desired track on...

Страница 80: ...72 H260A01O AAT STEREO RADIO OPERATION H260 If Installed H260A01O 1 POWER ON OFF VOLUME BALANCE Control Knob 2 FADER Control Knob 3 BASS TREBLE Control Knob 4 SCAN Button 6 BAND Selector 5 TUNE SEEK Select Button 7 PRESET Button ...

Страница 81: ...yoftheradio Then by simply pressing the band select button and or one of the six station select buttons you may recallanyofthesestationsinstantly Toprogram the stations follow these steps o Press band selector to set the band for AM FM or FM2 o Select the desired station to be stored by seek scan or manual tuning o Determine the preset station select button you wish to use to access that station o...

Страница 82: ...ton and pro ceed to program the next desired station A total of 18 stations can be programmed by selecting one AM and two FM stations per button o When completed any preset station may be recalled by selecting AM FM or FM2 band and the appropriate station button ...

Страница 83: ...FEATURES OF YOUR HYUNDAI 1 75 H260B01O AAT COMPACT DISC PLAYER OPERATION H260 If Installed H260A01O 1 Playing CD 2 FF REWButton 3 TRACK UP DOWN 4 SCAN Button 5 REPEAT Button 6 EJECT Button ...

Страница 84: ... Button When the EJECT button is pressed with a CD loaded the CD will eject NOTE o If the CD does not operate properly or if theER2faultcodeisdisplayed useoneof two methods to reset the CD deck func tion Remove the audio fuse for 5 minutes Then reinstall the audio fuse Diconnect the negative terminal of the battery and wait 5 minutes Then re connectthenegativebatteryterminal o To assure proper ope...

Страница 85: ...FEATURES OF YOUR HYUNDAI 1 77 B260E01E AAT CD AUTO CHANGER H260 If Installed H260A01O 1 CD Select Button 4 FF REWButton 3 TRACK UP DOWN 6 SCAN Button 5 REPEAT Button 2 DISC Select Button ...

Страница 86: ...C battery system with negativeground o This unit is made of precision parts Do not attempt to disassemble or adjust any parts o Whendrivingyourvehicle besuretokeep the volume of the unit set low enough to allowyoutohearsoundscomingfromthe outside CAUTION Do not insert warped or poor quality discs into the CD changer as damage to the unit mayoccur TUNE DISC 3 TRACK UP DOWN o The desired track on th...

Страница 87: ...PERATURE IS TOO HIGH NO DISC IN MAGAZINE NO CD MAGAZINE IN THE AUTO CHANGER AFTER RESETTING THE AUDIO SYSTEM PUSH THE EJECT BUTTON IF DISC IS NOT EJECTED CONSULT YOUR HYUNDAI DEALER MAKE SURE THE DISC IS NOT SCRATCHED OR DAMAGED PRESS THE EJECT BUTTON AND PULL OUT THE DISC THEN INSERT A NORMAL CD DISC CHECKIFTHEDISCISINSERTEDCORRECTLYINTHECDPLAYER MAKE SURE THE DISC IS NOT SCRATCHED OR DAMAGED AFT...

Страница 88: ...B260A01GK 1 On Off Switch 2 Tone Button 3 Road traffic announcement button 4 Operatingmodeswitchingbutton Mode 5 Function button Function 6 Waveband switching button Band 7 CD eject button 8 Volumecontrol 9 Multifunctionbuttons 10 Display 11 Right rotary control 1 2 3 4 5 6 7 8 9 10 11 ...

Страница 89: ...Switch On Off Press the button to switch the power on To switch the power off press the button again 2 Adjust Volume Turn volume control to right left The volume is increased or decreased The current volume level is shown on the display 3 Mute Function The unit can be switched to mute in each opera tionmodebypressingthevolumecontrol MUTE appears on the display The mute function is cancelled by pre...

Страница 90: ...lypressmultifunctionbutton 6 ST in tone menu until the desired optimization is set AUTO Settingfornormaloperation i e theunit switchesfromstereotomonoandbackdepend ing upon reception location provides the opti mum setting for almost all reception areas STEREO Setting for unusual reception situa tions i e the unit is set permanently to stereo e g for private radio stations in city areas MONO Settin...

Страница 91: ... by AS Select radio menu mode in order to quit the autostore storage plane Then press multifunction button AS The radio switches back to the station button plane 10 Manual tuning Select radio menu and the turn the right rotary control Turningstepsof100kHz FM or9kHz AM are performer Pressing the right rotary control switches to fine tuning 1 kHz steps for AM The function is quit ifthereisnofurthera...

Страница 92: ...0 seconds 6 Random play The random play is activated by pressing the multifunction button 4 RP The tracks of the current CD are then played in random order RP appears on the display The random play function is terminated by repeated pressing of the multifunction button RP 7 Direct track selection The unit is switched to select mode by pressing the multifunction button 0 The digits 1 0 and TRACK _ ...

Страница 93: ...A01L Proper care of your cassette tapes will extend the tape life and increase your listening enjoy ment Always protect your tapes and cassette casesfromdirectsunlight severecoldanddusty conditions When not in use cassettes should alwaysbestoredintheprotectivecassettecase When the vehicle is very hot or cold allow the interior temperature to become more comfort able before listening to your casset...

Страница 94: ...our vehicle Head Cottonapplicator SSAR042B o Theplaybackhead capstanandpinchrollers willdevelopacoatingoftaperesiduethatcan result in deterioration of sound quality such asawaveringsound Theyshouldbecleaned monthlyusingacommerciallyavailablehead cleaning tape or special solution available fromaudiospecialtyshops Followthesuppli er sdirectionscarefullyandneveroilanypart of the tape player unit o Al...

Страница 95: ...atoreceiveboth AM and FM broadcast signals Thisantennaisaremovabletype Toremovethe antenna turntheantennacounterclockwise To install the antenna turn the antenna clockwise CAUTION Be sure to remove the antenna before wash ing the car in an automatic car wash or the antenna may be damaged B870A01F ...

Страница 96: ...ing the engine idle in your garage even with the garage door open is a hazardous practice Never run the engine in your garage any longer than it takes to start the engine and back the car out o Avoid idling the engine for prolonged periods with people inside the car If it is necessary to idle the engine for a prolonged period with people inside the car be sure to do so only in an open area with th...

Страница 97: ...osition o Tostarttheengine inserttheignitionkeyand turn it to the START position Release it as soonastheenginestarts Donotholdthekey in the START position for more than 15 seconds NOTE Forsafety theenginewillnotstartiftheshift lever is not in P or N Position Automatic Transaxle C030A01A GAT COMBINATION IGNITION SWITCH To Start the Engine o If your Hyundai is equipped with a manual transaxle place ...

Страница 98: ...warning lights and gaugesarefunctioningproperlybeforestart ing the engine WARNING Be sure that the clutch is fully depressed when starting a manual transaxle vehicle Otherwise there is the potential to cause damage to the vehicle or injury to someone insideoroutsidethevehicleasaresultofthe forward or backward movement of the ve hicle that will occur if the clutch is not de pressed when the vehicle...

Страница 99: ...ntly press the gear shift lever sideways in such a manner that second gear is engaged Such a drastic downshift may cause the en gine speed to increase to the point that the tachometer will enter the red zone Such over revvingoftheenginemaypossiblycause enginedamage C070B01A AAT Using the Clutch The clutch should be pressed all the way to the floor before shifting then released slowly The clutch pe...

Страница 100: ...slipperysurface anabruptchangeinvehicle speed can cause the drive wheels to lose traction and the vehicle to go out of control WARNING o Avoid high cornering speeds o Do not make quick steering wheel move ments such as sharp lane changes or fast sharp turns o Always wear your seat belts Inacollisioncrash ununbeltedpersonis significantly more likely to die than a per son wearing a seatbelt o The ri...

Страница 101: ...ientHyundaiautomatictransaxle hasfourforwardspeedsandonereversespeed Theindividualspeedsareselectedautomatical ly dependingonthepositionofthespeedselec torlever Theselectorleverhas2gates themain gate and the manual gate NOTE For information on manual gate operation refer to Sports Mode In the main gate the selector lever has 4 posi tions and is equipped with a button to avoid inadvertentwrongselec...

Страница 102: ...apid ac celeration can cause a loss of traction however downshiftsmustbemadecare fully in accordance with the vehicle s speed NOTE o In sports mode only the four forward gears can be selected To reverse or park thevehicle movetheselectorlevertothe R or P position as required o Insportsmode downwardshiftsaremade automatically when the vehicle slows down When the vehicle stops 1st gear is automatica...

Страница 103: ...en you leave the vehicle even momentarily Never leave the vehicle unattended while the engine is running o Check the automatic transaxle fluid level regularly and add fluid as necessary C090N02O AAT Good Driving Practices o Never move the gear selector lever from P or N to any other position with the acceler ator pedal depressed o Never move the gear selector lever into P when the vehicle is in mo...

Страница 104: ... brake o Do not hold the vehicle on the upgrade with the accelerator pedal This can cause the transmission to overheat Always use the brake pedal or parking brake C120A02A AAT ANTI LOCK BRAKE SYSTEM If Installed The Anti Lock Brake System ABS is designed to prevent wheel lock up during sudden braking oronhazardousroadsurfaces TheABScontrol module monitors the wheel speed and controls the pressure ...

Страница 105: ...also means that the road is slippery or your car is accelerating excessively In this situation gently release footpressurefromtheacceleratorpedaland maintainmoderatespeed WARNING Traction control is only a driving aid all normal precautions for driving in inclement weatherandonslipperyroadsurfacesshould beobserved On slippery road surfaces the traction control system TCS limits the drive wheels fr...

Страница 106: ...speciallyimportant that mud dirt ice etc not be allowed to accumulate on the underside of the car This extra weight can result in increased fuel con sumption and also contribute to corrosion o Travellightly Don tcarryunnecessaryweight in your car Weight reduces fuel economy o Don t let the engine idle longer than neces sary Ifyouarewaiting andnotintraffic turn C150A01A AAT SMOOTH CORNERING Avoidbr...

Страница 107: ...extent Sudden brake applications on snowy or icy roads may cause skids to occur You need to keep sufficient distance between the vehicle in front and your vehicle Also apply the brake gently Itshouldbenotedthatinstallingtirechains onthetirewillprovideagreaterdrivingforce but will not prevent side skids NOTE Tire chains are not legal in all provinces Checkprovincelawsbeforefittingtirechains C160C01...

Страница 108: ...your car you should carry appropriate emergency equipment Some of the items you may want to carry include tire chains tow straps or chains flashlight emergency flares sand a shovel jumpercables awindowscraper gloves ground cloth coveralls a blanket etc C160J01A AAT Don t Let Ice and Snow Accumulate Underneath Under some conditions snow and ice can build upunderthefendersandinterferewiththesteer in...

Страница 109: ...ge 5 4 CAUTION o Never connect a trailer brake system di rectly to the vehicle brake system o When towing a trailer on steep grades in excess of 12 pay close attention to the engine coolant temperature gauge to en sure the engine does not overheat If the needle of the coolant temperature gauge movesacrossthedialtowards H HOT pull over and stop as soon as it is safe to do so and allow the engine to...

Страница 110: ... 2 Always drive your vehicle at a moderate speed Less than 100 km H 3 Trailertowingrequiresmorefuelthannormal conditions 4 To maintain engine braking efficiency and electrical charging performance do not use fifth gear manual transaxle or overdrive automatictransaxle 5 Always secure items in the trailer to prevent load shift while driving 6 Check the condition and air pressure of all tires on the ...

