Octagon PC-500 User Manual Download Page 227

Page: 227 / 233

C-2

Third party support

PC-500 user’s manual

WARNING!

Installing the DOC module into the wrong position on SSD0
of the PC-500 board will permanently damage the DOC
module.

6. Power on the PC-500.

7. Execute:

DOCPRGO /F:OCT1202.BIN /W

Note

The DOCPRGO.EXE and the OCT1202.BIN are on the DOC utility
disk.

8. Reset your system.

9. Execute:

TFORMAT 2 /BOOTSIZE:128K

Note

To access the DOC module, execute the TFORMAT command line at the
same time you execute the operating system.

10. Reset your system.

11. Access the DOC drive as drive D:.

Note

If a hard disk is installed, change Step 9 to the following command:

TFORMAT 3 /BOOTSIZE:128K

Then access the DOC drive as drive E: (Step 10).

Booting from the DOC drive

1. Add an operating system to the DOC. For ROM DOS, use the SYS

command.

2. Execute:

SETSSD SSD1 /after

3. Reset the system.

Summary of Contents for PC-500

Page 1: ...tracting zip file located at the Octagon Systems web site on the product specific page Download this file to a separate directory on your hard drive then double click on it to extract the files All references in this manual to files and directories on the CD now refer to files in the Utilities zip file ...

Page 2: ...O C T A G O N S Y S T E M S Embedded PCs For Extreme Environments PC 500 User s Manual 5170 0403 ...

Page 3: ...ions herein may change without notice The information contained in this manual is believed to be correct However Octagon assumesnoresponsibilityforanyofthecircuitsdescribedherein conveysnolicense under any patent or other right and makes no representations that the circuits are free from patent infringement Octagon makes no representation or warranty that such applicationswillbesuitablefortheusesp...

Page 4: ...ntext of the MicroPC Octagonhasdevelopedareliabledatabaseofcustomer induced field failures The average MTBF of Micro PC cards exceeds 11 years yet there are failures Most failures have been identified as customer induced but there is a small percentage that cannot be identified As expected virtually all the failures occur when bringing up the first system On subsequent systems the failure rate dro...

Page 5: ...is tances is 2 1 or greater fault conditions most likely have occurred A common cause is miswiring the power supply n Improper power causes catastrophic failure If a card has had reversepolarityorhighvoltageapplied replacingafailedcompo nent is not an adequate fix Other components probably have been partially damaged or a failure mechanism has been induced There fore a failure will probably occur ...

Page 6: ...hs on digital inputs Long leads act as an antenna to pick up noise They can also act as unterminated transmission lines When 5V is switch onto a line it creates a transient waveform Octagon has seen submicrosecond pulses of 8V or more The solution is to place a capacitor for example 0 1 µF across the switch contact This will alsoeliminateradiofrequencyandotherhighfrequencypickup Avoiding damage to...

Page 7: ...Notice to user PC 500 user s manual ...

Page 8: ... 1 5 Diagnostic software verifies system integrity automatically 1 5 SETUP information stored in EEPROM for high reliability 1 5 Phoenix BIOS 1 6 Instant DOS operating system 1 6 Programmable video BIOS 1 6 On board flash file system 1 6 Octagon BIOS extensions 1 6 Interrupt routing In system and programmable 1 6 Floppy and hard disk ports 1 6 Bootsequence 1 7 Multifunctional printer port 1 7 Watc...

Page 9: ...ptions 5 1 Descriptionofserialports 5 2 Conflicting COM port addresses 5 2 COM1 5 2 COM2 5 3 COM3 through COM5 interrupt status port 5 3 COM3 5 5 COM4 5 5 COM5 5 6 Null modem cable 5 6 Mating receptacle 5 6 Building your own cable 5 7 Function and use of serial ports 5 9 COM1 as serial console device 5 9 COM1 through COM4 as RS 232 I O 5 9 COM5 as RS 485 transmitter control 5 9 RS 485network 5 10 ...

Page 10: ...oppy disk drive 9 1 Hard disk controller 9 2 Booting with ROM DOS 9 2 Chapter 10 IRQ routing and opto IRQs 10 1 Interruptrouting 10 1 Opto IRQs 10 3 Interrupt routing matrix defaults 10 3 Programming 10 3 Masterdisable 10 4 Chapter 11 EZ I O 11 1 Description 11 1 Pulling the I O lines high or low 11 2 Organization of ports 11 2 Port addressing 11 3 Base I O address 11 3 Configuring and programming...

Page 11: ...er 17 Watchdog timer and hardware reset 17 1 Description 17 1 Enhanced INT 17h function definitions 17 1 Enablewatchdog 17 1 Strobewatchdog 17 2 Disablewatchdog 17 2 Hardwarereset 17 3 Chapter 18 Serial EEPROM and CMOS RAM 18 1 Description 18 1 Enhanced INT 17h function definitions 18 1 Serial EEPROM 18 1 Read a single word from the serial EEPROM 18 1 Write a single word to the serial EEPROM 18 2 ...

Page 12: ... 20 6 Programming the video BIOS into an SSD 20 6 Chapter 21 User defined jumper 21 1 User definedjumper 21 1 Read jumpers 21 1 Chapter 22 CPU power management 22 1 Description 22 1 Power management overview 22 1 Hardware controlled modes 22 2 Device power management 22 2 System power management 22 3 How to initiate the SUSPEND RESUME option 22 4 How to initiate the STANDBY option 22 6 Save to dis...

Page 13: ...B 6 LPT1CON COM B 7 PFORMAT EXE B 7 PGMBIOS EXE B 8 PGMIMG EXE B 9 PGMIMGH EXE B 10 PGMVIDEO EXE B 11 PHDISK EXE B 12 PICOFA SYS B 13 PMISETUP EXE B 14 REMDISK EXE B 15 REMQUIT COM B 17 REMSERV EXE B 17 RESET COM B 19 SCONSOLE EXE B 19 SETIRQ EXE B 20 SETSSD EXE B 20 SETUP COM B 22 TESTRFA EXE B 23 TRANSFER EXE B 24 VDISK SYS B 26 Appendix C Third party support C 1 Using QNX on the PC 500 C 1 Prog...

Page 14: ...gure 7 1 The PC 500 and a serial console 7 2 Figure 7 2 VTC 20F cable and null modem adapter 7 2 Figure 7 3 Changing ROM Enable flowchart 7 4 Figure 10 1 Interrupt routing matrix 10 2 Figure 11 1 Typical EZ I O configurations 11 1 Figure 11 2 Organization of ports 11 3 Figure 11 3 MPB 16PC opto rack hookup 11 9 Figure 11 4 PC 500 interfacing with an STB 26 terminal board 11 11 Figure 13 1 The PC 5...

Page 15: ...3 Custom RS 232 null modem cable for the PC 500 Second COM port 5 8 Table 5 14 RS 485 transmitter control COM5 at location 320h 5 10 Table 5 15 RS 485 termination select jumper W1 5 10 Table 5 16 RS 485 and TTL interfaces 5 10 Table 7 1 Video BIOS disabling and enabling options in SETUP C0000h C7FFFh C8000h CFFFFh ROM Enable 7 4 Table 8 1 SSD0 device selection jumpers W5 W2 7 8 8 1 Table 8 2 Selec...

Page 16: ...Table A 17 Keyboard connector J2 A 10 Table A 18 Mouse connector J3 A 10 Table A 19 Speaker connector J4 A 10 Table A 20 Flat panel connector J5 A 11 Table A 21 VGA connector J6 A 11 Table A 22 PC video connector J7 A 12 Table A 23 Battery connector J8 A 12 Table A 24 Ethernet connector J9 A 13 Table A 25 OPTOA and OPTOB J10 A 13 Table A 26 EZ I O connector J11 A 13 Table A 27 SCSI connector J12 A...

Page 17: ...xii Contents PC 500 user s manual ...

Page 18: ...ansion cards add I O functions to the Micro PC system such as analog input output digital input output motioncontrol anddisplay EZ I O This digital I O chip supplies 24 I O lines which can be individually programmed as 5V input or 5V output Flash ElectricallyerasablePROMwhichallowsatleast 100 000 write cycles h The suffix h denotes a hexadecimal number A decimal number has no prefix or suffix For ...

Page 19: ...isk A simulated disk which uses a high speed solid state SSD memory device For example flash memory EEPROM orstaticRAM StaticRAM Static Random Access Memory device Static RAMs providevolatilememorywithunlimitedreadand write cycles They may be used with a backup battery TTLcompatible Transistortransistorlogiccompatible 0 5Vlogic levels Virtualdrive A disk created in DOS or extended memory which emu...

Page 20: ...nly enter a single keyword for example reset For most commands however you will enter several keywords followed by one or more parameters for which you must supply values Commands must be entered in a specific format To indicate the format this manual uses a series of conventions that are explained below The conventionscovertherulesforissuingallcommands includingthemost complex ones Most commands ...

Page 21: ...yourparticular system or program e g Enter filename means enter the name of your file n Paired angle brackets are used to indicate a specific key on your keyboard e g ESC means the escape key CTRL means the control key F1 means the F1 function key n All addresses are given in hexadecimal for example 328h ...

Page 22: ...nd battery backup Chapter9 Externaldrives Chapter 10 IRQ routing and opto IRQs Chapter 11 EZ I O Chapter 12 LEDsignalingand beep codes Chapter 13 CRTs and flat panels Chapter 14 PC 104expansion Chapter 15 SCSI Chapter 16 Ethernet n Section 3 System management Chapter 17 Watchdogtimerandhardwarereset Chapter 18 Serial EEPROM and CMOS RAM Chapter 19 Transferringfiles remotedisks Chapter 20 Managing ...

Page 23: ...About this manual PC 500 user s manual ...

Page 24: ...ection 1 Installation Section1providesinstallationandprogramminginstructions startup options andsystemconfigurationprogramexamples Thefollowing chaptersareincluded Chapter1 Overview Chapter2 Quickstart Chapter3 SETUPprograms Chapter4 Save and run programs ...

Page 25: ...Overview of Section 1 PC 500 user s manual ...

Page 26: ... and the software is compatible with the software in theMicroPCseries Specified to your engineering needs the PC 500 can be ordered as a semi custom board in OEM quantities The stocked version of the PC 500 is listed below with the standard and optional features The standard version can be used for system development and an optional version of the PC 500 is usually application specific PC 500 majo...

Page 27: ...tion on changing the device type refer to the W5 SSD0 table in the Quickstart chapter You can also install compatible PROMs into SSD0 through the supplied utility programs found on the PC 500 utility disk You can format the flash while in the socket EPROMusage however requiresoff cardprogrammingfromeithera master flash or a master EPROM SSD0 also supports a battery back up voltage The PC 500 is ca...

Page 28: ... chip from Chips Technologies It supports CRT LCD and EL displays with resolutions to 1024 x 768 bpp Displays from CGA through SVGA are supported The 65550 is also a graphics accelerator with real time PC videobeingsupported Sincethevideocircuitryoperatesonthe localbusatthefullprocessorspeed programslikeWindowsexecute very rapidly The video section has 2 MB of video RAM for high resolu tion displa...

Page 29: ... 16 bit PC 104 expansion board PC 104 expansion boards are avail able from several manufacturers As many as three PC 104 expansion boards may be stacked on the PC 500 Ethernet The PC 500 provides a 10Base T Ethernet port located at J9 This interface is a standard feature on the PC 500 and supports the IEEE 802 3 Ethernet standard The Ethernet controller IC chip provides the following n 16 bit ISA ...