Страница 111: ...ency 14 Whengoingdownahill shiftintoalowergear and use the engine braking effect Whenascendingalonggrade downshiftthe transmission to a lower gear and reduce speedtoreducechancesofengineoverload ingand oroverheating 15 If you have to stop while going uphill do not hold the vehicle in place by pressing on the accelerator This can cause the automatic transmission to overheat Use the parking brake or...

Страница 112: ...tionsfor JumpStarting onthefollow ing pages D010C01A AAT IfEngineTurnsOverNormallybutDoes Not Start 1 Check fuel level 2 With the key in the off position Check all connectors at ignition coils and spark plugs Reconnect any that may be disconnected or loose 3 Check the fuel line in the engine compart ment 4 If engine still refuses to start call a Hyundai dealer or seek other qualified assistance D0...

Страница 113: ...nd let it run for a few minutes This will help to assure that the booster battery is fully charged During the jumping operation run the engine in this vehicle at about 2000 rpm 5 Starttheengineinthecarwiththedischarged battery using the normal starting procedure After the engine starts leave the jumper cables connected and let the engine run at fast idle or about 2000 rpm for several min utes 6 Ca...

Страница 114: ... speeds of over 80 km h 50 mph is not recommended 4 As the temporary spare tire is specifically designedforyourcar itshouldnotbeusedon any other vehicle 5 The temporary spare tire should not be used on any other wheels nor should standard tires snow tires wheel covers or trim rings be used with the temporary spare wheel If such use is attempted damage to these items or other car components may occ...

Страница 115: ...the car has slowedtosuchaspeedthatitissafetodoso brake carefully and pull off the road Drive off the road as far as possible and park on firm levelground Ifyouareonadividedhighway do not park in the median area between the two traffic lanes 2 When the car is stopped turn on your emer gency hazard flashers set the parking brake and put the transaxle in P automatic or reverse manual transaxle 3 Have...

Страница 116: ... Then while holding the wrench near the end of the handle push down on it with steady pressure Do not remove the nuts at this time Just loosen them aboutone halfturn HGK193 D060C01A AAT 2 Block the Wheel Block the wheel that is diagonally opposite from the flat to keep the vehicle from rolling when the car is raised on the jack Flat tire HGK192 Remove the spare tire and remove the jack and tool ba...

Страница 117: ...car high enough so that the fully inflatedsparetirecanbeinstalled Todothis you willneedmoregroundclearancethanisrequired to remove the flat tire WARNING Donotgetunderthecarwhenitissupported bythejack Thisisverydangerousasthejack could fall and cause serious injury or death Nooneshouldstayinthecarwhilethejackis beingused D060G02Y AAT 6 Changing Wheels Loosen the wheel nuts and remove them with your...

Страница 118: ...ood contact on the mounting surfacebetweenthewheelandhub thewheel nuts could come loose and cause the loss of a wheel Loss of a wheel may result in loss of control of the vehicle This may cause seri ous injury or death STA3071H Lower the car to the ground by turning the wheel nutwrenchcounterclockwise Thenpositionthe wrench as shown in the drawing and tighten the wheel nuts Be sure the socket is s...

Страница 119: ...n the ACC position This is necessary to prevent damage to the steering lock mecha nism which is not designed to hold the front wheels straight while the car is being towed o If any of the loaded wheels or suspension components are damaged a towing dolly must be used o OK FOR AUTOMATIC OR MANUAL TRANSAXLE EQUIPPED VEHICLE o OK FOR AUTOMATIC OR MANUAL TRANSAXLE EQUIPPED VEHICLE WITH NO DAMAGE D080A0...

Страница 120: ...rface This could result in serious damage to your car Nor should towing be attempted if the wheels drive train axles steering or brakes are dam aged Before towing be sure the transaxle is in neutral and the key is in ACC with the engine off or in the ON position with the engine running A driver must be in the towed car to steer it and operate the brakes CAUTION o If the car is being towed with all...

Страница 121: ...WHAT TO DO IN AN EMERGENCY 3 10 D120A02A GAT IF YOU LOSE YOUR KEYS Informationaboutthekeyofimmobilizersystem if installed will be found on page 1 2 ...

Страница 122: ...ner s cooperation and assistance is alsorequired E010C01A AAT High Corrosion Areas If you live in an area where your car is regularly exposed to corrosive materials corrosion pro tection is particularly important Some of the common causes of accelerated corrosion are roadsalts dustcontrolchemicals oceanairand industrialpollution E010B01A AAT Common Causes of Corrosion The most common causes of cor...

Страница 123: ...rt In winter or if you have driven through mud or muddy water be sure to thor oughly clean the underside as well Use a hard direct stream of water to remove accumulations ofmudorcorrosivematerials Highpressurecar washes may cause water to enter your vehicle Use a good quality car washing solution and followthemanufacturer sdirectionsonthepack age TheseareavailableatyourHyundaidealer or auto parts ...

Страница 124: ...cleaningagents Thesecandamagethefinishof the car To remove road tar use turpentine on a clean soft cloth Be gentle To remove dead insects or tree sap use warm water and mild soap or car washing solution Soakthespotandrubgently Ifthepainthaslost its luster use a commercial car cleaning polish E030C01A AAT Polishing and Waxing Always wash and dry the car before polishing or waxingorusingacombination...

Страница 125: ...hemforexces sivewear cuts frayingorothersignsofdamage and replace them if necessary E040C01A AAT Cleaning the Carpets Useafoam typecarpetcleaner Cleanersofthis typeareavailableinaerosolcansinliquidformor powder Read the instructions and follow them exactly Usingavacuumcleanerwiththeappro priateattachment removeasmuchdirtfromthe carpetsaspossible Applythefoamfollowingthe manufacturer s directions t...

Страница 126: ...ese items will be found on page 6 4 F010A01A GAT MAINTENANCE INTERVALS Service Requirements To assure that you receive the greatest number of kilometers of satisfying operation from your Hyundai certain maintenance procedures must be performed Although careful design and en gineering have reduced these to a minimum those that are required are of the utmost impor tance It is your responsibility to ...

Страница 127: ...ll vehicle services to protect your warranty Where both mileage and time are shown the frequency of service is determined by whichever occurs first F030B03GK GAT R Replace I Inspect and after Inspection clean adjust repair or replace if necessary NO DESCRIPTION 105 84 R I I 120 96 R I I I I I R 90 72 R I I I R I I R R 75 60 R I I 60 48 R I I I I I I R 45 36 R I I I 30 24 R I I I I R 15 12 R I I KI...

Страница 128: ...OR BLOWER UNIT F030C01GK GAT R Replace I Inspect and after inspection clean adjust repair or replace if necessary 120 96 I I I I I I I I I I I I I I 105 84 I I I I I I I I I I I I 90 72 I I R I I I I I I I I I I I 75 60 I I I I I I I I I I I I 60 48 I I I I I I I I I I I I I I 45 36 I I I I I I I I I I I I 30 24 I I I I I I I I I I I I I I 15 12 I I I I I I I I I I I I KILOMETERS X 1000 MONTHS NO ...

Страница 129: ...ONDITION MAINTENANCE INTERVALS R R R R I I I I R R R MAINTENANCE OPERATION MAINTENANCEITEM EVERY 7 500 KM OR 6 MONTHS EVERY 5 000 KM OR 6 MONTHS MORE FREQUENTLY MORE FREQUENTLY EVERY 60 000 KM OR 48 MONTHS MORE FREQUENTLY MORE FREQUENTLY MORE FREQUENTLY EVERY 15 000 KM OR 12 MONTHS EVERY 100 000 KM EVERY 45 000 KM EVERY 40 000 KM MORE FREQUENTLY A B C F H C E B H D E F G C D G H C D G H C D E F C ...

Страница 130: ...immediately F060G01A AAT o Vapor Hose and Fuel Filler cap The vapor hose and fuel filler cap should be inspected at those intervals specified in the maintenance schedule Make sure that a new vapor hose or fuel filler cap is correctly re placed F060F01A AAT o Vacuum Crankcase Ventilation Hoses Inspect the surface of hoses for evidence of heat and or mechanical damage Hard and brit tle rubber cracki...

Страница 131: ...iled service procedures refer to the Shop Manual F070J01A AAT o Brake Pads Calipers and Rotors Check the pads for excessive wear discs for run out and wear and calipers for fluid leakage F070K01A AAT o Exhaust Pipe and Muffler Visually inspect the exhaust pipes muffler and hangers for cracks deterioration or damage Start the engine and listen carefully for any exhaust gas leakage Tighten connectio...

Страница 132: ... REQUIREMENTS 5 7 F070Q01A AAT o Air Conditioning Refrigerant Check the air conditioning lines and connec tions for leakage and damage Check air condi tioning performance according to the relevant shop manual if necessary ...

Страница 133: ...stic rocker cover of the engine is not damaged 6 1 Engine oil filler cap 2 Brake Booster 3 Brake fluid reservoir 4 Clutch fluid reservoir If installed 5 Relay box 6 Windshield washer fluid reservoir cap 7 Power steering fluid reservoir 8 Engine coolant reservoir 9 Engine oil level dipstick 10 Radiator cap 11 Automatic transaxle fluid level dipstick If installed 12 Air cleaner 13 Battery HGK238 1 2...

Страница 134: ... fluid reservoir cap 7 Power steering fluid reservoir 8 Engine coolant reservoir 9 Engine oil level dipstick 10 Radiator cap 11 Automatic transaxle fluid level dipstick If installed 12 Air cleaner 13 Battery 1 HGK059 2 6 3 4 5 7 8 9 10 11 12 13 CAUTION When inspecting or servicing the engine you should handle tools and other heavy objects carefully so that the plastic rocker cover of the engine is...

Страница 135: ... element 5 Relay box 6 Windshield washer fluid reservoir cap 7 Engine coolant reservoir 8 Engine oil level dipstick 9 Radiator cap 10 Engine oil filler cap 11 Automatic transaxle fluid level dipstick If installed 12 Battery CAUTION When inspecting or servicing the engine you should handle tools and other heavy objects carefully so that the plastic rocker cover of the engine is not damaged ...

Страница 136: ...indshield wiper operation o Horn operation o Defroster heating system operation and air conditioning if installed o Steering operation and condition o Mirror condition and operation o Turn signal operation o Accelerator pedal operation o Brake operation including parking brake o Manual transaxle operation including clutch operation o Automatic transaxle operation including Park mechanism operation...

Страница 137: ...he oil level is close to or below the L mark add oil until it reaches the F mark To add oil 1 Remove the oil filler cap by turning it counter clockwise 2 Add oil then check the level again Do not overfill 3 Replace the cap by turning it clockwise The distance between the F and L marks is equal to about 1 liter of oil HGK211 DOHC V6 DOHC V6 See the lubrication chart on the page 9 3 NOTE o The use o...

Страница 138: ...A certain amount of oil will come out when you remove the filter So be sure to have your drain pan in place under neath it 6 Install a new oil filter in accordance with the instructions on the carton or on the filter itself Do not over tighten Tightening torque 1 2 1 6 kgf m Be sure that the mounting surface on the engine is clean and that the old gasket is removed completely Lubricate the new gas...

Страница 139: ...The coolant level can be seen on the side of the plastic coolant reservoir The level of the cool ant should be between the LOW and FULL lines on the reservoir when the engine is cool If the level is below the LOW mark add engine coolant to bring it up between LOW and FULL If the level is low inspect for coolant leaks and recheck the fluid level fre quently If the level drops again visit your Hyund...

Страница 140: ...plugs genuine Hyundai replacement parts are recom mended RecommendedSparkPlugs Type RC10YC4 CHAMPION BKR5ES 11 NGK RC10PYPB4 CHAMPION PFR5N 11 NGK RC10YC CHAMPION BKR5ES NGK RC10YC CHAMPION BKR5ES NGK Remark Unleaded Leaded 1 6 2 0L 2 7L 2 7L 1 6 2 0L 1 0 1 1 mm 0 039 0 043 in 0 7 0 8 mm 0 028 0 032 in leaded one G050D02A AAT To Change the Engine Coolant The engine coolant should be changed at tho...