Page 30: ...viding clock n Contextual save to disk Diagnosticsoftwareverifiessystemintegrityautomatically The PC 500 has built in diagnostic software that can be used to verify on card I O and memory functions On powerup a series of tests is performed If a problem occurs the failed test can be identified by the color sequence on an on board bicolored LED The test is performed automatically every time the syst...

Page 31: ...ile system controls the on board SSDs which allows read write DOS access to the flash SRAM SSD0 can also use EPROM For certain types of flash the flash file system uses wear leveling to spread the usage and maximize the lifetime of these devices OctagonBIOSextensions On board BIOS extensions allow easy access to digital I O serial EEPROM LCDbiascontrol watchdogtimerfunctions etc Interruptrouting I...

Page 32: ...trobed under software control The time out is 1 6 seconds typical Realtimecalendar clockwithbattery backup The real time clock is fully AT compatible and uses the standard DOS calls An optional off card battery powers the real time clock when the 5 volt supply is removed A connector is provided for the external bat tery The real time clock also provides the user with 128 bytes of user definedCMOS ...

Page 33: ...generates the RS 232 voltages on board The locking power connector is a standard PC power header connector n 5V 5 1 0A to 2 0A dependent upon processor speed and I O devices less than 500 mA in standby n 12V 12V and 5V supplied to PC 104 connector and display connector notrequiredforPC 500operation n A standard PC power supply may be used See the Power supply requirementssectionintheQuickstartchap...

Page 34: ...ure 2 1 for the location of variousconnectors beforeinstallingyourPC 500system WARNING The PC 500 Mobile Industrial Computer contains static sensi tive CMOS components Do the following to avoid damaging your card and its components n n Ground yourself before handling the PC 500 card n n Disconnect power before removing or inserting a PC 104 expansionboard n n When programming a memory device place...

Page 35: ...2 2 Quick start PC 500 user s manual Figure 2 1 PC 500componentdiagram ...

Page 36: ...2 3 PC 500 user s manual Quick start Figure 2 2 PC 500center to centerholedimensions ...

Page 37: ...th the copper circuit traces Figure 2 4 PC 500 keyboard and monitor and the surface mounted components 3 The power supply connector is located at P8 P9 Make certain to con nect the ground wires typically black to all ground connectors at P8 P9 on the PC 500 Refer to Figure 2 3 WARNING Accidently crossing the wires i e plugging 5V wires into the ground connector or the ground wires into the 5V con ...

Page 38: ...in Description P9 1 N C 1 Gnd 2 5V 2 Gnd 3 12V 3 5V 4 12V 4 5V 5 Gnd 5 5V 6 Gnd 6 5V Note SeetheAccessories appendixformatinginformationonthepower connector 4 Connect the PS 2 style keyboard directly to the keyboard port at J2 and a VGA monitor to J6 using a VGA 12 cable Refer to Figure 2 4 ...

Page 39: ...PC video J17 COM5 RS 485 TTL interface J8 Battery J18 IDE hard drive J9 Ethernet P8 P9 Power J10 OPTOA OPTOB Note SeetheAccessories appendixformatinginformationontheabove connectors Table 2 3 TTL and RS 485 interface W1 Pins Description 2 4 5 6 TTL interface 1 2 3 5 4 6 RS 485 interface default Table 2 4 RS 485 termination select jumper W1 Pins Description 7 8 RS 485 terminated idle line at mark 9...

Page 40: ...e information on BIOS regions Table 2 6 EZ I O pull up pull down user option jumper W3 Pins Label Description 1 2 Pull up to 5V 2 4 Pull down to Gnd 9 10 UA User option jumper A default Table 2 7 Auxiliaryoptionjumper W4 Pins Label Description 1 2 V1 C8000 CFFFF BIOS region toggle video BIOS region 2 3 4 X D8000 DFFFF BIOS region toggle PICO FA 5 6 UB User option jumper B 7 8 VE VGA controller on ...

Page 41: ... Refer to the P8 P9 power connector Table 2 1 for a complete listingofpinoutsandtheirdescription The maximum current requirements for the PC 500 is 2 0 A provided through P8 P9 It is important that a quality power supply be used with the PC 500 For example when a particular application calls for a custompowersupply thereareseveralinternalissuestoconsidersuch as current capacity line and load regul...

Page 42: ... PICO Flash Array Copyright c 1996 Phoenix Technologies Ltd Resident Flash RFA OEM Layer Phoenix Pico Flash Array Octagon Systems vx xx First drive is in SSD1 1856K AMD 2 MB flash Starting ROM DOS HIMEM v6 22 Revision x xx Copyright c 1989 1995 Phoenix Inc VDISK v6 22 Revision x xx Copyright c 1989 1995 Datalight Inc Extended Memory Present VDISK v6 22 Revision x xx Copyright c 1989 1995 Datalight...

Page 43: ...4 Directory of C COMMAND COM 26 321 04 12 96 6 22p AUTOEXEC BAT 38 04 12 96 8 26p CONFIG SYS 67 04 12 96 8 26p DOS DIR 04 12 96 8 26p UTILS DIR 04 12 96 8 26p DEMO EXE EXE 27 922 04 12 96 8 26p DEMO BAS 5 045 04 12 96 8 26p 7 file s 26 426 bytes 105 472 bytes free What s next 1 To run SETUP and configure the system see the SETUPprograms chapter 2 To connect a floppy and or hard drive see the Exter...

Page 44: ...P can be entered in one of two ways n RunSETUP COM n Press the backspace key followed by the S key during BIOS POST sequence this occurs between the memory test and boot Also by removing the USESETUP jumper from W2 9 10 you may force the setup to temporarily revert to the BIOS defaults Table 3 1 and also allow the user to reconfigure the setup options The SETUP program defines the PC 500 system pa...

Page 45: ...vice C Only Serial port COM1 Specifies COM1 enable disable Enabled Serial port COM1 address COM1 address 3F8h Serial port COM2 Specifies COM2 enable disable Enabled Serial port COM2 address COM2 address 2F8h Parallel LPT port Specifies LPT port enable disable Enabled Parallel port mode Specifies mode to use with parallel port Bidirectional printer port Parallel port address Specifies address to us...

Page 46: ...ecifies backspace S hotkey enable disable Enabled Power management Specifies power management enable disable Enabled Doze clock Specifies doze mode in power management to slow or stop the clock Slow Time update after suspend To allow update of time after suspend mode Enabled DIMM module type Specifies the type of DIMM module EDO ROM Enable C0000 C7FFFh Toggles video BIOS region first 32 KB Enabled...

Page 47: ...up parameters and available options Select the option by pressing the space bar until the correct information appears then press ENTER Press ESC twice if you want to exit SETUP without saving your responses Note Options having an are default settings n Serial Console on COM1 ENABLED DISABLED WARNING Disabling the serial console when there is no video monitor present will stop further serial consol...

Page 48: ... 3E8h 2E8h 220h 238h 2E0h 228h n Serial Port COM2 Enabled Disabled n Serial Port COM2 address 2F8h 338h 3E8h 2E8h 220h 238h 2E8h 2E0h 228h Note Octagon strongly recommends the use of 3F8h for COM1 and 2F8h for COM2 Note The choices for COM1 and COM2 addresses are mutually exclusive therefore you may not see all the choices listed above COM1 and COM2 addresses may also conflict with those belonging...

Page 49: ...rovided for equip ment that has the capability to operate in these modes for enhanced performance n Number of floppy drives 0 1 2 n Onboard floppy controller Enabled enables onboard floppy connector J15 Disabled n Drives A and B No requires a swap in the cable Yes does not require a swap in the cable n Floppy drive 1 size Not Installed 5 25 360 KB 5 25 1 2 MB 3 5 720 KB 3 5 1 44 MB n Floppy drive ...

Page 50: ... xx Sectors xx n Internal CPU cache Enabled Disabled n Limit CPU to half speed NO YES n Setup entry via hotkey Enabled Disabled n Power management Enabled Disabled n Doze clock Slow Stop n Time update after suspend Enabled Disabled n DIMM module type EDO Standard n Shadow C0000h C7FFFh Disabled Enabled n Shadow C8000h CFFFFh Disabled Enabled n Shadow D0000h D7FFFh Disabled Enabled ...

Page 51: ...T ESC to EXIT Serial Console on COM1 ENABLED COM1 Console Baud Rate 9600 Power on memory test DISABLED Boot Sequence C ONLY Serial Port COM1 ENABLED Serial Port COM1 Address 3F8h default Serial Port COM2 ENABLED Serial Port COM2 Address 2F8h default Parallel LPT Port ENABLED Parallel Port Mode Bidirectional Printer Port Parallel Port Address 378h Number of floppy drives 1 Onboard Floppy Controller...

Page 52: ...ons to take effect PC500 C Note Executing SETUP D will change all setup parameters to default values SETSSD For more information on SETSSD refer to the Defining SSDs using SETSSD section in the ManagingSSDschapter PMISETUP PMISETUP allows the user to customize the power management fea tures of the PC 500 Refer to the CPU power management chapter See alsotheSoftwareutilitiesappendixfordetails SETIR...

Page 53: ...3 10 SETUP programs PC 500 user s manual ...

Page 54: ...meMicrosoftprogramsmakeundocumentedDOS calls With ROM DOS an error returns when an undocumented DOS call is made causing your program to operate erratically We recom mend booting from SSD1 using your own DOS when using programs with undocumented DOS calls Refer to the section Addingoperating system startup files intheManagingSSDschapterformoreinformation on saving and autoexecuting programs Saving...

Page 55: ...cation add your application name to the AUTOEXEC BATfile Toreplaceourexampleprogram DEMO EXE withyourapplication substituteDEMOintheAUTOEXEC BATfile withyourapplications filename Autoexecutingyourapplication Thissectiondescribeshowtoautoexecuteyourapplication 1 To autoexecute your application in SSD1 use the SETSSD command to define your SSD as the boot device Since you need to define the order of...

Page 56: ...al keyboard For more information see your ROM DOS manual Option 2 1 Change AUTOEXEC BAT and or CONFIG SYS to notcall out your program Option 3 1 Install a floppy 2 Change SETUP option Boot Sequence to A THEN C 3 Change SETUP to enable the floppy 4 Bootfromfloppy 5 ChangeAUTOEXEC BATonC ...

Page 57: ...4 4 Save and run programs PC 500 user s manual ...

Page 58: ...features The following chapters are included Chapter5 Serialports Chapter6 LPT1parallelport Chapter7 Consoledevices Chapter8 SSDs DRAM and battery backup Chapter9 Externaldrives Chapter 10 IRQ routing and opto IRQs Chapter 11 EZ I O Chapter 12 LEDsignalingand beep codes Chapter 13 CRTs and flat panels Chapter 14 PC 104expansion Chapter 15 SCSI Chapter 16 Ethernet ...

Page 59: ...Overview of Section 2 PC 500 user s manual ...

Page 60: ...rs which have the standard IBM PC pinout n Up to 115 2k Baud operation Serial port options The standard version of the PC 500 has COM1 and COM2 installed as an 8 wire interface Under OEM contract you can order all five serial ports in various configurations tailored to your application Table 5 1 lists the standard and optional configurations for COM1 through COM5 Table 5 1 COMportoptions COM ports...

Page 61: ...M1 COM1 is either a full 8 wire RS 232 standard or an industrial 4 wire RS 232 optional configuration The default I O address for COM1 is 3F8h but can be changed in SETUP to any of the addresses in Table 5 3 Refer to the SETUP programs chapter for more information on running SETUP IRQ4 is dedicated to COM1 and if COM1 is not used under interrupt control IRQ4 may be used by other resources For exam...

Page 62: ...ed to COM2 If COM2 is not used under interrupt control IRQ3 may be used by other resources such as the PC 104 expansion board the GPS module IRQ routing etc Refer to the IRQ routing and opto IRQs chapter for details COM1 and COM2 share the J13 20 pin header Table 5 4 COM2availableaddresses IRQ3dedicated COM2 available addresses 220h 2F8h 228h 338h 238h 3E8h 2E0h 3F8h 2E8h default Note See the Acce...

Page 63: ... port addresses 0 0 140 147h 150 157h 158 15Fh 0 1 120 127h 130 137h 138 13Fh 1 0 340 347h 350 357h 358 35Fh 1 1 320 327h 330 337h 338 33Fh default For example if bits 5 and 4 are both 0 the interrupt status port ad dresses are 158 15Fh If bit 5 is 0 and bit 4 is 1 the interrupt status port addresses are 138 13Fh if bit 5 is 1 and bit 4 is 0 the interrupt status port addresses are 358 35Fh and if ...

Page 64: ... address for COM3 is 3E8h The interrupt for COM3 IRQ15 is logically OR d with COM4 and COM5 Interrupt routing for COM3 is configured through the interrupt routing matrix COM3 and COM4 share the J14 20 pin header For more information seethe COM3 through COM5 interrupt statusportsectioninthischapter Table 5 8 COM3 available address and IRQ routing Address IRQ 3E8h IRQ15 default routable COM4 COM4 ca...

Page 65: ...5 is located at J17 For more information seethe COM3 through COM5 interrupt status portsectioninthischapter Table 5 10 AvailableaddressesforCOM5 IRQ5default routable Address IRQ 320h IRQ15 default routable Table 5 11 COM5 J17 RS 485 or TTL interface For RS 485 interface For TTL interface Pin 1 RS 485 Pin 1 TTL RD Pin 2 TxD Pin 2 TxD Pin 3 Gnd Pin 3 Gnd Pin 4 RS 485 Pin 4 NA W1 1 2 3 5 4 6 W1 2 4 5...

Page 66: ...COM port connector of the PC 500 are tied to gether Pins 7 and 8 are tied together on each DB 9 cable connector Pins 4 and 5 are tied together on each DB 25 cable connector Refer to the following table and diagram for a complete listing of all cable con nections for the PC 500 Table 5 12 Custom RS 232 null modem cable for the PC 500 First COM port PC 500 COM1 COM2 or COM3 COM4 PC 500 serial port s...

Page 67: ... PC 500 COM1 COM2 or COM3 COM4 PC 500 serial port signal DB 9 pin DB 25 pin PC port signal 11 DCD 7 8 4 5 RTS CTS 12 DSR 4 20 DTR 13 RxD 3 2 TxD 14 16 RTS CTS 1 8 DCD 15 TxD 2 3 RxD 17 DTR 6 6 DSR 18 RI NC NC RI 19 Gnd 5 7 Gnd 20 5V Safe NC NC pins tied together Figure 5 2 Custom null modem cable for the PC 500 ...

Page 68: ...32 serial ports Depend ing upon the design of each port COM1 through COM4 can support 4 or 8 wire configurations Use a VTC 20F cable to interface from the PC 500 to the serial device Figure 5 3 PC 500serialdevices COM5asRS 485transmittercontrol COM5 can either have a 2 wire RS 485 or a 2 wire TTL interface The default configuration is for an RS 485 port To change the default configuration from RS ...

Page 69: ... 9 10 RS 485 terminated idle line at mark 7 9 RS 485 terminated idle line at space 8 10 RS 485 terminated idle line at space default Note For no termination remove jumpers from pins 7 8 9 and 10 Table 5 16 RS 485 and TTL interfaces For RS 485 interface For TTL interface Pin 1 RS 485 Pin 1 TTL RD Pin 2 TxD Pin 2 TxD Pin 3 Gnd Pin 3 Gnd Pin 4 RS 485 Pin 4 NA W1 1 2 3 5 4 6 W1 2 4 5 6 default RS 485 ...

Page 70: ...l ports They can only respond to messages that are addressed to them from the host Thefollowingdiagramdemonstrateshowatypicaltwo wiretransmis sion is implemented in the RS 485 network Figure 5 4 RS 485two wire halfduplex transmission ...

Page 71: ...5 12 Serial ports PC 500 user s manual ...

Page 72: ...supports a number of devices including a PC compatible printer a multiline display a matrix keypad or an opto rack with opto isolateddigitalI Omodules Note Make sure that the interrupt used for COM3 through COM5 does not conflict with the IRQ selected for the LPT in SETUP Printer Note See the Accessories appendixformatinginformationontheLPT1 printerportconnector Installingaprinter 1 Make sure that...

Page 73: ...either the 14 pin or 16 pin header on the 2010 The size of the display will determine which header to use 3 RefertothefileDISPLAY DOCformoreinformationoninitializingand usingthedisplay Keypad LPT1 also supports 4 x 4 matrix keypads To interface the keypad to the PC 500 use the Octagon 2010 interface board A CMA 26 cable is required to connect the interface board to the PC 500 The program DISPLAY E...

Page 74: ...ectlytotheparallel printerportandcancontrolhighvoltage highcurrentG4opto isolated modules Of the sixteen positions available eight can be either input or output four are dedicated as inputs and the other four are dedicated as outputs Refer to the MPB 16PC opto module rack product sheetfor moreinformation Figure 6 3 LPT1 and an opto rack ...

Page 75: ...6 4 LPT1 parallel port PC 500 user s manual ...

Page 76: ... serial cable null modem adapter plugged into a host PC running SmartLINK provides both input and output The local keyboard also allows input n No console device means no video output either from the SVGA moni tor or the serial console The local keyboard allows input LocalbusSVGA For correct usage of the CRT and flat panel see the CRTs and flat panels chapter Serial console If the serial console i...

Page 77: ... a 25 pin serial connector attach a 9 to 25 pin adapter to the 9 pin null modem adapter and then insert the matching end of the 9 to 25 pin adapter into the serial port 6 Start PC SmartLINK 7 Remove W2 1 2 and W3 1 2 to disable the video BIOS Note For more information on enabling and disabling the video BIOS refer to thefollowingsectioninthischapter 8 Power on the PC 500 Figure 7 2 VTC 20F cable a...

Page 78: ...nsole device to use If a console device exists the BIOS will use the console device the CRT or the flat panel When the console device does not exist the BIOS will otherwise use a serial console if it has not been disabled in SETUP To enable disable the video BIOS area either change W2 1 2 W4 1 2 or run SETUP and change C0000h C7FFFh or C8000h CFFFFh ROM enable options The jumpers work as a toggle ...

Page 79: ...Disabled On Enabled Change SETUP to enabled or remove W2 1 2 V0 W4 1 2 V1 Disabled Off Enabled Change SETUP to enabled or install W2 1 2 V0 W4 1 2 V1 Enabled On Disabled Change SETUP to disabled or remove W2 1 2 V0 W4 1 2 V1 Enabled Off Disabled Change SETUP to disabled or install W2 1 2 V0 W4 1 2 V1 Note Octagon strongly recommends that you configure both the ROM Enable SETUP option and the jumpe...

Page 80: ...ESETUP W2 9 10 2 Install W2 1 2 W4 1 2 3 Rebootthesystem If Step A does not work then follow Step B Step B 1 Make sure the BIOS jumper W2 5 6 is on To use the BIOS in SSD1 install W2 5 6 To use the BIOS in SSD0 remove W2 5 6 2 Rebootthesystem If Step B does not work then follow Step C Step C 1 RemoveW2 1 2 W4 1 2 2 Attach a serial cable to COM1 3 Run PC SmartLINK at 9600 baud 4 Bootthesystem 5 Pro...

Page 81: ...7 6 Console devices PC 500 user s manual ...

Page 82: ...device may be installed on the PC 500 Jumper blocks W2 7 8 and W5 must be set appropriately See Table 8 1 forsettings SelectingSSD0devicetype Table 8 1 SSD0 device selection jumpers W5 W2 7 8 Pins Description W5 1 3 2 4 5 7 8 10 W2 7 8 SRAM with battery backup W5 1 2 3 4 5 6 9 10 W2 7 8 Flash W5 1 2 3 4 5 6 9 10 EPROM default pins jumpered W2 7 8 is not jumpered SSD0 replaced with an SRAM device B...

Page 83: ...tain to properly align pin 1 of either the SRAM flash or EPROM device with pin 1 of SSD0 on the PC 500 SSD0 replaced with a flash device Before replacing SSD0 with a flash device do the following steps 1 Power off the PC 500 and then make sure W2 5 6 is jumpered in order to boot from the BIOS on SSD1 2 Since SSD0 is to be replaced with an unprogrammed device the PC 500 must be configured to boot f...

Page 84: ...ur applicationprograms Thesedevicesareerasedautomaticallyduring theprogrammingprocess SSD1 can be accessed directly as a read write DOS drive with the PICO FA driver Also it can be accessed directly as a read write DOS drive when the PICOFA SYS driver is loaded While this is convenient for product development the flash however has a limited number of writes allowed Therefore Octagon does not recom...

Page 85: ...y backup configu ration The SSD0 requires an AT battery for battery backup of the SRAMfiles An AT battery also backs up the CMOS real time clock Table 8 3 SSD0 device configuration W5 W2 7 8 Pins Description W5 1 3 2 4 5 7 8 10 W2 7 8 SRAM with battery backup W5 1 2 3 4 5 6 9 10 W2 7 8 Flash W5 1 2 3 4 5 6 9 10 EPROM default pins jumpered W2 7 8 is not jumpered InstallinganATbattery 1 Power off th...

Page 86: ...ve to your system you must use a floppydrivecablewhichhastwoconnectors Powerrequirements The PC 500 requires 5V for operation You must also supply power to the floppy drive s through an external source Refer to your floppy drivemanualforspecificinstructions Installingafloppydiskdrive 1 DisconnectpowertothePC 500 2 Insert one end of your cable into the rear of the floppy drive Make sure pin 1 on th...

Page 87: ...the IDE cable into J18 on the PC 500 Make sure pin 1 on the cable is connected to pin 1 on the PC 500 4 Execute the BIOS SETUP program to configure your system for a hard drive You can execute this program either by pressing BACK SPACE S during system bootup or by executing the file SETUP EXE This file is found on the PC 500 BIOS drive and the PC 500 utility disk The system steps you through the c...

Page 88: ... program to update the routing matrix withthedesiredIRQroutes In addition to IRQ routing the I O range select A and select B bits can be set so that the base addresses in COM5 EZ I O and COM3 through COM5 IRQ status registers can be moved to different locations These can also be read at I O address 0A9h bits 4 and 5 See also the SETIRQ DOC file in the IRQ directory on the PC 500 utility disk for m...

Page 89: ...10 2 IRQ routing and opto IRQs PC 500 user s manual Figure 10 1 Interruptroutingmatrix ...

Page 90: ...until the interrupt is acknowledged At that time the interrupt source can be rearmed by returning the input to 0 volts Note See the Accessories appendixformatinginformationontheOPTOAand OPTOBconnectors Theinterruptroutingmatrixprovidesflexibilitytotheinterruptstruc turewhichallowsconnectionbetweenthelower orderedISAinterrupts and the unused higher ordered interrupts Caution must be used when confi...

Page 91: ...ormation The IORG SEL A I O register select A and IORG SEL B I O register select B select the base address for COM5 as well as for the EZ I O and theinterruptstatusregister Table 10 1 Interrupt status port ISP map setting at I O location 0A9h I O range select A bit 5 B bit 4 COM5 addresses EZ I O addresses Interrupt status port addresses 0 0 140 147h 150 157h 158 15Fh 0 1 120 127h 130 137h 138 13F...