Страница 141: ...too loose can cause the spark plug to get very hot and possibly result in damage to the engine 7 Replace the cable by pushing the insulated connector directly down onto the electrode Check to be sure it has snapped into place and can t fall off G060C02GK GAT Changing the Spark Plugs You will find it easier to change spark plugs if the engine is cold Always change one spark plug at a time This help...

Страница 142: ...es and arms use a clean sponge or cloth with a mild soap or detergent and water If the wipers continue to streak or smear the glass replace them with Genuine Hyundai Replacement Parts or their equivalent CAUTION o Do not operate the wipers on dry glass This can result in more rapid wear of the wiper blades and may scratch the glass o Keep the blade rubber out of contact with petroleum products suc...

Страница 143: ...ck for leaks before adding oil To refill the transaxle or bring the oil level up add oil slowly until it reaches the proper level Do not overfill 3 Replace the plug and washer screw it in with your fingers and then tighten securely with the wrench G100A02GK GAT CHECKING THE TRANSAXLE OIL MANUAL G110A01E Filler plug Drain plug G110A02A AAT CHECKING THE TRANSAXLE FLUID AUTOMATIC Transaxle fluid in t...

Страница 144: ...times oper ate even when the engine is not running Use extreme caution when working near the blades of the cooling fan so that you are not injured by a rotating fan blade As the en gine coolant temperature decreases the fan will automatically shut off This is a normal condition Fluid level should be within this range HGK249 Î Î DOHC V6 HGK212 G110D02Y AAT To Check the Transaxle Fluid Level HGK174 ...

Страница 145: ...lutch Fluid The clutch fluid level in the master cylinder should be checked when performing other un der hood services The system should be checked for leakage at the same time Check to make certain that the clutch fluid level is always between the MAX and MIN level markings on the fluid reservoir Fill as required Fluid loss indicates a leak in the clutch system which should be inspected and repai...

Страница 146: ...the air conditioning system for extended periods of time with a low refriger ant level may damage the compressor G140C01A AAT Lubrication To lubricate the compressor and the seals in the system the air conditioning should be run for at least 10 minutes each week This is particularly important during cool weather when the air conditioning system is not otherwise in use G130B02A AAT To Replace the F...

Страница 147: ... it inspected by your Hyundai dealer and adjusted or repaired if necessary HGK218 30 mm 1 18in B760B01GK GAT Replacement of air conditioner filter If installed HGK250 HGK251 HGK253 HGK254 1 Remove the mounting screws on the down side of the glove box 2 Open the glove box and remove the mount ing screws on the upside of the glove box 3 Remove the filter cover 4 Replace the air filter with a new one...

Страница 148: ... BRAKE PEDAL FREE PLAY With the engine off press down on the brake pedal several times to reduce the vacuum in the brake booster Then using your hand press down slowly on the brake pedal until you feel a change in resistance This is the brake pedal freeplay The freeplay should be within the limits speci fied in the illustration If it is not have it inspect ed by your Hyundai dealer and adjusted or...

Страница 149: ...mage to the entire wiring harness This could be caused by a short in the system drawing too much current If this ever happens have a Hyundai dealer determine the cause repair the system and replace the fusible link The fusible links are located in a relay box for easy inspection CAUTION When replacing a fusible link never use anything but a new fusible link with the same or lower amperage rating N...

Страница 150: ...your skin flush the affected areas with water for at least 15 minutes and then seek medical assistance o If battery fluid is in your eyes rinse out your eyes with water and get medical assistance as soon as possible While you are being driven to get medical assistance continue to rinse your eyes by using a sponge or soft cloth saturated with water o If you swallow battery fluid drink a large quant...

Страница 151: ...e stops dur HGK214 G220C01A AAT Checking Condenser Cooling Fan The condenser coolant fan should come on automatically whenever the air conditioning is in operation ing warm up there is no abnormal function in the system It is due to a power steering fluid characteristic in extremely cold condi tions Recommended Fluid Use PSF 3 type fluid NOTE Do not start the engine when the power steering oil res...

Страница 152: ...e bulb against abrasions or scratches and against liquids when lighted Turn the bulb on only when installed in a headlight Re place the headlight if damaged or cracked Keep the bulb out of the reach of children and dispose of the used bulb with care Before performing aiming adjustment make sure of the following Low Beam G290A02GK Vertical aiming High Beam Horizontal aiming G260A02A AAT REPLACING L...

Страница 153: ... is aligned with point P shown in the illustra tion 2 Dotted lines in the illustration show the cen ter of headlights 1 Keep all tires inflated to the correct pres sure 2 Place the vehicle on level ground and press the front bumper rear bumper down sev eral times Place vehicle at a distance of 3m 118 in from the test wall 3 See that the vehicle is unloaded except for full levels of coolant engine ...

Страница 154: ... Turn Signal Light Front Door Edge Warning Light LuggageCompartmentLight No 1 2 3 4 5 6 7 No 8 9 10 11 12 13 Part Name HighMounted Withoutspoiler Stop LIght With spoiler Rear Turn Signal Light Combination Stop TailLight Back up Light License Plate Light Rear Fog Light If installed Wattage 2 4 LED 3 5 LED 21 21 5 21 5 21 5 11 12 13 3 4 6 HGK035A 1 1 8 2 High Low 10 9 7 ...

Страница 155: ...og Light TCM ECM Horn A Conditioner Head Light High Head Light LOW FUSE RATING 120A 50A 30A 30A 30A 30A 30A 30A 30A 15A 10A 15A 15A 10A 15A 15A 15A DESCRIPTION BATT BATT COND RAD ECU IGN ABS 1 ABS 2 BLOWER INJ SNSR DRL F FOG ECU HORN A CON H LP H1 H LP LO NOTE Not all fuse panel descriptions in this manual may be applicable to your vehicle It is accurate at the time of printing When you inspect th...

Страница 156: ...Multi Gauge Unit B Up Lamp Air Bag Indicator Air Bag Outside Mirror Defroster Hazard Warning Light Rear Window Wiper Tail Light Front Window Wiper A Conditioner Rear Window Defroster Stop Light Tail Light A Conditioner ECM Multi Gauge Unit TCM Cluster Map Light Clock Audio Power Window Tail Gate Open A Con A Q S Sensor Rear Fog C Lighter Outside Mirror Sunroof Seat Warmer ABS TCS Audio Clock FUSER...

Страница 157: ...orbed and stored in the canister When the engine is running the fuel vapors absorbed in the canis ter are drawn into the induction system through the purge control solenoid valve Purge Control Solenoid Valve The purge control solenoid valve is controlled by the ECM when the engine coolant tempera ture is low and during idling it closes so that evaporated fuel is not taken into the engine After eng...

Страница 158: ...ler as soon as possible and have the difficulty corrected o Avoid driving with a very low fuel level If your run out of gasoline it could cause the engine to misfire and result in excessive loading of the catalytic converter o Avoid idling the engine for periods longer than 10 minutes o Your Hyundai should not be either pushed or pulled to get it started This can cause the catalytic converter to o...

Страница 159: ...ide the best performance for normal driving I030A02GK AAT RECOMMENDED INFLATION PRES SURES The tire label located on the driver side center pillar outer panel gives the tire pressures rec ommended for your vehicle HGK220 HGK092 8 DOHC V6 These pressures were chosen to provide the most satisfactory combination of ride comfort tire wear and stability under normal conditions Tire pressures should be ...

Страница 160: ...e air pressure than the pressure recommended for the standard tires on the tire label on the drive side center pillar outer panel or up to the maximum pressure shown on the tire sidewall whichever is less Do not drive faster than 120 km h 75 mph when your car is equipped with snow tires Tires should be rotated every 10 000 km 6 000 miles If you notice that tires are wearing un evenly between rotat...

Страница 161: ...wo or more grooves of the tread Always replace your tires with those of the recommended size If you change wheels the new wheel s rim width and offset must meet Hyundai specification I100A01FC GAT SPARE TIRE AND TOOLS Your Hyundai is delivered with the following Spare tire and wheel Wheel nut wrench Wrench bar Spanner Driver Jack HGK189 I060A02GK WARNING When rotating the 215 45 R17 tires the tire...

Страница 162: ...in Vane type 195 65R15 205 55 R16 215 45 R17 Standard Option Overalllength Overall width Overallheight unladen Wheelbase Front Rear 4395 173 1760 69 3 1330 52 4 2530 99 6 1490 58 7 1490 58 7 Wheeltread mm in J020A01GK GAT POWER STEERING Fuel tank capacity Liter 55 US gal 14 5 Imp gal 12 J040A02GK GAT ELECTRICAL Item Battery Alternator J050A01GK GAT BRAKE Type Front brake type Rear brake type Parki...

Страница 163: ...ingorder Valveclearance Cold Engine 20 5 C Spark plug Spark plug gap Idle speed RPM Ignition timing Base Unleaded Leaded Unleaded Leaded 2 7 L 2 7 6 Cylinder V6 DOHC 86 7 x 75 2 656 1 2 3 4 5 6 AUTO LASH PFR5N 11 RC10PYPB4 750 100 BTDC 12 10 J070A03GK GAT ENGINE Intake Exhaust Intake Exhaust NGK CHAMPION NGK CHAMPION For adjusting For checking 0 17 0 23 mm 0 0067 0 0091 in 0 25 0 31 mm 0 0098 0 01...

Страница 164: ...e operation Normaldrivingcondition Severe driving condition HYUNDAI GENUINE PARTS MTF 75W 90 API GL 4 DIAMOND ATF SP III or SK ATF SP III PSF 3 DOT 3 or DOT 4 equivalent Ethylene glycol base for aluminium radiator J080A03GK GAT LUBRICATION CHART Item Engine Oil EngineOilConsumption Transaxle PowerSteering Brake Fluid Coolant Q ty liter us qts Imp qts Engine Oil 1 6 L 3 3 3 5 2 9 2 0 L 3 85 4 07 3 ...

Страница 165: ...3 Protecting your Hyundai from corrosion 4 1 Washing and waxing 4 2 Cruise Control 1 47 D Defrosting Defogging 1 54 Door Central door lock 1 5 Door locks 1 3 Locking and unlocking front door with a key 1 4 Drink Holder 1 38 Drive Belts 6 17 ZK000A1 G 10 INDEX A Air bag 1 20 1 24 Air cleaner filter 6 10 Air Conditioning Care 6 14 Operation 6 14 Switch 1 55 Air filter 1 62 Antenna 1 87 Ashtray 1 37 ...

Страница 166: ...t cushion height adjustment 1 9 Seat warmer 1 9 Fuel Capacity 9 1 Gauge 1 28 Recommendations 1 1 Fuel Filler Lid Remote release 1 45 Fuse Panel Description 6 23 6 24 Fuses 6 17 G General Everyday Checks 6 4 Glove box 1 41 H Hazard Warning System 1 36 Headlight Bulb 6 20 Headlight Leveling Device System 1 38 Heating and Cooling Control Rotary type 1 51 1 56 Automatic type 1 57 1 62 High mounted rea...

Страница 167: ...ation H250 H260 1 65 1 72 Stereo Sound System 1 63 1 64 Sun Visor 1 46 Sunroof 1 38 T Tachometer 1 30 Tail Gate 1 45 TCS Traction control system 2 10 Theft Alarm System 1 5 J Jump Starting 3 1 K Keys 1 2 If you lose your keys 3 10 Positions 2 2 L Light Bulb Replacement 6 20 Lubrication Chart 9 3 Luggage Net 1 47 M Maintenance Intervals Explanation of scheduled maintenance items 5 5 5 7 Maintenance...