Page 92: ...The EZ I O drives the OctagonMPBseriesopto isolationmoduleracksdirectly controllingAC and DC loads to 240V at 3A Figure 11 1 shows typical EZ I O configura tions The EZ I O port at J11 has the following features n The EZ I O chip has 24 I O lines grouped into 3 ports of 8 bits n Each bit is programmable as either 5V input or 5V output n Read back state of each pin n Easy to program n Sink and sour...

Page 93: ... block W3 pulls the I O lines at ports A B and C high or low This allows a known state upon powerup The default configuration pulls all of the I O lines high Note that 10K ohm resistor networks are used to configure the I O lines as high or low Table 11 2 EZ I O pull up pull down jumpers W3 Pins Label Description 1 2 Pull up to 5V 2 4 Pull down to Gnd 9 10 UA User option jumper A default Organizat...

Page 94: ...er Base address 3 BaseI Oaddress The base I O address for the EZ I O port is 330h default This address can be changed through OctaGlue PCS_2 to one of four addresses Refer to the section Interrupt routing in the IRQ routing and opto IRQs chapter to change the base address of the EZ I O chip Based on the I O range select A and B you can determine the port addresses for the EZ I O port by reading 0A...

Page 95: ...ol register of the EZ I O port When a line is configured as an output it can sink a maximum of 15 mA at 0 4V or can source 15 mA at 2 4V On powerup and software or hardware reset all digital I O lines at J11 reset as inputs ProgrammingtheEZI O Follow these steps to program the EZ I O chip 1 Configure the EZ I O port bit directions either as inputs or outputs 2 Write to port A B or C with the desir...

Page 96: ...hipbackinto operation mode OUT 333h 3 control register Writing and reading from EZ I O Writing to or reading from the desired EZ I O port is accomplished with singleprogramstatements 1 To write a bit pattern to the desired EZ I O port OUT 332h FFh All bits of port C go high all input bits are unaffected 2 To read a bit pattern from the desired EZ I O port PORTC INP 332h The byte read from port C i...

Page 97: ...To configure ports A and C as inputs and port B as outputs issue the follow ingcommands OUT 333h 2 Direction Mode OUT 330h 0 OUT 331h FF OUT 332h 0 OUT 333h 3 Operation Mode To read ports A and C issue the following commands PORTA INP 330h port A PORTC INP 333h port B Enhanced INT 17h function definitions Thissectionprovidesdefinitionsforthefollowingfunctions Initialize EZ I O Write EZ I O and Rea...

Page 98: ...mmingexample Inline assembly code for Borland C 3 1 asm mov ax 0ef00h mov di 00ffh port A all outputs init data all 0 s mov bx 55ffh port B all outputs init data 55h mov cx 0000h port C all inputs mov dx 0ffffh int 17h Write EZ I O Function efh Subfunction 01h Purpose To write a value of an EZ I O port Callingregisters AH efh AL 01h DI Port A mask and data xxxxxxxx xxxxxxxxB xxxxxxxx MaskforportA ...

Page 99: ...t C bit 1 1 other bits unchanged mov dx 0ffffh int 17h Read EZ I O Function efh Subfunction 02h Purpose To read from an EZ I O port Callingregisters AH efh AL 01h xxxxxxxx Data for port C DX ffffh Returnregisters Carryflagclearedifsuccessful AL Port A data AH Port B data BL Port C data Carry flag set if error AL Errorcode Comments This function is used to read from the EZ I O before nor mal use Pr...

Page 100: ... rack Refer to the MPB opto racksdatasheetformoreinformation You can also use a CMA 26 cable to connect the EZ I O port to an STB 26 terminal board and then to the opto rack The STB 26 has two 26 pin connectors one of which would connect to the EZ I O port the other would connect to the opto rack Refer to the following opto rack diagrams For either configuration run a separate power line to 5V and...

Page 101: ... port Connector pin Opto module position Port C 0 bit 0 13 1 bit 1 16 2 bit 2 15 3 MPB 08 bit 3 17 4 bit 4 14 5 bit 5 11 6 bit 6 12 7 bit 7 9 Opto module position Port A 8 bit 0 19 9 bit 1 21 10 bit 2 23 11 MPB 16 bit 3 25 12 bit 4 24 13 bit 5 22 14 bit 6 20 15 bit 7 18 Opto module position Port B 16 bit 0 10 17 bit 1 8 18 bit 2 4 19 MPB 24 bit 3 6 20 bit 4 1 21 bit 5 3 22 bit 6 5 23 bit 7 7 5V 2 ...

Page 102: ...g switches or other digital I O devices to the EZ I O digital port I O lines at the EZ I O connector can be connected to an STB 26 with a CMA 26 cable Parallel I O devices are then connected to the screw terminals on the STB 26 Refer to the STB 26 productsheet for more information Figure 11 4 PC 500 interfacing with an STB 26 terminal board ...

Page 103: ...11 12 EZ I O PC 500 user s manual ...

Page 104: ...table Also if a speaker is installed at J4 the beep codes are audible The bicolor LED also indicates memory suspend status Upon entering memory suspension the green LED turns off and the amber LED turns on On a resume condition the amber LED turns off and the green LED turnson When the system enters the cool down clocking state the green LED and the amber LED turn on When the system exits the cool...

Page 105: ...M chip or data line failure bit 2 13h 2 1 4 1st 64K RAM chip or data line failure bit 3 14h 2 2 1 1st 64K RAM chip or data line failure bit 4 15h 2 2 2 1st 64K RAM chip or data line failure bit 5 16h 2 2 3 1st 64K RAM chip or data line failure bit 6 17h 2 2 4 1st 64K RAM chip or data line failure bit 7 18h 2 3 1 1st 64K RAM chip or data line failure bit 8 19h 2 3 2 1st 64K RAM chip or data line fa...

Page 106: ... 4 2 1 Timer tick interrupt test in progress or failure 35h 4 2 2 Shutdown test in progress or failure 36h 4 2 3 Gate A20 failure 37h 4 2 4 Unexpected interrupt in protected mode 38h 4 3 1 RAM test in progress or failure above address 0FFFFh 3Ah 4 3 3 Interval timer channel 2 test in progress or failure 3Bh 4 3 4 Time of day clock test in progress or failure 3Ch 4 4 1 Serial port test in progress ...

Page 107: ...ialization D7h N A Using defaults from ROM D9h N A Using EEPROM values DFh N A Exit CMOS initialization E0h N A Reset E1h N A BIOS determined it is an actual reset E7h N A Going to CMOS initialization E8h N A Returned from CMOS initialization E9h N A Entry to chipset initialization EAh N A Exit from chipset initialization F0h N A Loading chipset from EEPROM or defaults F1h N A Completed chipset lo...

Page 108: ...d on the PC 500 n HighperformanceChips TechnologiesVGA65550videocontroller n 2 MB DRAM for display buffering n CRT support with resolutions to 1024 x 768 at 75 MHz n Flatpanelsupportwithresolutionsthefollowingresolutions 640 x 480 x 24 bpp 800 x 600 x 24 bpp 1024 x 768 x 16 bpp n Support for plasma EL and LCD displays 3V and 5V flat panel support jumper selectable Flatpanelpowersequencing Software...

Page 109: ...e two BIOSes refer to the VideoBIOS reprogrammingsectionintheSCSIchapter The PC 500 is factory configured and programmed for a VGA analog monitor If you wish to use a monitor other than the default or a flat panel display you must reprogram the video BIOS for the appropriate display To reprogram your video BIOS see the README DOC on your 65550 utility disk If you are using the default monitor and ...

Page 110: ...utility disk for a list of the supported displays If your particulardisplayisnotcurrentlylisted pleasecontactOctagonTechni cal Support 303 426 4521 for assistance 5 If you are using a SCSI hard drive combine the video BIOS To do this use the copy command COPY B drive S64P80 DAT SCSI DAT VID SCSI DAT Then use VID SCSI DAT in step 6 6 To program the PC 500 for the appropriate monitor display type th...

Page 111: ...nd or a flat panel display The CT COM and FP COM programs allow you to toggle between the moni tor and the flat panel If the flat panel supports simultaneous mode the SM COM program will allow you to display images from both the monitor and the flat panel at the same time These programs are on the VGA 65550 utility disk in the UTILS subdirectory along with other diagnostic and configurationutiliti...

Page 112: ...ion is 18 in WARNING Before connecting your flat panel to the PC 500 check your flat panel for bias voltage requirements By default the PC 500 comes with a bias voltage range of 21 to 29V 1 Refer to the text file associated with your flat panel to determine the supplyvoltage 2 Connect an adapter cable from the flat panel to the flat panel connector located at J5 on your PC 500 3 Refer to the diagr...

Page 113: ...il you obtain a good contrast display with no washout To confirm the LCD bias voltage place a voltmeter on ground at J5 pin 6 and also on positive at J5 pin 3 5 The VEESAFE voltage may require additional adjustments in order to obtain the proper contrast Use LCDBIASDW or LCDBIASUP to obtain thepropercontrast WARNING Since improper voltage levels can severely damage the flat panel make sure the PC ...

Page 114: ...g diagrams specific to your flat panel to determine the correct jumper settings All wiring diagrams are found in the txt files on the 65550 utility disk Flatpanelinterfacevoltageselect W8 The PC 500 supports flat panel interface at either 5V or 3 3V W8 1 2 enables flat panel interface at 5V default W8 3 4 enables flat panel interface at 3 3V Table 13 2 Flat panel interface voltage select W8 Pins D...

Page 115: ...13 8 CRTs and flat panels PC 500 user s manual Table 13 3 Inverted shift clock signal voltage level select W9 Pins Description 1 2 3 3V 3 4 5V default pins jumpered ...

Page 116: ...C 500 supports 8 and 16 bit and provides 12V from the power supply at P8 P9 These modules can be stacked on top of the PC 500 to form a highly integrated control system Figure 14 1 Typical PC 104 module stack WARNING When installing any PC 104 module avoid excessively flexing the PC 500 board Mate pins correctly and use the required mounting hardware Note See the Accessories appendixformatinginfor...

Page 117: ...14 2 PC 104 expansion PC 500 user s manual ...

Page 118: ...otincluded optional Note See the Accessories appendixformatinginformationontheSCSI connector Reprogramming the video BIOS When you use a SCSI hard drive the SCSI DAT extended BIOS must be combined with the video BIOS before you begin programming Follow the steps outlined in the Programming the video BIOS section in the CRTs and flat panels chapter Refer also to the README DOC on the SCSI utility d...

Page 119: ...15 2 SCSI PC 500 user s manual ...

Page 120: ...ses twisted pair wiring cable which is built in a star configuration The 10Base T physical interfaceterminatesatthestandard 8 position RJ 45latchingphone jack which can be vertically accessed For more information on programming the Ethernet port see the README DOC on the Ethernet utility disk By default the Ethernet port connects to IRQ10 but can be reconfigured via the SETIRQ DOC program found on...

Page 121: ...16 2 Ethernet PC 500 user s manual ...

Page 122: ... in the areas of internalcontrol CPUpowermanagement andtroubleshooting The followingchaptersareincluded Chapter 17 Watchdogtimerandhardwarereset Chapter 18 Serial EEPROM and CMOS RAM Chapter 19 Transferringfiles remotedisks Chapter 20 Managing SSDs Chapter 21 User definedjumper Chapter 22 CPUpowermanagement Chapter 23 Troubleshooting ...

Page 123: ...Overview of Section 3 PC 500 user s manual ...

Page 124: ...ion on the PC 500 Enhanced INT 17h function definitions Thissectionprovidesdefinitionsforthefollowingfunctions Enable watchdog Strobewatchdog andDisablewatchdog Enablewatchdog Function fdh Subfunction 01h Purpose To enable the watchdog Callingregisters AH fdh AL 01h DX ffffh Returnregisters None Comments This function enables the watchdog Once the watchdog is enabled it has to be strobed at a peri...

Page 125: ...grammingexample Inline assembly code for Borland C 3 1 asm mov ax 0fd02h mov dx 0ffffh int 17h The watchdog timer can also be strobed by reading address 20Ch This may be faster than strobing the watchdog timer with an interrupts functioncall forexample A INP 20Ch Disablewatchdog Function fdh Subfunction 03h Purpose Todisablethewatchdog Callingregisters AH fdh AL 03h DX ffffh Returnregisters None C...

Page 126: ... RESET command also accom plishes the same thing as the reset button It is also possible to issue a hardwareresetthroughtheopto isolatedinputs eitherOPTOAor OPTOB channels at J10 See the IRQ routing and opto IRQs chapter for more information on opto channels Refer to the component diagram in the Quickstart chapter for the location of the reset button WARNING When using COM1 as the console the CTRL...

Page 127: ...17 4 Watchdog timer and hardware reset PC 500 user s manual ...

Page 128: ...back to serial EEPROM Enhanced INT 17h function definitions ThissectionprovidesdefinitionsforbothserialEEPROMandCMOS RAMfunctions TheserialEEPROMdefinitionsincludethefollowing functions Read a single word from serial EEPROM Write a single word toserialEEPROM ReadmultiplewordsfromserialEEPROM Write multiplewordstoserialEEPROM andReturnserialEEPROMsize TheCMOSRAMdefinitionsincludethefollowingfunctio...

Page 129: ...d C 3 1 asm mov ax 0fc00h mov bx 02h Read word 2 mov dx 0ffffh int 17h mov seeData ax store data in c environment Write a single word to the serial EEPROM Function fch Subfunction 01h Purpose To write a single word to the on board serial EEPROM Callingregisters AH fch AL 01h BX Wordaddress zerobased CX Datawordtowrite DX ffffh relative to user area Returnregisters Carryflagclearedifsuccessful Carr...

Page 130: ...daddress zerobased CX Wordcount DX ffffh relative to user area ES DI Destinationpointer Returnregisters Carryflagclearedifsuccessful AX Wordread Carry flag set if error AL Errorcode Error Code Meaning ffh Unknownerror 01h Functionnotimplemented 02h DefectiveserialEEPROM 03h Illegalaccess Comments Thisfunctionreadsmultiplewordsfromtheuser area of the serial EEPROM Programmingexample Read 10 words s...

Page 131: ... Functionnotimplemented 02h DefectiveserialEEPROM 03h Illegalaccess Comments This function writes multiple words to the user area oftheserialEEPROM Programmingexample Write 8 words starting at word 6 unsigned int far seeDataPtr new unsigned int 8 Allocate storage unsigned int far tmpPtr seeDataPtr for int i 0 i 8 i seeDataPtr i initialize data Inline assembly code for Borland C 3 1 asm push ds mov...

Page 132: ...s of the serial EEPROM Since the user cannot access all of the serialEEPROM thisfunctiondetermineshowmuch space is available to the user This avoids the user fromaccessingunavailableaddresses Programmingexample unsigned int seeUserSize Inline assembly code for Borland C 3 1 asm mov ax 0fc04h mov dx 0ffffh int 17h mov seeUserSize bx CMOS RAM ReadextendedCMOSRAM Function fbh Subfunction 06h Purpose ...

Page 133: ...yteSave WriteextendedCMOSRAM Function fbh Subfunction 07h Purpose To write a single byte to extended CMOS RAM area Callingregisters AH fbh AL 07h BL CMOS index 0 127 BH CMOS data DX ffffh Returnregisters Carryflagclearedifsuccessful Carry flag set if error AL Errorcode ErrorCode Meaning ffh Unknownerror 01h Functionnotimplemented 02h DefectiveserialEEPROM 03h Illegalaccess Comments This function w...

Page 134: ...s ThisfunctionreportstheconditionoftheCMOS battery This is useful to determine if extended CMOS data contents should be relied upon or refreshed from EEPROM Programmingexample Reports the condition of the CMOS battery unsigned int cmosflag Inline assembly code for Borland C 3 1 asm mov ax 0fb08h mov dx 0ffffh int 17h mov cmosflag al printf The CMOS byte 0E at powerup time 02x n cmosflag Copyconten...

Page 135: ... 17h CopycontentsofextendedCMOSRAMtoserialEEPROM Function fbh Subfunction 0Ah Purpose TocopycontentsofthecurrentextendedCMOS RAM data to the serial EEPROM Callingregisters AH fbh AL 0Ah DX ffffh Returnregisters Carryflagclearedifsuccessful Carry flag set if error AL Errorcode ErrorCode Meaning ffh Unknownerror 01h Functionnotimplemented 02h DefectiveserialEEPROM 03h Illegalaccess Comments Thisfunc...

Page 136: ...EXE and REMSERV EXE are located on the PC 500 BIOS drive and the PC 500 utility disk Once these pro grams are executed single or multiple files can then be transferred to and from the PC 500 using DOS COPY or XCOPY commands TRANSFER EXE REMDISK EXEandREMSERV EXEarelocatedon the PC 500 BIOS drive in the DOS directory and on the PC 500 utility disk in the DOS directory Refer to the Softwareutilities...

Page 137: ... R characters upon receiving a block and T upon transfer ring a block Do not use V when using a serial console 3 Execute the TRANSFER program from your PC to send a file to the PC 500 S specifies send to file TRANSFER COM1 S V drive path filename ext filename ext is the name of the file on the PC which you are sending to the PC 500 Note An alternate method of transferring a file is to press ALT D ...

Page 138: ...C 500 COM1 R V Receive in verbose mode Note Transfer will time out if the program has not been started after approxi mately 40 seconds It displays the following message Failed to receive drive filename ext Deleting drive filename ext Also you may speed up the transfer using the Bnnnn switch to increase the baud rate Example B57600 Downloading files to the PC 500 using PC SmartLINK Thefollowinginfo...

Page 139: ...ring PC500 C TRANSFER DEMO EXE The following message is displayed from the PC 500 Receiving DEMO EXE 4 Execute the following steps using PC SmartLINK n Press ALT D toenterthedownloadscreen n Type in the name of the file to transfer e g C MPC DEMO DEMO EXE n To begin the transfer either press ENTER defaultdownloadSTART tab to START click on the STARTbutton in the download screen n When the file tra...

Page 140: ...file s 27264 bytes 7 To execute the program you have just downloaded type PC500 C DEMO The DEMO program displays a message on your PC Remote disks DownloadingfilestothePC 500usingREMDISK REMSERV ThefollowingrepresentsamethodofusingREMDISK REMSERVwith PC 500 with one serial cable Refer to the Softwareutilitiesappendixforspecificinformationonusing REMDISK EXEandREMSERV EXE PC 500 with one serial cab...

Page 141: ...right c 1990 1994 Datalight Inc All rights reserved Installed as Drive F COM1 B115 T3 Note REMDISK assigns the remote drive as the last drive in the system In this case drive F was assigned 3 ExecuteREMSERV EXEonthedesktopPC C REMSERV C The following message is displayed on the PC REMSERV v1 0 Copyright c 1990 1994 Datalight Inc All rights reserved Using COM1 at 115K baud Accessing Drive C Time ou...

Page 142: ... C COPY F MPC PC500 DEMO EXE PC500 C DIR PC500 C DEMO EXE The DEMO program displays a message on the PC 500 monitor 5 When finished on the PC 500 system execute PC500 C REMDISK U This unloads REMDISK from the desktop PC 6 On the desktop PC press ESC to exit REMSERV ...

Page 143: ...19 8 Transferring files remote disks PC 500 user s manual ...

Page 144: ...n recommends that you use this jumper to disable or enable the PICO FA BIOS region and leave the D8000 DFFF ROMSETSSD enabled in SETUP as the default Note When installing Windows 95 or Windows NT operating system it is necessary to disable the PICO FA flash file system Phoenix s PICO FA includes an extended BIOS PICOFA IMG a device driver PICOFA SYS a format utility PFORMAT EXE and a testutility T...

Page 145: ...ve is based upon the drive order set by the SETSSD com mand and by SETUP s boot sequence option If the boot sequence is set to A THEN C the system will look for a floppy diskette in drive A If a diskette is not installed or a floppy is not defined the boot drive will be the first drive specified in the SETSSD command If the boot sequence is set to C ONLY the check for a diskette is bypassed Note T...

Page 146: ...ou have 1 IDE drive enter PC500 C PFORMAT H2 Note If the drive had not been formatted previously reset the system before accessing the drive This allows DOS to recognize the drive and add a letterdesignationtoit Note PFORMAT EXE must be downloaded from the PC 500 utility disk This file is located in the UTILS directory Note PFORMAT EXEwillnotformatIDE ATAdrives Using SYS to make an SSD bootable Ad...

Page 147: ...SETSSD SSD1 SSD0 before 2 Add your application to SSD1 and modify the AUTOEXEC BAT pro gramtoincludeyourapplication 3 Reset the system SSD1 is now drive C and your application should beginexecution Note If the SETUP option Boot Sequence is set to A THEN C remove any floppy in drive A before resetting the system Note The SETSSD options are not used when W2 9 10 is not jumpered Using SETSSD and TEST...

Page 148: ...al file enter GETIMG SSD1 filename 2 To make a copy of the PC 500 SSD to a remote file a Establish serial communications between the PC 500 and the desk top PC using SmartLINK b On the PC 500 enter GETIMG SSD1 filename COM1 c On the desktop PC exit SmartLINK by pressing ALT X and thenenter GETIMGH filename COM1 d Write the image filename to the host drive Programming copies of the PC 500 SSD PGMIM...

Page 149: ... set to boot from the SSD beingprogrammed You can create a new BIOS file for adding your own extended BIOS by running MAKEBIOS BAT from the utility disk To boot using the new BIOS in SSD1 be certain that W2 5 6 is jumpered To boot using BIOS in SSD0 be certain that W2 5 6 is not jumpered Programming the video BIOS into an SSD SSD0 and SSD1 can also contain the video BIOS If you choose to use a mon...

Page 150: ...cription 9 10 UA User option jumper A default Table 21 2 User option jumper W4 Pins Label Description 5 6 UB User option jumper B default Readjumpers ThissectionprovidesthedefinitionfortheReadjumpersfunction Function fbh Subfunction 0Bh Purpose To read the on board jumper settings Callingregisters Ah fbh AL 0Bh DX ffffh Returnregisters AL Jumperinformation bit state 7 Notused 6 Notused 5 Notused 4...

Page 151: ... reads the user defined jumpers unsigned char jumpers Inline assembly code for Borland C 3 1 asm mov ax 0fb0bh mov dx 0ffffh int 17h mov jumpers al if jumpers A look at bit 0 printf User jumper UA installed n else printf User jumper UA not installed n if jumpers B printf User jumper UB installed n else printf User jumper UB not installed n ...

Page 152: ...using the PMISETUP utility see the PMISETUP sectionlaterinthischapter Power management overview Power management is implemented via the software management interface SMI function andprovidesmultiplelevelsofmanagement The firmware is also capable of cooperative power management with an APMcompatibledriverorapplication suchasPOWER EXE Coopera tivepowermanagementallowspowerawareapplicationstocontrolt...