Страница 168: ...e towed 3 8 Trailer or vehicle towing 2 13 Transaxle Automatic 2 6 Automatic transaxle fluid checking 6 11 Manual 2 4 Manual transaxle oil checking 6 11 Trip Computer 1 31 Trip Odometer 1 30 V Vehicle Identification Number VIN 8 1 Vehicle Specification 9 1 Ventilation Center ventilator 1 50 Side ventilator 1 50 W Washer fluid 6 10 Warning Lights 1 28 1 29 Windows Glass 1 7 Windshield Wiper and Was...

Страница 169: ...tion counterfeit or used salvage parts is not covered under the Hyundai New Vehicle Limited Warranty or any other Hyundai warranty In addition any damage to or failure of Genuine Hyundai Parts caused by the installa tion or failure of an imitation counter feit or used salvage part is not cov ered by Hyundai Motor Company 3 How can you tell if you are pur chasing Hyundai Genuine Parts Look for the ...

Страница 170: ...T 1 1 2 DRIVING YOUR HYUNDAI 2 1 3 IN CASE OF EMERGENCY 3 1 4 APPEARANCE CARE 4 1 5 VEHICLE MAINTENANCE REQUIREMENTS 5 1 6 OWNER MAINTENANCE 6 1 7 EMISSION CONTROL SYSTEM 7 1 8 CONSUMER INFORMATION 8 1 9 VEHICLE SPECIFICATIONS 9 1 10 INDEX 10 1 1 2 3 4 5 6 7 8 9 10 ...

Страница 171: ... condition may result in harm or injury to you or other persons if the warning is not heeded Follow the advice provided with the warning CAUTION This indicates that a condition may result in damage to your vehicle or its equipment if the caution is not heeded Follow the advice provided with the caution NOTE This indicates that interesting or helpful information is being provided ...

Страница 172: ...STALLATION This vehicle is fitted with electronically controlled fuel injection or other micro processor controlled equipment It is possible for incorrectly installed two way radio equipment including mobile telephones to adversely affect these systems Before radio equipment of this kind is installed please contact your Hyundai dealer for recommendation regarding the suitability of the particular ...

Страница 173: ...sure that only the latest methods and genuine Hyundai replacement parts are used for the continued reliability safety and performance of the vehicle Should any question or query exist regarding any aspect of your Hyundai please contact the nearest Hyundai dealer who will be only too pleased to assist wherever possible Note This owners manual should be considered as part of the vehicle and should b...

Страница 174: ...he vehicle non scheduled mainte nance running repairs should be undertaken at the earliest available opportunity Under severe operating conditions more frequent maintenance is required Details of the maintenance schedule for such conditions are also given in section 5 It is recommended that all maintenance operations and repairs are entrusted to a franchised Hyundai dealer to ensure that the lates...

Страница 175: ... to all markets and includes descriptions and explanations of optional as well as standard equipment As a result some of the equipment operating descriptions referred to may not apply to the particular vehicle with which this manual is supplied Please refer to the nearest franchised Hyundai dealer for information regarding current standard and optional equipment levels SA010A1 E OWNER S MANUAL Ope...

Страница 176: ...ould be considered a part of the car and remain with it when it is sold for the use of the next owner OWNER I D ORIGINAL ADDRESS DATE OF SALE SUBSEQUENT ADDRESS TRANSFER DATE NAME STREET TOWN COUNTY P CODE NAME STREET TOWN COUNTY P CODE ...

Страница 177: ...e engine will become more quickly run in if the operation speedisvariedduringtherunninginperiod 4 Never allow the engine to labour Use the gearboxfreelyandavoidlargethrottleopen ings when the engine speed is below 1 500 rpm 5 Avoid rapid acceleration and maximum throttleopenings 6 Avoid harsh braking during the first 100 miles of urban motoring or 1 000 miles of motorwaydrivingtoallowthefrictionfa...

Страница 178: ...e exercised to ensure that the key does notbecomelockedinsidethevehiclebymistake NOTE If you make your own duplicate key you will not be able to cancel the system or start the engine AX10020A 1 B880C02A GAT Key Numbers AX10030A 1 The vehicle key number is recorded upon a metal tag attached to the keys when the vehicle is first delivered to you The key number should be recorded and kept in a safe p...

Страница 179: ...thattheredmarkonthe switch is not visible then close the door NOTE o Whenlockingthedoorthisway becareful not to lock the door with the ignition key left in the vehicle o To protect against theft always remove the ignition key close all windows and lock all doors when leaving your vehicle unattended HGK208 D UNLOCK LOCK B040D01S AAT Locking From the Inside To lock the doors from the inside simply c...

Страница 180: ... car is parked and the system is armed 1 A front door is unlocked and opened without using the transmitter 2 The hatchback door is opened without using the key 3 The engine bonnet is opened The siren will sound and the turn signal lamp will blinkcontinuouslyfor30seconds Toturnoffthe system unlock the door with the transmitter CAUTION Avoid trying to start the engine while the system is armed B070B...

Страница 181: ...In the middle of alarming or after alarming it disarms after 30 seconds if the key is turned to and kept in the ON position 3 If after disarming the system with the trans mitter the doors are not opened within 30 seconds the system will automatically re arm After completing one of steps above the turn signal lamp will blink twice to indicate that the system is disarmed HGK122 Screwdriver B070F01A ...

Страница 182: ...h To revert to normal operation push in on the window lock switch again CAUTION Nevertrytooperatethemainswitchandsub switch in opposing directions at the same time If this is done the window will stop and cannot be opened or closed Auto Down Window Driver s Side Not all models TheAuto Downwindowismovedtoitsfullyopen positionbypushingtheswitch andtostopatthe desired position push in on the switch a...

Страница 183: ... that the mecha nism has locked B050A02GK D WARNING o Be careful that head hands and body are not trapped by a closing window o If passengers remain in the car when you leave especially if a child remains alone always remove the ignition key for their safety HGK054 D SB070C1 E Front seat recline adjustment The front seat back recline angle may be ad justedbyleaningforwardslightlyandraisingthe recl...

Страница 184: ...e side of the backrest in a forward direction to increase the support HGK052 D FIRM SOFT HGK050 D SB070D2 E Head restraint adjustment To raise the head restraint pull it up To lower it push it down whilst pressing the lock knob For maximum effectiveness in the event of an acci dent the restraint must be adjusted so that the restraint is approximately at the level of the seat occupant s ears The re...

Страница 185: ...warm the front seats during cold weather With the ignition key in the ON position push either of the switches towarmthedriver sseatorthepassenger sseat During mild weather or under conditions where the operation of the seat warmer is not needed keep the switches in the OFF position HGK123 B130A01GK DAT REAR SEAT ENTRY Walk in device Thedriverandfrontpassenger sseatbackshould be tilted to enter the...

Страница 186: ...e event of sudden deceleration HGK108 B099A01F AAT BEFORE FOLDING THE REAR SEATS In order to prevent the shoulder belt from being damaged the shoulder belt must be passed through the hanger And then fold the rear seat downwards CAUTION Seat belt must be removed from the hanger when seat belt is in use HGK240 D 1 By pulling up the walk in device lever 1 at the left up side of the passenger side sea...

Страница 187: ... the country where the vehicle is in operation SB090C1 E Larger Children Larger children should occupy the rear seat and berestrainedatalltimes Therestraintmaytake the form of a special safety belt or the original factoryfittedseatbeltusedinconjunctionwithan approved booster cushion depending upon the size and weight of the child Under no circum stances should children be allowed to travel standin...

Страница 188: ...embly or assemblies should be replaced if the vehicle has been in volved in an accident even if no damage is evident Additional questions concerning seat belt operation should be directed to a Hyundai Dealer SB090O1 F FRONT SEATBELT PIVOT HEIGHT AD JUSTMENT Not all models attempt to adjust the height of the upper anchor age point while the vehicle is moving If you are any doubt as to the method of...

Страница 189: ...w the wearer maximum freedom of move ment whilst the belt is being worn However in theeventofrapiddecelerationorimpact thebelt mechanism will automatically lock The mechanism will also lock if the seat belt webbingiswithdrawntooquicklywhenthebeltis being fastened or if attempts are made to with drawthewebbingwhilstthevehicleisnotonlevel ground Should the seat belt lock under these conditions itwil...

Страница 190: ...heck the seat cover and buckles before placing a child there o When the child restraint system is not in use store it in the boot or fasten it with a safety belt so that it will not be thrown forwardinthecaseofasuddenstoporan accident o Children who are too large to be in a child restraint should sit in the rear seat and be restrainedwiththeavailablelap shoulder belts Never allow children to ride ...

Страница 191: ...manufacturer o If the seat belt does not operate as de scribed have the system checked imme diatelybyyourauthorizedHyundaidealer WARNING Donotinstallanychildrestraintsysteminthe front passenger seat Should an accident occur and cause the passenger side airbag to deploy it could severely injure or kill an infant or child seated in an infant or child seat Therefore only use a child restraint system ...

Страница 192: ...straint hook holder and tighten to secure the seat B230C04A EAT Securing a Child Restraint System with ISOFIX System and Tether Anchor age System B230F01GK ISOFIX is a standardised method of fitting child seats that eliminates the need to use the stan dard adult seat belt to secure the seat in the vehicle This enables a much more secure and positivelocationwiththeaddedbenefitofeasier andquickerins...

Страница 193: ...e child restraint seat 1 To engage the child restraint seat to the ISOFIX anchor insert the child restraint seat latch into the ISOFIX anchor Listen for the audible click sound 2 Connect the tether strap hook to the child restraint hook holder and tighten to secure theseat Referto SecuringaChildRestraint System with the Tether Anchorage System on page 1 15 HGK261 WARNING o There is no rear centre ...

Страница 194: ...aints approved for use in this mass group UF Suitable for forward facing universal cat egory restraints approved for use in this mass group L1 Suitablefor RömerISOFIXGR1 approved for use in this mass group Approval No E1 R44 03301133 X Seatpositionnotsuitableforchildreninthis mass group N A No seating position is provided The seat belt pre tensioner system consists mainly of the following componen...

Страница 195: ...AUTION o ThecontrolmodulethatactivatestheSRS airbagcontrolsthepre tensionerseatbelt also o If there is some function in the pre tensioner seat belt circuit the warning light will illuminate even if there is no malfunction in the SRS airbag system If the SRS airbag warning light does not illuminate or illuminates continuously whentheignitionkeyisturnedto ON or if it remains illuminated after blinki...

Страница 196: ...ct is sufficiently severe andwhentheimpactangleislessthan30 from the forward longitudinal axis of the vehicle and will not deploy in side rear or rolloverimpacts Additionally theairbags will only deploy once Thus seat belts must be worn at all times o Front airbags are not intended to deploy in light collisions in which protection can be provided by the seat belt alone o Front airbags are not inte...

Страница 197: ...onoftheairbags Furtheropen ing of the covers then allows full inflation of the airbags The airbag modules are located both in the centre of the steering wheel and in the front passenger s panel above the glove box When theSRSCMdetectsaconsiderableimpacttothe frontofthevehicle itwillautomaticallydeploythe airbags B240B01GK AAT SRS Components and Functions The SRS consists of the following component...

Страница 198: ...s warning will cause the SRS SRI to illumi nate FUD1115A CAUTION Wheninstallingacontainerofliquidairfresh ener inside a vehicle do not place it near the instrumentclusternorontheinstrumentpanel pad surface If there is any leakage from the air freshener onto these areas instrument cluster instrument panel pad or air ventila tor it may damage these parts If the liquid from the air freshener does lea...