Page 153: ...that keyboard disk and video access should prevent the system from entering DOZE mode In addition specific interrupts can be configured to reset the DOZE timer DOZE mode is typicallyareducedclockoperation butastopped clockmodeisalso supported Iftheslow clockmodeisselected theCPUclockisslowed from 33 MHz to 8 MHz If stopped clock mode is selected the secondary DOZE timer is configured to restart th...

Page 154: ...ver Individual device states in the various system power states can be configured via CMOS locations to the extent at which the firmware has the ability to control them For example the video can remain ON during STANDBY which makes STANDBY mode more transparent to the user or it can be powered OFF during STANDBY to further reduce power The parallel port may be powered OFF in STANDBY or remain ON i...

Page 155: ...en the system resumes Normally the BIOS can read the actual time from the real time clock and restore the operating system s timer from that value However some operating sys tems do not support the update methods utilized by the BIOS for this function The time update can be enabled or disabled using the PC 500 SETUP program In SETUP the following options are available PowerManagement ENABLEDorDISA...

Page 156: ...y PC500 C PMISETUP TEST PMI 5 Hardware reset the system for the PMISETUP options to take effect The PC 500 system is now ready for SUSPEND RESUME 6 Initiate a SUSPEND RESUME input signal at J10 3 4 or allow the suspend delay timer to expire Refer to the IRQ routing and opto IRQschapter for the EPMI connection and signal requirements 7 The PC 500 system enters the SUSPEND mode powering down any dev...

Page 157: ...powered up if specified in CMOS Any device access or specifiedinterruptcancausethesystemtoRESUME HowtoinitiatetheSTANDBYoption 1 In the PC 500 SETUP and in a PMI file enable power management and selectthefollowingoptions SETUP PowerManagement ENABLED DOZEClock Slow Stop SLOW TimeUpdatedAfterSuspend ENABLED TEST PMI pmi enable Y Enablesthepowermanagement standby delay xx SetsdelaytimebeforeSTANDBY ...

Page 158: ...ined by the APM software powering down any devices that can be powered down 7 A system RESUME is generated by any event defined in the PMI file or when an external RESUME signal is applied If a VGA monitor is attached the video will return If a hard drive is attached the drive will not spin up until accessed Refer to the default PMI file in the Powermanagementconfiguration section in this chapter ...

Page 159: ... memory typi cally 512 KB to 1 MB However a larger partition may be created in order to support additional system memory to be added at a later time WARNING PHDISK EXE provides the same function as FDISK but also creates a special partition for the Save to Disk option Only use a hard drive which any existing data can be destroyed The Save To Disk function may be disabled If it is disabled then the...

Page 160: ...turn off your computer Power down the system The CPU enters SUSPEND mode The validity of the system context on the hard disk is identified by marking a bit in the configurationEEPROM 8 When the system is powered on the validity of the context is checked in EEPROM If valid the system s context is restored to the system memory and devices back to where it was before the PMI signal was generated Powe...

Page 161: ...lay time before SUSPEND x 0 31 minutes Dozetimerenableandresets The DOZE mode may be selected to be a SLOW clock or STOP clock mode and is determined in power management SETUP Numerous sources may reset the DOZE timer preventing entry to DOZE mode The BIOS as sumes that video floppy hard disk and keyboard accesses should all reset the DOZE timer In addition various interrupts can be configured to ...

Page 162: ...rs LPT reset idle Y N Enables reset of IDLE timer if LPT access occurs KBD reset idle Y N Enables reset of IDLE timer if Keyboard accessoccurs FDD reset idle Y N Enables reset of IDLE timer if Floppy Disk Driveaccessoccurs HDD reset idle Y N Enables reset of IDLE timer if Hard Disk Driveaccessoccurs Interrupts in the system can also reset the IDLE timer to prevent entry intoreducedpowermodes These...

Page 163: ...reset Y N Enables reset of STANDBY mode if IRQ4 occurs irq5 standby reset Y N Enables reset of STANDBY mode if IRQ5 occurs irq6 standby reset Y N Enables reset of STANDBY mode if IRQ6 occurs irq7 standby reset Y N Enables reset of STANDBY mode if IRQ7 occurs irq8 standby reset Y N Enables reset of STANDBY mode if IRQ8 occurs irq9 standby reset Y N Enables reset of STANDBY mode if IRQ9 occurs irq10...

Page 164: ...UME then the interrupt must be selected in the PMI file resume irqs enable Y N Enables RESUME from RESUME IRQ group irq1 resume reset Y N Enables RESUME if IRQ1 occurs irq3 resume reset Y N Enables RESUME if IRQ3 occurs irq4 resume reset Y N Enables RESUME if IRQ4 occurs irq5 resume reset Y N Enables RESUME if IRQ5 occurs irq7 resume reset Y N Enables RESUME if IRQ7 occurs irq8 resume reset Y N En...

Page 165: ...tate of the system to disk or generating an INT 15h The power failure is signaled by activation of the external power management input J10 1 2 Once activated the system either performs a System Reset performs a Save to Disk opera tion or generates an INT 15h These functions are enabled in a PMI file 1 SystemReset The PMI file contains pfh enable Y Enablespowerfailoptions pfh reset Y Enablessystemr...

Page 166: ...ys enabled and the CPU not run in full on condition If thermal man agement is enabled and DOZE is enabled the PC 500 will operate to the published temperature specifications If thermal management is disabled care must be taken not to damage or shorten the life of the CPU Adequate ventilation preferably with a fan and ample room around the CPU and card cage must be provided Please contact Octagon T...

Page 167: ...he PMISETUP program isasfollows PMISETUP inputfilename SHOWALL DEFAULT P PMISETUP will parse a file using KEYWORD nn type options One keyword can be specified per line characters after a semicolon will be regarded as comments Blank lines are ignored If multiple lines contain the same keyword the last value will be used Keywords and values are notcasesensitive A sample input file TEST PMI is as fol...

Page 168: ...vailable and can be included in a PMI file which is loaded by PMISETUP EXE PMISETUP EXE is located inthe UTILSdirectory The following are the keywords which are used To disable options either an N or 0 is used depending on the option pmi enable Y N Disables enablesthepowermanagementcode fdd to xx Sets the on card LPT1 floppy disk drive time out value x 0 31 minutes hdd to xx Sets the hard drive ti...

Page 169: ...Y N Enables reset of IDLE clock if IRQ15 occurs save to disk Y N Enables save to disk feature thermal management Y N Enables thermal management features CDC irq0 standby reset Y N Enables reset of STANDBY mode if IRQ0 occurs irq1 standby reset Y N Enables reset of STANDBY mode if IRQ1 occurs irq3 standby reset Y N Enables reset of STANDBY mode if IRQ3 occurs irq4 standby reset Y N Enables reset of...

Page 170: ...mber of RI transitions n for RESUME COM2ringindicator EPMI resume reset Y N Enables RESUME timer if EPMI occurs EPMI reset idle Y N Enables reset of IDLE timer if EPMI occurs LCD reset idle Y N LCD VGAaccessresetsIDLEtimer COM1 reset idle Y N Enables reset of IDLE timer if COM1 access occurs COM2 reset idle Y N Enables reset of IDLE timer if COM2 access occurs LPT reset idle Y N Enables reset of I...

Page 171: ...15 reset idle N save to disk N thermal management Y irq0 standby reset N irq1 standby reset Y irq3 standby reset Y irq4 standby reset Y irq5 standby reset Y irq6 standby reset Y irq7 standby reset Y irq8 standby reset Y irq9 standby reset N irq10 standby reset N irq11 standby reset N irq12 standby reset N irq13 standby reset N irq14 standby reset Y irq15 standby reset N resume irqs enable Y irq1 r...

Page 172: ...t Y RI transitions 5 EPMI resume reset Y EPMI reset idle Y LCD reset idle Y COM1 reset idle Y COM2 reset idle Y LPT reset idle Y KBD reset idle Y FDD reset idle Y HDD reset idle Y CDC beep Y COM1 suspend Y COM2 suspend Y COM1 buffer suspend Y COM2 buffer suspend Y ...

Page 173: ...22 22 CPU power management PC 500 user s manual ...

Page 174: ...00 4 Make sure your power module provides 5V 0 25V and at least 2 5A ofcurrent 5 After verifying the above conditions you can monitor voltage levels by connecting an oscilloscope between the TxD line on J13 pin 5 and ground After powerup you should see a burst of activity on the oscillo scope screen The voltage level should switch between 8V This test verifies that the CPU is active and that the t...

Page 175: ... from it and remake SSD1 PICO FA reports a drive but issuing a DIR generates an error message 1 The SSD may not be formatted Run either of the following PFORMAT Hn or PFORMAT Hn m where nrepresentstheharddrivenumber For more information see the on Save and run programschapter PICO FA does not report the drive 1 Run SETSSD and make sure it is correct 2 Make sure that W4 3 4 is jumpered or that PICO...

Page 176: ...ither use a different power supply that discharges faster leave the power off until the supply has adequate time to discharge or place a 100 ohm large wattage resistor across the output capacitor Technical assistance Carefully recheck your system before calling Technical Support Run as many tests as possible the more information you can provide the easier it will be for the Technical Support staff...

Page 177: ...23 4 Troubleshooting PC 500 user s manual ...

Page 178: ...of Section 4 Overview Section 4 Appendices Section4containsaseriesofappendiceswhichprovidesadditional information about the PC 500 AppendixA Technicaldata AppendixB Softwareutilities AppendixC Thirdpartysupport AppendixD Accessories ...

Page 179: ...Overview of Section 4 PC 500 user s manual ...

Page 180: ...OEM con tract Floppy drive Floppydrivesupportviathefloppydriveconnector Hard drive HarddriveBIOSsupportedusingexternalharddrivecontrollerwhich supports drives up to 4 GB Solid state disk 0 Supports a 512K EPROM 512K flash or 512K SRAM Solid state disk 1 Supports 2 MB flash soldered on card 1 MB flash soldered on card is availableunderOEMcontract ROM DOS DOS 6 22 compatible Serial I O COM1 through ...

Page 181: ...56 Amps typical Slowclock 650 mA typical Stopclock 770 mA typical Suspend 406 mA typical Voltage supervisor Reset threshold 5V supply 4 65V typical Environmental specifications 40 to 70 C operating temperatures above 45 C require power man agement or installation of a fan 55 to 90 C nonoperating RH 5 to 95 noncondensing Size 5 75 x 8 00 x 0 9375 Watchdog timer Default time out is typically 1 6 sec...

Page 182: ...Fh Video BIOS 1st 32 KB C8000h CFFFFh Video BIOS 2nd 32KB and SCSI BIOS area D0000h D7FFFh Off card memory D8000h DFFFFh INT 17h and PICO FA extension area E0000h E7FFFh 32 KB BIOS extension area reserved for power management E8000h EFFFFh 32 KB SSD memory paging window F0000h FFFFFh 64 KB BIOS area 100000h 1FFFFFFh 32 KB addressable extended memory default ...

Page 183: ... Serial EEPROM read access watchdog IOR strobe X2F8h X2FFh COM2 configurable in SETUP X378h X37Bh Bidirectional parallel port LPT1 configurable in SETUP X300h X31Fh Ethernet X320h X33Fh Set by IORGSEL A 1 and IORGSEL B 1 X328h X32Fh is free X340h X35Fh Set by IORGSEL A 1 and IORGSEL B 0 X348h X34Fh is free X3F8h X3FFh COM1 configurable in SETUP X320h X327h COM5 default configurable with SETIRQ Alt...

Page 184: ... read write 0 on 1 off LCD bias down Bit 1 I O read write 0 on 1 off VGA suspend Bit 0 I O read write 0 on 1 off Table A 4 I O map Configuration inputs via OctaGlue Address at X0A9h Function Port 0A9H USEEDO Bit 7 I O read 0 on 1 off Not used Bit 6 I O read 0 on 1 off IOREGSEL_A Bit 5 I O read 0 on 1 off IOREGSEL_B Bit 4 I O read 0 on 1 off User option jumper B Bit 3 I O read 0 on 1 off User optio...

Page 185: ...lt Jumper settings Table A 8 TTL and RS 485 interface W1 Pins Description 2 4 5 6 TTL interface 1 2 3 5 4 6 RS 485 interface default Table A 9 RS 485 termination select jumper W1 Pins Description 7 8 RS 485 terminated idle line at mark 9 10 RS 485 terminated idle line at mark 7 9 RS 485 terminated idle line at space 8 10 RS 485 terminated idle line at space default Note For no termination remove j...

Page 186: ...re information on BIOS regions Table A 11 EZ I O pull up pull down user option jumper W3 Pins Label Description 1 2 Pull up to 5V 2 4 Pull down to Gnd 9 10 UA User option jumper A default Table A 12 Auxiliaryoptionjumper W4 Pins Label Description 1 2 V1 C8000 CFFFF BIOS region toggle video BIOS region 2 3 4 X D8000 DFFFF BIOS region toggle PICO FA 5 6 UB User option jumper B 7 8 VE VGA controller ...

Page 187: ...h battery backup W5 1 2 3 4 5 6 9 10 W2 7 8 Flash W5 1 2 3 4 5 6 9 10 EPROM default pins jumpered W2 7 8 is not jumpered Table A 14 Flat panel voltage select W8 Pins Description 1 2 5V 3 4 3 3V default pins jumpered Table A 15 Inverted shift clock signal voltage level select W9 Pins Description 1 2 3 3V 3 4 5V default pins jumpered ...

Page 188: ...SD2 12V LA18 IRQ14 8 SD1 0 WS LA17 DACK0 9 SD0 12VDC MEMR DRQ0 10 IOCHRDY Key MEMW DACK5 11 AEN SMEMW SD8 DRQ5 12 SA19 SMEMR SD9 DACK6 13 SA18 IOW SD10 DRQ6 14 SA17 IOR SD11 DACK7 15 SA16 DACK3 SD12 DRQ7 16 SA15 DRQ3 SD13 5V 17 SA14 DACK1 SD14 Master 18 SA13 DRQ1 SD15 Gnd 19 SA12 Refresh Key Gnd 20 SA11 SYSCLK 21 SA10 IRQ7 22 SA9 IRQ6 23 SA8 IRQ5 24 SA7 IRQ4 25 SA6 IRQ3 26 SA5 DACK2 27 SA4 TC 28 S...

Page 189: ... Function 1 Keyboard data 2 NC 3 Gnd 4 5V Safe 5 Keyboard clock 6 NC 7 SHLD0 8 SHLD1 Table A 18 Mouse connector J3 Pin Function 1 Mouse data 2 NC 3 Gnd 4 5V Safe 5 Mouse clock 6 NC 7 SHLD0 8 SHLD1 Table A 19 Speakerconnector J4 Pin Function 1 Speaker drive 2 NC 3 Gnd 4 5V Safe ...

Page 190: ...4 Gnd 15 P0 16 P1 17 Gnd 18 P2 19 P3 20 Gnd 21 P4 22 P5 23 Gnd 24 P6 25 P7 26 Gnd 27 P8 28 P9 29 Gnd 30 P10 31 P11 32 Gnd 33 P12 34 P13 35 Gnd 36 P14 37 P15 38 Gnd 39 P16 40 P17 41 Gnd 42 P18 43 P19 44 Gnd 45 P20 46 P21 47 Gnd 48 P22 49 P23 50 Gnd Table A 21 VGA connector J6 Pin Function Pin Function 1 Red 2 Green 3 Blue 4 NC 5 Gnd 6 Gnd 7 Gnd 8 Gnd 9 5V Safe 10 Gnd 11 NC 12 DDCD 13 Horizontal syn...

Page 191: ... NC 16 Gnd 17 NC 18 Gnd 19 VSYNC 20 Gnd 21 HSYNC 22 Gnd 23 NC 24 Gnd 25 NC 26 Gnd 27 NC 28 Gnd 29 PCLK 30 Gnd 31 Color key 32 Gnd 33 VR2 34 VR3 35 Gnd 36 VR4 37 VR5 38 Gnd 39 VG2 40 VG3 41 Gnd 42 VG4 43 VG5 44 Gnd 45 VG6 46 VG7 47 Gnd 48 VB2 49 VB3 50 Gnd 51 VB4 52 VB5 53 Gnd 54 VB6 55 VB7 56 Gnd 57 NC 58 NC 59 NC 60 NC Table A 23 Batteryconnector J8 Pin Function 1 Battery 2 Key 3 Gnd 4 Gnd ...

Page 192: ...10 3 4 pin 1 positive input pin 3 positive input pin 2 negative input pin 4 negative input Table A 26 EZ I O connector J11 Pin Function Pin Function Pin Function 19 Port A bit 0 10 Port B bit 0 13 Port C bit 0 21 bit 1 8 bit 1 16 bit 1 23 bit 2 4 bit 2 15 bit 2 25 bit 3 6 bit 3 17 bit 3 24 bit 4 1 bit 4 14 bit 4 22 bit 5 3 bit 5 11 bit 5 20 bit 6 5 bit 6 12 bit 6 18 bit 7 7 bit 7 9 bit 7 2 5V safe...

Page 193: ...5 Gnd 6 SD2 7 Gnd 8 SD3 9 Gnd 10 SD4 11 Gnd 12 SD5 13 Gnd 14 SD6 15 Gnd 16 SD7 17 Gnd 18 SCDP 19 Gnd 20 Gnd 21 Gnd 22 Gnd 23 Gnd 24 Gnd 25 NC 26 Terminate power 27 Gnd 28 Gnd 29 Gnd 30 Gnd 31 Gnd 32 ATNG 33 Gnd 34 Gnd 35 Gnd 36 BSY 37 Gnd 38 ACK 39 Gnd 40 RST 41 Gnd 42 MSG 43 Gnd 44 SEL 45 Gnd 46 C D 47 Gnd 48 REQ 49 Gnd 50 I O ...

Page 194: ... Gnd Gnd 20 5V Safe 5V Safe active low pulled high to 5V RI on COM2 used to resume suspended operation Refer to the Watchdog timer and hardware resest and the CPU power management chapters Table A 29 AT and industrial serial for COM3 and COM4 J14 Pin COM3 standard AT serial COM3 optional industrial serial Pin COM4 standard AT serial COM4 optional industrial serial 1 DCD 2 DSR 3 RxD RxD 4 RTS RTS 5...

Page 195: ...TE 25 Gnd 26 TRK 00 27 Gnd 28 WP 29 Gnd 30 RD DATA 31 Gnd 32 SIDE 1 33 Gnd 34 DISKCHANGE active low 5V Safe is factory optional Gnd is factory default Table A 31 LPT1 as printer connector J16 Pin DB 25 pin Function Pin DB 25 pin Function 1 1 STB 14 20 Gnd 2 14 AFD 15 8 DATA6 3 2 DATA0 16 21 Gnd 4 15 ERR 17 9 DATA7 5 3 DATA1 18 22 Gnd 6 16 INIT 19 10 ACK 7 4 DATA2 20 23 Gnd 8 17 SLIN 21 11 BUSY 9 5...

Page 196: ... 4 5 6 default Table A 33 IDE hard drive connector J18 Pin Function Pin Function 1 Reset 2 Gnd 3 Data 7 4 Data 8 5 Data 6 6 Data 9 7 Data 5 8 Data 10 9 Data 4 10 Data 11 11 Data 3 12 Data 12 13 Data 2 14 Data 13 15 Data 1 16 Data 14 17 Data 0 18 Data 15 19 Gnd 20 Key 21 NC 22 Gnd 23 IOW 24 Gnd 25 IOR 26 Gnd 27 CHRDYB 28 5V 29 NC 30 Gnd 31 IRQ14 32 NC 33 A1 34 NC 35 A0 36 A2 37 CS0 38 CS1 39 NC 40 ...

Page 197: ...the PC 500 board for the use of 100 wide nylon tie wraps These tie wraps loop around the SSD0 DIP device and also the DIMM memory expansion device This feature will increase the ruggedness and the retention ability in high vibration environments Nylon tie wraps are available from a hardware specialty supplier such as Richco phone number 1 800 621 1892 The following letters specify the length of th...

Page 198: ... COM1CON EXE n GETBIOS EXE n GETIMG EXE n GETIMGH EXE n I17HNDLR EXE n LCDBIAS EXE n LPT1CON COM n PFORMAT EXE n PGMBIOS EXE n PGMIMG EXE n PGMIMGH EXE n PGMVIDEO EXE n PHDISK EXE n PMISETUP EXE n REMDISK EXE n REMQUIT COM n REMSERV EXE n RESET COM n SCONSOLE EXE n SETIRQ EXE n SETSSD EXE n SETUP COM n TESTRFA EXE n TRANSFER EXE Supportdevicedrivers n PICOFA SYS n HIMEM SYS n VDISK SYS Note Other ...

Page 199: ...heoutputfileforsavingorprogramming GETIMG EXE Purpose 1 This support command captures an image of an SSD and places it into a localfile Syntax 1 GETIMG SSDx filename Purpose 2 This support command captures an image of an SSD and transfers it to a host PC running GETIMGH Syntax 2 GETIMG SSDx COMx Bxx Ixx Purpose 3 This support command captures an image of an SSD and transfers it to a host PC runnin...

Page 200: ...00 57600 115 115200 The default is 38400 when using a COMx switch n Ixx specifies the interrupt to which the UART is connected The value x represents a variable from 3 to 15 Remarks GETIMG compatibility The following devices share the same image and can be used inter changeably Atmel s AT29C040 and AT29C040A SST s 28SF040 512K EPROM and 512K SRAM Use an EPROM to make the drive read only Because th...

Page 201: ...ase address 100 3FF is in hexadecimal format n Bxx specifies baud rate of transfer where xx can be 300 1200 2400 4800 9600 19200 38400 57600 115 115200 The default is 38400 when using a COMx switch If COM1 is the console the baud rate defaults to the current console baud rate n Ixx specifies the interrupt to which the UART The variable x represents a value from 3 to 15 See also GETIMG EXEfordetail...

Page 202: ...ith 2 designates the PS 2 method Example 1 DEVICE HIMEM SYS The above command installs the XMS device driver Once this driver is installed accessing the HMA and Extended Memory XMS areas are legal The Extended Memory area can contain up to 2 Gigabytes of memory Typical systems have 4 8 or 16 MB XMS memory installed Example 2 DEVICE HIMEM SYS machine 1 This example forces the use of the AT style A2...

Page 203: ...hin the PC 500 s pre defined voltage range factory default is 22V to 30V The and are on the 101 key enhanced numeric keypad The and are also on the local keyboard as well as the CTRL keystroke Syntax LCDBIAS D R U Parameters n D shows a display of or when the LCDBIAS TSR detects a CTRL or CTRL This display may interfere with graph icsbasedprograms n Rreinstalls the TSR when detection occurs of a p...

Page 204: ...CD TSR will not install See also I17HNDLR EXE and the CRTs and flat panels chapter LPT1CON COM Purpose This support command redirects the video to the LPT1 port Syntax LPT1CON Remarks If you have a 2010 interface board and an LCD display connected to the LPT1port executingtheDISPLAY EXEandLPT1CON COMprograms allow you to use the display as the system console You must reset your system to change th...