Страница 199: ...the side airbag system and to avoid being injured by the deploying side airbag both front seat oc cupants should sit in an upright position with the seat belt properly fastened The driver s hands should be placed on the steeringwheelatthe9 00and3 00o clock positions The passenger s arms and hands should be placed on their laps o Do not use any accessory seat covers o Use of seat covers could preve...

Страница 200: ...information Failure to follow these precautions and procedures could increase the risk of personal injury o If you sell your vehicle be sure to inform the new owner of these important points and make certain that this manual is transferred to the new owner together with the vehicle o If your car was flooded and has soaked carpeting or water on flooring you shouldn t try to start engine have car to...

Страница 201: ...14 HeadLightLevelingDevice 15 CentreConsole 16 Glove Box 17 Parking Brake Lever 18 Shift Lever 19 Cigarette Lighter 20 Ashtray 21 Heating and Cooling Controls 22 Horn and Driver Side Airbag 23 Cruise Control Switch Not all models 24 Fuse Box Relay 25 Boot Release Lever CAUTION Wheninstallingacontainerofliquidairfreshenerinsidethevehicle donotplaceitneartheinstrumentclusternorontheinstrumentpanelsu...

Страница 202: ...ometer 9 Traction Control Indicator Light Not all models 10 Door Ajar Warning Light 11 Odometer Trip Odometer Reset Knob 12 Charging System Warning Light 13 SRS Airbag Warning Light 14 Seat Belt Warning Light 15 High Beam Indicator Light 16 Oil Pressure Warning Light 17 Malfuction Indicator Light Not all models 18 Low Fuel Warning Light 19 Parking Brake Brake Fluide Level Warning Light 20 Trip Com...

Страница 203: ... lamp will illuminate whenever the headlamps are switched to high beam of flash position 260P02Y EAT ABS SERVICE REMINDER IN DICATOR Not all models When the key is turned to the ON position the Anti Lock Brake System SRI will come on and then go off in a few seconds If the ABS SRI remains on comes on while driving or does not come on when the key is turned to the ON position this indicates that th...

Страница 204: ...hicle as soon as it is safe to do so and check the condition of the generator drive belt If thebeltisinplaceandthetensionissatisfactory theadviceofaHyundaidealershouldbesought B260H01GK EAT PARKING BRAKE BRAKE FLUID LEVEL WARNING LAMP CAUTION In the event of problems being suspected with the braking system the advice of the nearest Hyundai dealer must be sought be fore the vehicle is driven Drivin...

Страница 205: ...nateswhiledriving or does not illuminate when the ignition key is turnedtothe ON position takeyourcartoyour nearestauthorizedHyundaidealerandhavethe system checked shortage may occur This situation must be avoidedtopreventdamagetothecatalystoccur ring B260E01HP GAT SEAT BELT WARNING LIGHT Not all models The seat belt warning light blinks for about 6 secondswhentheignitionkeyisturnedfromthe OFF pos...

Страница 206: ...cale Should the indication move into the upper or Hot por tionofthescale engineoverheatingisindicated Under these circumstances the vehicle should bebroughttorestassoonasissafetodosoand theengineturnedoff Oncetheenginehascooled somewhat thecoolantlevelandtheconditionof the generator water pump drive belt should be checked If the cause of the overheating cannot be readily established the assistance...

Страница 207: ... miles and is useful for keeping a record for maintenanceintervals NOTE Anyalterationoftheodometermayvoidyour warrantycoverage 2 3 Trip odometer Records the distance of 2 trips in miles TRIP A First distance you have traveled from your origination point to a first destination TRIP B Second distance from the first destina tion to the final destination To shift from TRIP A to TRIP B press the reset ...

Страница 208: ...E SPEED o Thismodeindicatestheaveragespeedtrav elled since the last average speed reset o Pressing the reset switch for more than 1 second when the average speed is being displayed clears the average speed to zero HGK057B A Type B Type 1 DISTANCE TO EMPTY DISTANCE TO EMPTY AVERAGE SPEED DRIVE TIME o Thismodeprovidestheestimateddistanceto empty from the current fuel level in the fuel tank o Thetrip...

Страница 209: ...MULTI FUNCTION SWITCH Turn Signal Operation To signal an intention to turn right the switch lever should be pressed down To signal an intention to turn left the switch lever should be pushed upwards In both instances the turn signal lamps on one side of the car will flash and the warning lamp located in the instrument clus terwillflashinsympathy Uponcompletionofthe manoeuvre the lever will under n...

Страница 210: ...e headlight may be flashed by pulling the turn signal switch lever towards the steering wheel The headlight will be extinguished when the switch is released Toindicateanintentiontochangelanes moving the lever slightly towards the direction of the relevant turn signal will cause the turn signal lamps to flash When the lever is released it will return to the off position HGK039 D To operate the auto...

Страница 211: ...re using the wiper Thevariableintermittentwipefacilityisoperated by moving the windscreen wiper switch to the first position The time period between wipes is adjusted by moving the rotary control on the windscreen wiper switch barrel B350B01O EAT WINDSCREEN WASHER OPERATION To use the windscreen washer pull the wiper washer lever toward the steering wheel When the washers are operated the wipers a...

Страница 212: ...hould never be cleaned with a hard or sharp imple ment since damage to the heating element mayoccur Theglassshouldonlybecleaned with a soft cloth or chamois leather with the use only of a mild detergent or proprietary glass cleaner where necessary Only hori zontalmovementoftheclothshouldbemade when cleaning the glass and care should be exercisedtoensurethattheheatingelements are not damaged by rin...

Страница 213: ...adout to 12 00 The level of illumination intensity of the instru ment panel may be varied by turning the control shown The instrument panel will be illuminated when the side or head lamps are in operation For the cigar lighter to work the key must be in the ACC or the ON position To use the cigar lighter push the lighter all the wayintoitssocket Whentheelementisheated the lighter will pop out into...

Страница 214: ...ng to the list B450A01GK GAT DRINK HOLDER Not all models HGK149 D Thedrinkholderisusedforholdingcupsorcans To use the passenger s drink holder push the drinkholder WARNING Donotplaceobjectsotherthancupsorcans in the drink holder Such objects can be thrownoutintheeventofasuddenstoporan accident possiblyinjuringthepassengersin thevehicle Driver s Passenger s B430A01GK AAT FRONT ASHTRAY Thefrontashtr...

Страница 215: ... Your HYUNDAI is equipped with a sliding sun shade which you can manually adjust to let in lightwiththesunroofclosed ortoblocksunlight WARNING Never adjust the sunshade while driving B460B01GK GAT Opening the Sunroof System HGK030 Thesunroofcanbeelectricallyopenedorclosed with the ignition key in the ON position The sunroof is moved to its fully open position by pushing the OPEN switch and to stop...

Страница 216: ...sitionby pushing the UP switch and to stop at the desired position push in any switches Open Close Up Down Totiltdown pressandholdthe DOWN button Release the button when the sunroof reaches the desired position NOTE Afterwashingthecarorafterthereisrain be sure to wipe off any water that is on the sunroof before operating it B460E02GK GAT Resetting the Sunroof System Ifthebatteryhasbeenrecharged di...

Страница 217: ...P LIGHT HGK034 1 Pushinthemaplightswitchtoturnthedriver side light 2 Inthe DOOR position theinteriorcourtesy light comes on when any door is opened regardless of the ignition key position The light goes out gradually 6 seconds after the door is closed 3 Push in the map light switch to turn the passenger side light 1 2 3 HGK036 B500A01A EAT GLOVE BOX WARNING To avoid the possibility of injury the g...

Страница 218: ...Y EAT OUTSIDE REARVIEW MIRROR HEATER Not all models Theoutsiderearviewmirrorheaterisactuatedin connection with the rear window defroster To heat the outside rearview mirror glass push in the switch for the rear window defroster The rearview mirror glass will be heated for defrost ing or defogging and will give you improved rear visionininclementweatherconditions Pushthe switch again to turn the he...

Страница 219: ...d lower the lever SB370A1 E INTERIOR REAR VIEW MIRROR The interior mirror is of the day night type to enable the glare of headlamps from following vehicles to be eliminated during night time driv ing Thetablocatedatthebottomofthemirrorshould be set to the position nearest the windscreen for normaldaytimedriving andflippedtowardsthe rear of the vehicle to eliminate glare during night time driving T...

Страница 220: ... inserted in the rear spoiler also comes on when the brakes are applied B360B01GK GAT REAR FOG LIGHT SWITCH Not all models HGK183 To turn on the rear fog lights push the switch They will come on when the headlights are turnedon B550A01GK A Type B Type YB800A2 A FRONT FOG LIGHT SWITCH Not all models To turn on the front fog lights push the switch They will come on when the headlights are turned on ...

Страница 221: ...not latched the bonnet could fly open while the vehicle is being driven causing a total loss of visibility which might result in an accident o Donotmovethevehiclewiththebonnetin theraisedposition asvisionisobstructed and the bonnet could fall or be damaged B570A01GK EAT BONNET RELEASE 1 Pull the release knob to unlatch the bonnet HGK106 D Bonnet Release Lever HGK098 2 Press the safety hook lever u...

Страница 222: ... on the fuel filler lid release NOTE If the fuel filler lid will not open because ice has formed around it tap lightly or push on the lid to break the ice and release the lid Do not lever the lid If necessary spray around the lid with an approved de icer fluid do not use radiator anti freeze or move the vehicle to a warm place and allow the ice to melt HGK105 D HGK124 WARNING Fuel vapours are dang...

Страница 223: ...ead of a person sitting upright on the rear seat Closing the hatch back door onto a person s head may cause serious injuries including death SB510A1 E SUNVISOR Sun visors are fitted to both the driver and pas senger side of the vehicle Certain derivatives areequippedwithavanitymirrorwhichislocated on the back of the passenger visor The visor may be lowered to reduce the amount of glare from direct...

Страница 224: ... face and body out of recoil path DO NOT use when strap has visible signs of wear or damage SB530B1 F HORN Pressthepadonthesteeringwheeltosoundthe horn HGK141 WorkingZone B540D02HP DAT LUGGAGE NET Not all models HGK241 A Type B Type B600A01HP AAT STEERING WHEEL TILT LEVER Not all models To adjust the steering wheel 1 Pullthelevertowardyouandholdittounlock 2 Raise or lower the steering wheel to the...

Страница 225: ...fromtheacceleratorpedal and the desired speed will automatically be maintained 5 To increase speed depress the accelerator pedal enough for the vehicle to exceed the preset speed When you remove your foot from the accelerator pedal the vehicle will return to the speed you have set B660C01GK B660C01E AAT To Cancel the Cruise Speed Do one of the followings o Pull the control switch toward steering w...

Страница 226: ...ained release the control switch While the control switch is pushed the vehicle speed will gradually de crease WARNING o Keep the main switch off when not using the cruise control o Do not use the cruise control when it may not be safe to keep the car at a constant speed for instance driving in heavy or varying traffic or on slippery rainy icy or snow covered or winding roads or over 6 up hill or ...

Страница 227: ... are located on each side of dashboard To change the direction of the air flow move the knob in the center of the vent up and downandside to side Thesideventknobs control the amount of outside air entering the vehicle through the side vents The vents are opened when the vent knob is moved to the up position The vents are closed when the vent knob is moved to the down position Keep these vents clea...

Страница 228: ...trol HGK006 This is used to turn the blower fan on or off and to select the fan speed Thisblowerfanspeed andthereforethevolume of air delivered from the system may be con trolled manually by setting the blower control between the 1 and 4 positions 1 2 3 4 5 6 1 Air Conditioning switch 2 Air intake control switch 3 Rear window defroster switch 4 Air flow control switch 5 Fan speed control switch 6 ...

Страница 229: ...rol is recirculation mode With the Fresh mode selected air enters the vehicle from the outside and is heated or cooled according to the function selected With the Recirculation mode selected air from within the passenger compartment will bedrawn throughtheheatingsystemandheatedorcooled according to the function selected NOTE o It should be noted that prolonged opera tionoftheheatingin Recirculatio...

Страница 230: ... be discharged through the face level vents HGK022 D Bi Level Air is discharged through the face vents and the floor vents This makes it possible to have cooler airfromthedashboardventsandwarmerairfrom the floor outlets at the same time HGK021 D If the Floor Defrost mode is selected the A C will be on automatically and it will be changed to Fresh mode Defrost Level Airisdischargedthroughthewindscr...

Страница 231: ...are not blocked by leaves snow ice or other obstructions o Topreventinteriorfogonthewindscreen set the air intake control to the fresh air position and fan speed to the desi red posi tion NOTE When the A C is operated continuously on the floor defrost level or defrost level it may cause fog to form on the exterior windscreen by the temperature differential Atthistimesettheairflowcontroltotheface l...

Страница 232: ... to Fresh mode o Setthetemperaturecontrolto Cool Cool providesmaximumcooling Thetemperature may be moderated by moving the control toward Warm o Adjust the fan control to the desired speed For greater cooling turn the fan control to one of the higher speeds or temporarily select the Recirculation position on the air intakecontrol B740C01S AAT Dehumidified Heating Fordehumidifiedheating o Turn on t...

Страница 233: ...nd Cooling Controls TYPE A Without Air Quality System TYPE B With Air Quality System 1 TemperatureControlButton 2 Defroster Switch 3 DisplayWindow 4 Air Conditioning Switch 5 Rear Window Defroster Switch 6 Fan Speed Control Switch 7 Air Flow Control Switch 8 AUTO Automatic Control Switch 9 OFF Switch 10 Air lntake Control Switch 11 AmbientSwitch 12 Air Quality System Switch Not all models HGK004 H...

Страница 234: ...e to increase by 1 F 0 5 C The temperature will decrease to the mini mum62 F 17 C bypushing onthe button Each push of the button will cause the tem perature to decrease by 1 F 0 5 C G280A01GK D Photo sensor HGK014 NOTE Never place anything over the sensor which is located on the instrument panel to ensure better control of the heating and cooling system NOTE Ifthebatteryhasbeendischargedordiscon n...

Страница 235: ...tomatically Press the AUTO button in order to convert to automatic control of the system Pressing the button displays the amb ient temperature on the display B995A01Y GAT AMBIENT SWITCH HGK009 B670C01GK EAT Air Intake Control Switch Without A Q S HGK008 1 Thisisusedtoselectfreshoutsideairorrecircu lation inside air To change the air intake control mode Fresh mode Recirculationmode pushthecontrolbu...

Страница 236: ...vent exhaust gas from entering the vehicle NOTE o It should be noted that prolonged opera tionoftheheatingsysteminrecirculation mode will give rise to mis ting of thewindscreenandsidewindowsandthe airwithinthepassengercompartmentwill become stale In addition prolonged use of the air conditioning with the recircula tion mode selected may result in theairwithinthepassengercompartment becomingexcessi...

Страница 237: ...l When selecting the Face mode the indicator light will come on causing air to be discharged through the face level vents Bi Level When selecting the Bi Level mode the indica torlightwillcomeonandtheairwillbedischarged through the face vents and the floor vents This makes it possible to have cooler air from the dashboard vents and warmer air from the floor outlets at the same time Floor Level When...

Страница 238: ...frost Switch When the Defrost button is pressed the mode will be automatically selected and the air will be discharged through the windscreen de frost vents To assist in defrosting the air condi tioning will operate if ambient temperature is higherthan38 3 F 3 5 C andautomaticallyturns off if the ambient temperature drops below 38 3 F 3 5 C HGK012 B740D01A AAT Operation Tips o If the interior of t...

Страница 239: ...on closeness of other strong radio stations or the presence of buildings bridges or other large obstructions in the area AM broadcasts can be received at greater dis tancesthanFMbroadcasts ThisisbecauseAM radio waves are transmitted at low frequencies These long low frequency radio waves can follow the curvature of the earth rather than travelling straight out into the atmosphere In addition they ...

Страница 240: ...SAR013A o Station Swapping As an FM signal weak ens another more powerful signal near the same frequency may begin to play This is because your radio is designed to lock onto the clearest signal If this occurs select another station with a stronger signal o Multi PathCancellation Radiosignalsbeing received from several directions can cause distortionorfluttering Thiscanbecausedby a direct and refl...

Страница 241: ...extend the tape life and increase your listening enjoy ment Always protect your tapes and cassette casesfromdirectsunlight severecoldanddusty conditions When not in use cassettes should alwaysbestoredintheprotectivecassettecase inwhichtheywereoriginallysupplied Whenthe vehicle is very hot or cold allow the interior temperaturetobecomemorecomfortablebefore listening to your cassettes o Never leave ...

Страница 242: ...ead capstanandpinchrollers willdevelopacoatingoftaperesiduethatcan result in deterioration of sound quality such asawaveringsound Theyshouldbecleaned monthlyusingacommerciallyavailablehead cleaning tape or special solution available from audio specialty shops Follow the supplier s directions carefully and never oil any part of the tape player unit o Always be sure that the tape is tightly wound on...

Страница 243: ...toreceiveboth AM and FM broadcast signals Thisantennaisaremovabletype Toremovethe antenna turntheantennacounterclockwise To install the antenna turn the antenna clockwise CAUTION Be sure to remove the antenna before wash ing the car in an automatic car wash or the antenna may be damaged B870A01F ...

Страница 244: ...spected at the first available opportunity to ensure that no leakage exists o Confined Areas Do not run the engine in confined spaces allowing the engine to idle in a garage even when the doors are open is dangerous practice Only start the engine immediately prior to moving the vehicle out of the garage o Prolonged Idling If it is necessary to allow the vehicle to idle for prolonged periods ensure...

Страница 245: ...t 15 seconds NOTE For safety the engine will not start if the shift lever is not in P or N Position Auto T A SC040A1 F COMBINATIONIGNITIONSWITCHAND STEERING LOCK To Start the Engine o If your Hyundai is equipped with a manual transaxle place the shift lever in neutral and depress the clutch pedal fully o If your Hyundai has an automatic transaxle place the shift lever in P park SC050A2 E KEY POSIT...

Страница 246: ...eel slightly to facilitate turning the key Under no circum stances should the key be forced since break age of the key will occur SC060A1 E STARTING THE ENGINE C050A01E SC090D1 F To Remove the Ignition Key 1 Turn the ignition key to the ACC position 2 Simultaneously push and turn the ignition key counterclockwise from the ACC posi tion to the LOCK position 3 The key can be removed in the LOCK posi...

Страница 247: ... mileage intervals speci fied o Use the air conditioning only when neces sary NOTE Do not operate the starter for more than 15 seconds continuously or continue to oper ate the starter after the engine has started to avoid damaging the starter motor If the engine makes a false start allow it and the starter motor to come to rest before at tempting to start the engine again Never attempt to start th...

Страница 248: ...shifting may be dif ficult until the transaxle lubricant has warmed up This is normal and not harm ful to the transaxle o If you ve come to a complete stop and it s hard to shift into 1st or R Reverse put the shift lever in N Neutral position and let up on the clutch Press the clutch pedal back down and then shift into 1st or R Reverse gear position o Do not use the shift lever as a handrest durin...

Страница 249: ...ed Failure to observe this caution will cause severe damage to the transaxle C090C01A AAT o R Reverse Use for backing up the vehicle Bring the car to a complete stop before shifting the selector lever to R position C090D02O AAT o N Neutral In the N position the transaxle is in neutral which means that no gears are engaged The engine can be started with the shift lever in N position although this i...

Страница 250: ... must be fully stopped to avoid transaxle damage CAUTION o In sports mode the driver must execute shifts in accordance with prevailing road conditions taking care to keep the en gine speed below the red zone o For engine protection upward shifts are made automatically when the engine rpm reaches the red zone o By rapidly moving the selector lever back wards twice it is possible to skip one gear by...

Страница 251: ...y be avoided o When descending long gradients use the engine to assist in retarding the vehicle to minimize the possibility of brake fade occur ring o When trailer towing ensure that the trailer brakes function correctly and use engine braking to assist the vehicle braking system o Use only genuine Hyundai replacement brake pads and shoes to ensure consistent friction characteristics and wear rate...

Страница 252: ...ents due to im proper or dangerous driving manoeuvres Even though vehicle control is improved during emergency braking always maintain a safe distance between you and objects ahead Vehicle speeds should always be reduced during extreme road conditions The braking distance for cars equipped with an anti lock braking system may be longer than for those without it in the following road conditions o R...

Страница 253: ...plights Try to adjust your speed to that of the other traffic so you don t have to change speeds unnec essarily Avoid heavy traffic whenever possible Al ways maintain a safe distance from other vehicles so you can avoid unnecessary brak ing This also reduces brake wear o Drive at a moderate speed The faster you drive the more fuel your car uses Driving at a moderate speed especially on the high wa...

Страница 254: ...Lugging is driving too slowly in too high a gear resulting in the engine bucking If this hap pens to you shift to a lower gear Over revving is racing the engine beyond its safe limit This can be avoided by shifting at the recommended speeds o Use your air conditioning sparingly The air conditioning system is operated by the en gine power so your fuel economy is reduced when you use it SC160A1 F SM...

Страница 255: ...hecked periodi cally and any accumulated snow or ice removed o It is advisable to carry emergency equip ment including torch shovel tow rope blan kets etc if a journey is to be undertaken into areas of severe road conditions ZC170D1 E Door Locks Should the door lock mechanism become fro zen a proprietary lock de icer should be used Alternatively warming the door key may thaw the door lock However ...

Страница 256: ...rably before each towing session The trailer towbar hitch and the safety catch mechanism must be maintained in good work ing order The trailer break away cable or cable should be inspected for damage and should be attached to the vehicle towing attachment each and every time the trailer is hitched to the vehicle Whilst towing the performance of the vehicle will be reduced in terms of acceleration ...

Страница 257: ... a hill be sure to follow all the normal precautions Turn your front wheel into the curb set the parking brake firmly and put the transaxle in 1st or Reverse manual or Park automatic In addition place wheel chocks at each of the trailer s tires o The maximum permissible static vertical load on the coupling device o The maximum permissible overhang of the coupling point 38 98 in 990 mm 1 6 L 2 0 2 ...

Страница 258: ...y 14 When going down a hill shift into a lower gear and use the engine braking effect When ascending a long grade downshift the transaxle to a lower gear and reduce speed to reduce chances of engine overloading and or overheating 15 If you have to stop while going uphill do not hold the vehicle in place by pressing on the accelerator This can cause the automatic transaxle to overheat Use the parki...

Страница 259: ...e is equipped with an ex haust catalyst damage to the catalyst may result if the vehicle is tow started SD020B1 E IF THE ENGINE CANNOT BE CRANKED 1 If the vehicle is fitted with manual transaxle ensure that the clutch pedal is depressed whilst cranking the engine If the vehicle is fitted with automatic transaxle ensure that D010C01A AAT IfEngineTurnsOverNormallybutDoes Not Start 1 Check fuel Level...

Страница 260: ...another vehicle ensure that the two vehicles are not touching 2 Turnoffallunnecessaryelectricalequipment in both vehicles 3 Ensure that the engine of the vehicle provid ing the jump start is running prior to connec tion of the jump cables 4 Connecttheredjumpcabletothepositive terminal of the booster battery and the other end to the positive terminal of the dis chargedbattery 5 Attach the black jum...