Page 205: ... write an MBR This is required for unformatted drives using non AMD flash devices n V is an optional parameter that specifies a volume label is to be placedondisk Example 1 To place a volume label on disk for preformatted drive D enter PFORMAT d V Example 2 To have PICO FA write an MBR to drive H0 enter PFORMAT H0 M PGMBIOS EXE Purpose This support command programs a new system BIOS into the PC 50...

Page 206: ...IOS from SSD0 to SSD1 enter PGMBIOS SSD0 SSD1 PGMIMG EXE Purpose 1 This support command programs a local file image to an SSD Syntax 1 PGMIMG SSDx filename Purpose 2 This support command programs a local file image to an SSD and transfers it to a host PC running PGMIMGH Syntax 2 PGMIMG SSDx COMx Bxx Ixx Purpose 3 This support command programs a local file image to an SSD and transfers it to a host...

Page 207: ... be 300 1200 2400 4800 9600 19200 38400 57600 115 115200 The default is 38400 when using a COMx switch If COM1 is the console the baud rate defaults to the current console baud rate n Ixx specifies the interrupt to which the UART base address is con nected The variable x represents a value from 3 to 15 PGMIMGH EXE Purpose 1 This support command programs an image file from a target PC run ningPGMIM...

Page 208: ...alue from 3 to 15 See also See PGMIMG EXE See also GETIMG for image compatibility PGMVIDEO EXE Purpose This support command programs a video BIOS into the BIOS area of an SSD A new video BIOS is required for a different flat panel display Syntax PGMVIDEO VIDEOBIOS DAT SSDn P C Parameters n VIDEOBIOS DAT is the filename of the new video BIOS For a complete listing see the VGA 65550 utility disk n S...

Page 209: ...sablingthevideoBIOS seetheConsoledeviceschapter If the video BIOS is programmed and no display results occur then adjust W2 1 2 and W4 7 9 by trying four options on on on off off on or off off refer to Table 7 4 Also confirm that the VGA disable jumper W4 5 6 is installed If the display still does not work then check the cabling and or the video BIOS programmed for your flat panel To restore the C...

Page 210: ...ion already exists on the hard drive this program will destroy it Execute PHDISK first then install other partitions using FDISK or other OS partitioning programs To use the save to disk feature the PMISETUP SAVE TO DISK option must be set to Y The IDE drive must also be the first drive therefore the SETSSD after option should be used The save to disk feature works with true IDE drives only See th...

Page 211: ...OWALLspecifies to show all of the power management options onscreen n DEFAULT specifies the BIOS defaults that are to be loaded first before the inputfileisused n Pspecifies to enable pausing between screens for viewing when usingthe SHOWALLoption n displays a short help screen for the PMISETUP program No other arguments are to be included on the command line when the isused See also SLOW PMI QUIC...

Page 212: ...0 19200 38400 57600 and 115k The default baud rate is 115k n isanoptionalargumentwhichspecifiespacketstyletransmission This is recommended for any baud rates over 19200 The default for this option is to include the for packet transmission n COMnis an optional argument which selects the communication port Available ports are 1 and 2 COM1 is the default port Note To use the Remote Disk both the REMD...

Page 213: ...andin CONFIG SYS or from the DOS prompt Example 1 To install the REMDISK program from CONFIG SYS at 19200 on COM1 usingpacketstyletransmission enterthefollowingin CONFIG SYS and then reboot the system remember to include the full path to find REMDISK EXE if not located in the root directory DEVICE REMDISK EXE B19200 Example 2 To display a help screen for REMDISK enter the following at the DOS prom...

Page 214: ...U running REMDISK to cancel the REMSERV command You may also press the ESC key if you have access to a local keyboard to the CPU running REMSERV See also REMSERV EXE REMDISK EXE REMSERV EXE Purpose This support command makes a single drive at a time on the server system available to the Client The available drive can be changed at any time by quitting the REMSERV program and then running the progr...

Page 215: ...rts are 1 and 2 COM1 is the default port n S instructs REMSERV to run silently that is without any screen output n is an unlisted option which is used to print a short help screen for the REMSERV program If the is used the drive letter argument isomitted forexample REMSERV Example 1 To select drive B as the available Server drive at 115K baud packet styletransmission usingCOM1 youwouldenterthefoll...

Page 216: ...pansion I O cards on the bus This differs from a CTRL ALT DEL reboot of the system which only restarts the system but not the expansion cards The RE SET button on the PC 500 also accomplishes the same thing as the RESETcommand SCONSOLE EXE Purpose This support command checks whether the system is running on a serial console Syntax SCONSOLE Remarks This command is useful in batch programs to detect...

Page 217: ...To program the factory default map file enter SETIRQ 500_001 ISP SETSSD EXE Purpose ThissupportcommandconfiguresPICOFAdeviceorder Syntax SETSSD SSDn SSDm before after NoSSD D QNX QNX SSD0BIOS SSD0BIOS Parameters n SSDn specifiesoneSSD n SSDm specifiestwoSSDs n before is an optional parameter that indicates the SSDs are to be allocated before any hard drives The first SSD specified will be the boot...

Page 218: ...QNX drive image Example 2 To enable the PICOFA compatible mode enter the following command SETSSD SSD1 SSD0 QNX If the SSDs were programmed with a QNX drive image use PFORMAT to reformat the SSD Remarks If the boot order in SETUP is set to A THEN C the system tries to boot from a floppy if one exists and then it tries to boot from the C drive The C drive can be either an SSD or an HDD depending up...

Page 219: ...ain menu appears OCTAGON SYSTEMS CORPORATION PC500 SETUP UTILITY Vx x c Phoenix Technologies Ltd 1985 1995 _________________________________________________ Press SPACE to CHANGE ENTER to ACCEPT ESC to EXIT Serial Console on COM1 ENABLED COM1 Console Baud Rate 9600 Power on memory test ENABLED Boot Sequence C ONLY Serial Port COM1 ENABLED Serial Port COM1 Address 3F8h default COM2 ENABLED Serial P...

Page 220: ... Shadow D8000h DFFFFh DISABLED Press ENTER to SAVE the changes or Press ESC to EXIT without saving the changes Options Saved You must reset for these options to take effect PC500 C Note Executing SETUP D will change all setup parameters to default values See also See the SETUP programs chapter for more information You may also enter SETUP at post time by entering the backspace and s keys TESTRFA E...

Page 221: ...EXE PFORMAT EXE TRANSFER EXE Purpose This support command transfers files to or from the PC 500 over a serialport Syntax TRANSFER filepath S R Bxxxx V COMx Parameters n filepathspecifiesthefilepathnametosendorreceive n S specifiestosendthefile n R specifies to receive the file This is the default n Bxxxx specifies baud rate of transfer where xxxx can be 300 1200 2400 4800 9600 19200 38400 57600 11...

Page 222: ...O DEMO EXE from a remote PC to the file named D DEMO EXE on the PC 500 at 57600 baud with a serial cable from COM2 on the remote PC and COM1 on the PC 500 enter the following command on the PC 500 TRANSFER D DEMO EXE R V B57600 Then enter the following command on the remote PC TRANSFER C DEMO DEMO EXE S V COM2 B57600 To receive a file named D MYAPP EXE from the PC 500 and name it C APPS MYAPP2 EXE...

Page 223: ...amount of memory available for programs unless the extended memory switch is used n secs specifies the sector size in bytes The default is 512 bytes per sector This value must be 128 256 512 or 1024 All other values are not valid and the default of 512 bytes will be used n dirs specifies the number of root directory entries The default is 64 directory entries There may be any number of root direct...

Page 224: ... DEVICE VDISK SYS The above example builds a 64K RAM disk in DOS memory Example 2 DEVICE C DOS VDISK SYS 220 E This example builds a 220K RAM disk in extended memory The VDISK device driver is loaded from the C drive and the DOS direc tory VDISK assumes the default 512 byte sector size and 64 directory entries Example 3 DEVICE VDISK SYS 45 128 18 The above example builds a 45K RAM disk in DOS memo...

Page 225: ...B 28 Software utilities PC 500 user s manual ...

Page 226: ...this space auto matically Use the sample files from Octagon s QNX utility disk to program QNX into SSD1 Note When QNX is in the SETSSD command line i e SETSSD SSD1 SSD0 QNX then the QNX drive option is enabled Once your system is in the QNX mode SSD1 cannot be used as a drive from DOS TESTRFA will not work on SSD1 Using M Systems DiskOnChip DOC To use the M Systems DiskOnChip DOC module with your ...

Page 227: ...Resetyoursystem 9 Execute TFORMAT 2 BOOTSIZE 128K Note To access the DOC module execute the TFORMAT command line at the same time you execute the operating system 10 Resetyoursystem 11 Access the DOC drive as drive D Note If a hard disk is installed change Step 9 to the following command TFORMAT 3 BOOTSIZE 128K Then access the DOC drive as drive E Step 10 Booting from the DOC drive 1 Add an operat...

Page 228: ...ain relief J16 J11 LPT1 printer EZ I O 26 pin shrouded header AMP 746288 6 receptacle 499252 3 strain relief P8 P9 Power 6 pin connector Molex 90331 x101 housing 08 50 0276 crimp terminal J15 Floppy 34 pin shrouded header AMP 746288 8 receptacle 499252 6 strain relief J18 IDE hard drive 44 position 2mm x 2 header AMP 111626 0 receptacle J1 PC 104 interface PC 104 8 or 16 bit receptacle Samtec ESQ ...

Page 229: ...5 3 5 hard drive 4080 STB 26 Terminal board 26 position 2905 Table D 3 Memorydevices Address Description 00000h 9FFFFh System memory A0000h BFFFFh Off card memory C0000h C7FFFh Video BIOS 1st 32 KB C8000h CFFFFh Video BIOS 2nd 32KB and SCSI BIOS area D0000h D7FFFh Off card memory D8000h DFFFFh INT 17h and PICO FA extension area E0000h E7FFFh 32 KB BIOS extension area reserved for power management ...

Page 230: ...features Optional features COM1 standard full 8 wire interface 4 wire industrial interface COM2 standard full 8 wire interface 4 wire industrial interface COM3 optional full 8 wire interface 4 wire industrial interface COM4 optional full 8 wire interface 4 wire industrial interface COM5 optional 2 wire RS 485 interface 2 wire TTL serial port none Table D 6 Miscellaneouspartnumbers Product Descript...

Page 231: ...D 4 Accessories PC 500 user s manual ...

Page 232: ...lect accident orimproperinstallation 3 The design capability capacity or suitability for use of the Software Software is licensed on an AS IS basis without warranty The warranty and remedies set forth above are in lieu of all other warranties expressed or implied oral or written either in fact or by operationoflaw statutoryorotherwise includingwarrantiesofmer chantabilityandfitnessforaparticularpu...

Page 233: ...customer 7 Otherconditionsandlimitationsmayapplytointernationalshipments Note PRODUCTS RETURNED TO OCTAGON FREIGHT COLLECT OR WITHOUT AN RMA NUMBER CANNOT BE ACCEPTED AND WILL BERETURNEDFREIGHTCOLLECT Returns There will be a 15 restocking charge on returned product that is unopened and unused if Octagon accepts such a return Returns will not be accepted 30 days after purchase Opened and or used pr...

Search results

Summary of Contents for PC-500

Reviews:

Related manuals for PC-500

Brands by name

Popular brands

Octagon PC-500, User Manual

Search results

Summary of Contents for PC-500

Reviews:

Related manuals for PC-500

Brands by name

Popular brands