Страница 261: ...EAT TEMPORARY SPARE TYRE Thefollowinginstructionsforthetemporaryspare tyre should be observed 1 Check inflation pressure as soon as practical afterinstallingthesparetyre andadjusttothe specifiedpressure Thetyrepressureshould be periodically checked and maintained at the specifiedpressurewhilethetyreisstored 2 Thesparetyreshouldonlybeusedtemporari ly and should be returned to the luggage compartmen...

Страница 262: ...of the driver to avoid scratching 2 Insert a driver into the groove of the wheel cap and pry gently to remove the wheel cap 3 Change the flat tyre 4 Reinstallthewheelcapbyfittingthebossofthe wheelcapinthegrooveofthewheel hittingthe centre of the wheel cap with hand Boss HGK196 HGK224 Groove Groove HGK189 HGK191 The jack is located in the right side of luggage trim Remove the jack cover with screwi...

Страница 263: ...ng a bar into the wheel nut wrench install the bar into the jack as shown in the draw ing Toraisethevehicle turnthewheelnutwrench clockwise Asthejackbeginstoraisethevehicle doublecheckthatitisproperlypositionedandwill notslip Ifthejackisonsoftgroundorsand place aboard brick flatstoneorotherobjectunderthe base of the jack to keep it from sinking Raisethecarhighenoughsothatthefullyinflated sparetire...

Страница 264: ...res withthewheelfromfittingsolidlyagainstthe hub If there is remove it If there is not good contactonthemountingsurfacebetweenthe wheel and hub the wheel nuts could come loose and cause the loss of a wheel Loss of a wheel may result in loss of control of the vehicle This may cause serious injury or death STA3071H D060G02Y EAT 6 Changing Wheels Loosen the wheel nuts and remove them with yourfingers...

Страница 265: ...h a suitable torque wrench Wheel nut tightening torque Steel wheel aluminium alloy wheel 90 110 Nm 65 80 lb ft SD070K1 E AFTER CHANGING WHEELS Thepressureofthesparetyreshouldbechecked at the first available opportunity If any doubt exists as to the tyre pressure the vehicle should be driven slowly to the nearest service station and the tyre pressure checked and adjusted as required If the valve ca...

Страница 266: ...will need to be reduced again after towing The vehicle must not be towed at speeds fasterthan25mph ordistancesgreaterthan fifty miles The general points regarding the steeringlocketc describedinthepreceding section Manualtransaxlevehicle shouldbe observed D120A01A EAT IF YOU LOSE YOUR KEYS Informationaboutthekeyofimmobilizersystem will be found on page 1 2 SD090A1 E Manual Transaxle Vehicle o OK F...

Страница 267: ...ay retain maximum effectiveness it is recommend ed that the underbody receives a power wash and a thorough inspection after each winter season In doing so any accumulations of mud which act as moisture traps and combine with road salts to accelerate corrosion will be re moved In order to maintain the Anti Perforation Warranty the requirements regarding the SE000A1 E 4 APPEARANCE CARE E030A01GK AAT...

Страница 268: ...high quality as those used in manufacture ofthevehicleandthatthecorrectrepairmethods and materials will ensure adequate levels of corrosionprotectionandthecontinuedvalidityof the Anti Perforation Warranty SE050A1 E INTERIOR During the winter period it is possible that the passenger compartment flooring may become wet from damp footwear or quantities of snow adhering to footwear The carpet should n...

Страница 269: ...ic equipment spe cifically designed for Hyundai vehicles The use of general purpose electrical test equip mentmayresultindamagetothecontrolunit microprocessors SF020C1 E Specified Scheduled Procedures The Specified scheduled procedures are listed in the maintenance charts beginning at page 5 2 The operations specified must be performed at the time or mileage intervals shown irrespec tive of whethe...

Страница 270: ...cle warranty F030B01GK EAT R REPLACE I INSPECT AND AFTER INSPECTION CLEAN ADJUST REPAIR OR REPLACE IF NECESSARY ENGINE CONTROL SYSTEM MAINTENANCE ENGINE OIL FILTER SG OR ABOVE See Note 1 DRIVE BELT 2 0 DOHC CVVT ALT W PUMP P STR G 1 6 DOHC 2 7 V6 AUTO TENSIONER ALT P STR G A CON FUEL FILTER MPI TYPE FLUID LEAKS TIMING BELT VENTILATION HOSE AIR CLEANER FILTER SPARKPLUG 1 6 2 0L SPARKPLUGS 2 7L VALV...

Страница 271: ...ENSION AND STEERING SYSTEM FRONT SUSPENSION BALL JOINTS POLLEN FILTER For Blower unit REAR WHEEL BEARINGS TYRE CONDITION AND PRESSURE incl Spare LUBRICATE LOCKS AND HINGES CHECK ALL ELECTRICAL SYSTEMS ROAD TEST CHECK ALL SYSTEMS WITH HI SCAN CHECK 4 GAS DRIVE SHAFT BOOT MILES X 1000 MONTHS NO DESCRIPTION 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 I I I I I I I I I I R I I I I I I I I 10...

Страница 272: ...AUTOMATIC TRANSAXLE FLUID POLLEN FILTER FOR BLOWER UNIT EVERY 4 500MILES OR 6 MONTHS EVERY 3 000MILES OR 6 MONTHS MORE FREQUENTLY MORE FREQUENTLY EVERY 37 000MILES OR 48MONTHS MORE FREQUENTLY MORE FREQUENTLY MORE FREQUENTLY EVERY 9 000MILES OR 12 MONTHS EVERY60 000MILES EVERY27 000MILES MORE FREQUENTLY A B C F H C E B H D E F G C D G H C D G H C D E F C D E F G A C D E F G H I J A C E F G H I C E ...

Страница 273: ...ure andthatno leaks are present Hoses should be replaced immediatelyifthereisanyevidenceofdeteriora tion or damage 6ZF060H1 A o Air cleaner filter A Genuine Hyundai air cleaner filter is recom mended when the filter is replaced 6ZF060J1 A o Spark plugs Make sure to install new spark plugs of the correct heat range 6ZF060A1 A EXPLANATION OF SCHEDULED MAINTENANCE ITEMS 6ZF060M1 A o Engine oil and fi...

Страница 274: ...uidlevelwiththeenginerunningand the transaxle in neutral with the parking brake properly applied Use DIAMOND ATF SP III SK ATF SP III when adding or changing fluid 6ZF070M1 A o Steering gear box linkage boots lower arm ball joint With the vehicle stopped and engine off check for excessive freeplay in the steering wheel Check the linkage for bends or damage Check the dust boots and ball joints for ...

Страница 275: ...oninglinesandconnections forleakageanddamage Checkairconditioning performance according to the relevant shop manual if necessary 6ZF070P1 A o Driveshafts and boots Check the drive shafts boots and clamps for cracks deterioration or damage Replace any damaged parts and if necessary repack the grease ...

Страница 276: ...1GK EAT ENGINE COMPARTMENT 1 6 DOHC 1 Clutch fluid reservoir Not all models 2 Engine oil filler cap 3 Brake Booster 4 Brake fluid reservoir 5 Relay box 6 Windscreen washer fluid reservoir cap 7 Power steering fluid reservoir 8 Engine coolant reservoir 9 Engine oil level dipstick 10 Radiatorcap 11 Automatic transaxle fluid level dipstick Not all models 12 Air cleaner 13 Battery HGK238 D 1 2 3 4 5 6...

Страница 277: ...er of the engine is not damaged 1 Clutch fluid reservoir Not all models 2 Engine oil filler cap 3 Brake Booster 4 Brake fluid reservoir 5 Relay box 6 Windscreen washer fluid reservoir cap 7 Power steering fluid reservoir 8 Engine coolant reservoir 9 Engine oil level dipstick 10 Radiatorcap 11 Automatic transaxle fluid level dipstick Not all models 12 Air cleaner 13 Battery 1 2 3 4 5 6 7 8 9 10 11 ...

Страница 278: ...t 6 Relay box 7 Windscreen washer fluid reservoir cap 8 Engine coolant reservoir 9 Engine oil level dipstick 10 Radiatorcap 11 Engine oil filler cap 12 Automatic transaxle fluid level dipstick Not all medels 13 Battery 1 2 3 4 5 7 8 9 10 11 12 6 13 CAUTION Wheninspectingorservicingtheengine you shouldhandletoolsandotherheavyobjects carefully so that the plastic rocker cover of the engine is not da...

Страница 279: ...w oil level may result in irreparable damage being sus tainedbytheengine Theengineoillevelmustbe checkedonadailybasisorwheneverthevehicle is refuelled whichever occurs sooner Inaddition itisimperativethatonlyanapproved gradeandspecificationofoilisusedtoavoidthe possibilityofseriousenginedamageandprema ture wear The use of budget price oil is a false economy that must be avoided if the maximum reli...

Страница 280: ... cap rotating it in a clockwise direction until tight Thequantityofoilrequiredtoraisethelevelfromthe minimumtomaximumlevelisapproximately1litre SG030C1 E Engine Oil Level The engine oil level should be checked with the engineatnormaloperatingtemperatureandthe vehicle parked upon level ground Priortocheckingthelevel thevehicleshouldbe allowed to stand for several minutes after the engine has been s...

Страница 281: ...l specified in the mainte nanceschedule Ifthevehicleisoperatedunder severe or adverse conditions the oil and filter must be replaced more frequently To replace the oil and filter proceed as follows 1 Ensurethattheengineisatnormaloperating temperature and park the vehicle on level ground with the parking brake securely ap plied and the engine turned off 2 Openthebonnetandremovetheoilfillercap 3 Pre...

Страница 282: ...uld not be exceeded for general use The use of methanol based anti freeze com poundsmayresultinengineoverheatingandwill invalidate the vehicle warranty NOTE It is imperative that vehicles fitted with an air conditioningsystemhaveacoolantconcen tration of the recommended strength at all times Theuseoftheairconditioningsystem when the cooling system is filled with water only will result in the heate...

Страница 283: ...eservoir 7 When the engine is hot check to ensure that no coolant leaks are present WARNING Thecoolingfaniscontrolledbyenginecool anttemperatureandmaysometimesoperate even when the engine is not running Use extremecautionwhenworkingneartheblades of the cooling fan so that you are not injured byarotatingfanblade Astheenginecoolant temperaturedecreases thefanwillautomati cally shut off This is a nor...

Страница 284: ...s correctly seated by lightly pulling upon it RecommendedSparkPlugs To replace the air cleaner element remove the air intake ducting from the air flow sensor body and unfasten the spring clips holding the air flow sensortoptothebody Liftouttheairflowsensor followed by the air cleaner element Replace ment of the element is the reverse of the above CAUTION o The air flow sensor is a precision engi n...

Страница 285: ...the glass replace them with genuine Hyundai re placement CAUTION o Do not operate the wipers on dry glass since rapid wear and damage to the windscreen glass may result o Keep the blade rubber out of contact with petroleum products such as engine oil petrol etc The level of windscreen washer fluid available should be checked on a daily basis The level of fluid will be visible through the side of t...

Страница 286: ...r hot parts of the en gine G110B03A AAT Recommended Fluid Your Hyundai automatic transaxle is specially designedtooperatewithDIAMONDATFSP III SK ATF SP III Damage caused by a nonspecified fluid is not covered by your new vehicle limited warranty G110D02GK EAT Transaxle fluid level checking Thevehiclemustbeparkedonlevelgroundwith theparkingbrakefirmlyappliedandtheengineat normal operating temperatu...

Страница 287: ...thatthebrake fluid level will decrease slightly as the friction linings of the pads and shoes become worn and that this is a normal condition higher mark If additional fluid is required this should be poured into the transaxle through the dipstick tube with the aid of a suitable funnel WARNING Thecoolingfaniscontrolledbyenginecool anttemperatureandmaysometimesoperate even when the engine is not ru...

Страница 288: ...markings on the fluid reservoir Fill as required Fluid loss indicates a leak in the clutch system which should be inspected and repaired immediately SG130B2 E Adding Fluid RecommendedbrakefluidconformingtoDOT3 orDOT4shouldbeused Thereservoircapmust be fully tightened to avoid contamination from foreign matter or moisture CAUTION Brake fluid is hygroscopic and should never be stored in an unsealed ...

Страница 289: ...ealer CAUTION Running the air conditioning system for ex tended periods of time with a low refrigerant level may damage the compressor A C CRANK PULLEY TENSION PULLEY 0 315 in 8mm G140D01GK V6 DOHC Auto tensioner Eng pulley COMP SG140D1 E Off Season Maintenance The air conditioning must be run for ten minutes or so weekly during periods when the system would not normally be used to ensure that the...

Страница 290: ... or deterioration SG150A1 E STEERING WHEEL FREEPLAY Steering wheel freeplay should be checked to ensure that the specified value is not exceeded HGK218 SG160A1 E CLUTCH PEDAL FREEPLAY SSA6160A 0 24 0 51 in 6 13 mm The clutch pedal freeplay should be checked against the specified value If the freeplay is not correct the clutch should be adjusted by a Hyundaidealer 1 18in 30 mm 3 Remove the filter c...

Страница 291: ...lowing fitment of the new belt to allow for the initial belt stretch SG200A1 E FUSIBLE LINKS AS60310A Melted Good The fusible link prevents damage to the wiring harness in the event of an electrical system malfunction Failure of a fusiblelink is indicative of a serious overload condition having occurred and therefore the electrical system should be checked by a Hyundai dealer before a replace ment...

Страница 292: ...ery which is ex plosive when combined with oxygen The following precautions must be strictly ob servedtoavoidpersonalinjuryordamageto thevehicle HGK185 D SG220A1 E ELECTRIC COOLING FANS WARNING Thecoolingfaniscontrolledbyenginecool anttemperatureandmaysometimesoperate even when the engine is not running Use extremecautionwhenworkingneartheblades of the cooling fan so that you are not injured byaro...

Страница 293: ...n the following pharagraph will as sistinlocatingandremovingtheheadlightbulbs Ensure that the replacement bulb has the same cap configuration and wattage as the original SG230B1 E POWER STEERING HOSES Power steering hoses should be checked for damage deterioration and leakage at each ser vice Theenginecoolingfanshouldoperatebeforethe temperaturegaugereachestheupperportionof the scale and the conde...

Страница 294: ...ulb Protectthebulb against abrasions or scratches and against liquids when lighted Turn on the bulb only when installed in a headlight Replace the headlight if damaged or cracked Keep the bulboutofthereachofchildrenanddispose of the used bulb with care Vertical aiming G290A01GK Horizontalaiming Low Beam Vertical aiming G290A02GK Horizontal aiming High Beam 7 Adjusteachcut offlineofthelowbeamtothe ...

Страница 295: ...ofheadlightsfromground Low Beam 26 7 in 679mm High Beam 26 5 in 672mm W Distance between each headlight centre Low Beam 47 3 in 1 202mm High Beam 38 0 in 966mm L Distance between the headlights and the wall that the lights are tested against 118 11 in 3 000 mm ...

Страница 296: ... Signal Light Front Door Edge Warning Light LuggageCompartmentLight No 1 2 3 4 5 6 7 No 8 9 10 11 12 13 Part Name HighMounted Withoutspoiler Stop LIght With spoiler Rear Turn Signal Light Combination Stop TailLight Back up Light License Plate Light Rear Fog Light Not all models Wattage 2 4 LED 3 5 LED 21 21 5 21 5 21 5 11 12 13 3 4 6 HGK035A 1 1 8 2 High Low 10 9 7 ...

Страница 297: ...ht TCM ECM Horn A conditioner Head Light High Head Light LOW FUSE RATING 120A 50A 30A 30A 30A 30A 30A 30A 30A 15A 10A 15A 15A 10A 15A 15A 15A DESCRIPTION BATT BATT COND RAD ECU IGN ABS 1 ABS 2 BLOWER INJ SNSR DRL F FOG ECU HORN A CON H LP H1 H LP LO NOTE Not all fuse panel descriptions in this manual may be applicable to your vehicle It is accurate at the time of printing When you inspect the fuse...

Страница 298: ...Gauge Unit B Up Lamp Air Bag Indicator Air Bag Outside Mirror Defroster Hazard Warning Light Rear Window Wiper Taillight Front Window Wiper A Conditioner Rear Window Defroster Stop Light Tail light A Conditioner ECM Multi Gauge Unit TCM Cluster Map Light Clock Audio Power Window Hatchback door Open A Con A Q S Sensor Rear Fog C Lighter Outside Mirror Sunroof Seat Warmer ABS TCS Audio Clock FUSERAT...

Страница 299: ...010C1 E 2 EVAPORATIVE EMISSION CONTROL SYSTEM The Evaporative Emission Control System is designed to prevent fuel vapours from escaping into the atmosphere through the fuel tank venti lation system Whilst the engine is not running fuel vapours generatedinsidethefueltankareabsorbedand storedinacharcoalcanister Whentheengineis started the vapours stored in the canister are drawn into the induction s...

Страница 300: ...th a gas analyzer having a Hydrocar bon measuring facility to ensure continued reli ability of the catalyst Push or tow starting of the vehicle is to be avoided since unburnt fuel may be enter the catalystandresultindamage Note itisimpos sible to push or tow start a Hyundai model equipped with fuel injection since the fuel pump safetyinterlockwillpreventthepumpfromoper ating under these conditions...

Страница 301: ...hrough overheating The tyre pressure must only be checked when the tyres are cold The correct tyre pressures are indicated on the label affixed to the drivers door pillar and below Tyre pressures should be increased by 3 psi when the vehicle is driven fully laden or under conditions of sustained high speed motoring SI030A2 E SNOW TYRES If it is desired to fit snow tyres to the vehicle it must be a...

Страница 302: ...rnation Itisnotrecommendedthatradialply tyres be rotated from side to side NOTE Aluminiumwheelswhicharenotsuppliedas Original Equipment should not be mixed on thesamevehiclewiththeoriginalsteelwheels WARNING Whenrotatingthe215 45R17tyres ensureto follow the ROTATION direction marked on the sidewall of tyres When rotating the tyres of the left and right separate the wheel from the tyre and then re ...

Страница 303: ...additiontothis thetyre must be replaced if any portion of the tread has become bald or if there are any lumps bulges or deep cuts in the sidewalls or tread SI060D1 E WHEEL REPLACEMENT The original wheels may only be replaced with Hyundai Approved Wheels WARNING Drivingonwornordefectivetyresisdanger ous Worn tyres may cause loss of steering controlandaseriousdeteriorationofbraking efficiency Defect...

Страница 304: ...30A01GK DAT TYRE J040A02GK GAT ELECTRICAL Item Battery Alternator Overalllength Overall width Overallheight unladen Wheelbase Wheeltread Front Rear Type Wheel free play Rack stroke Oil pump type Fuel tank capacity US gal 14 5 Imp gal 12 2 7 V6 215 45 R17 1 6L MF 60AH 90A 2 0L MF 68AH 90A 2 7L MF 68AH 95A J035A01GK DAT SPARE TYRE T125 70R16 Temporary Standard Dual hydraulic with brake booster Venti...

Страница 305: ...5 Foradjusting For checking In Ex In Ex 1 6 L 76 5 x 87 1 599 1 3 4 2 AUTO LASH BKR5ES 11 RC10YC4 700 100 BTDC 5 5 2 7 L 2 7 6 Cylinder V6 DOHC 86 7 x 75 2 656 1 2 3 4 5 6 AUTO LASH PFR5N 11 RC10PYPB4 750 100 BTDC 12 10 J070A03GK EAT ENGINE ITEMS EngineType Bore x Stroke Displacement cc Firingorder Valveclearance ColdEngine 20 5 C Spark plug Spark plug gap Idle speed RPM Ignition timing Base NGK C...

Страница 306: ...e operation Normaldrivingcondition Severe driving condition HYUNDAI GENUINE PARTS MTF 75W 90 API GL 4 DIAMOND ATF SP III or SK ATF SP III Dexron 2 DOT 3 or DOT 4 equivalent Ethylene glycol base for aluminium radiator J080A03GK EAT LUBRICATION CHART Item Engine Oil EngineOilConsumption Transaxle PowerSteering Brake Fluid Coolant Q ty Imp qts litre us qts Engine Oil 1 6 L 2 9 3 3 3 5 2 0L 3 39 3 85 ...

Страница 307: ...6 4 DEFROSTING DEFOGGING 1 55 DIGITAL CLOCK 1 37 DOOR LOCKS 1 2 DOOR WINDOWS 1 6 DRINK HOLDER 1 38 DRIVE BELTS 6 16 DRIVING FOR ECONOMY 2 10 JK000A2 EAT 10 INDEX A AIR BAG 1 19 AIR CONDITIONING SWITCH 1 56 AIR CONDITIONING SYSTEM MAINTENANCE 6 13 AIR CLEANER ELEMENT REPLACEMENT 6 9 AIR CONDITIONER FILTER 1 62 ANTENNA 1 67 ANTI LOCK BRAKE SYSTEM 2 8 AUTOMATIC TRANSMISSION FLUID 6 11 AUTOMATIC TRANS...

Страница 308: ... HEIGHT ADJUSTMENT 1 12 FUEL ECONOMY 2 3 FUEL GAUGE 1 29 FUEL RECOMMENDATIONS 1 1 FUSE PANEL DESCRIPTION 6 22 FUSIBLE LINKS 6 16 G GLOVE BOX 1 41 H HATCHBACK DOOR 1 46 HATCHBACK DOOR WIPER AND WASHER 1 36 HAZARD WARNING SYSTEM 1 36 HEADLIGHT BULB 6 18 HEADLIGHT AIMING ADJUSTMENT 6 18 HEADLIGHT LEVELING DEVICE SYSTEM 1 38 HEAD RESTRAINT ADJUSTMENT 1 8 HEATED REAR WINDOW 1 36 HEATING AND COOLING CON...

Страница 309: ...RANSMISSION 2 4 MAP LIGHT 1 40 MULTI FUNCTION SWITCH 1 33 MULTI GAUGE 1 33 O ODOMETER 1 31 OUTSIDE REARVIEW MIRROR HEATER 1 42 P PARKING BRAKE 1 43 POWER STEERING FLUID LEVEL 6 18 POWER STEERING HOSES 6 18 PRE TENSIONER SEAT BELT 1 18 1 19 PROTECTING YOUR HYUNDAI FROM CORROSION 4 1 R REAR FOG LIGHT SWITCH 1 44 REAR PARCEL SHELF 1 11 REAR SEAT ENTRY 1 9 REAR SEAT POSITIONS 1 9 RECOMMENDED SHIFT POI...

Страница 310: ...G SYSTEM 1 19 T TACHOMETER 1 30 THEFT ALARM SYSTEM 1 4 TOWING ATTACHMENTS 2 12 TRACTION CONTROL SYSTEM 2 9 TRAILER AND CARAVAN TOWING 2 12 TRIP COMPUTER 1 31 TRIP ODOMETER 1 31 TYRE PRESSURES 8 1 TYRE BALANCING 8 3 TYRE CHAINS 8 2 TYRE REPLACEMENT 8 3 TYRE ROTATION 8 2 V VARIABLE INTERMITTENT WIPE FACILITY 1 35 VEHICLE IDENTIFICATION NUMBER 8 1 VEHICLE TOWING OR RECOVERY 3 7 W WHEEL REPLACEMENT 8 ...

Отзывы: