Mitsubishi Electric FDC100VNA Скачать руководство пользователя страница 56

Страница: 56 / 210

'11 • PAC-T-160

10m

15m

20m

25m

30m

Piping length limitations

0RGHO

Item

71VN

9196

Max. one way piping length

50m

91;96;

100m

70m or 35m

(2)

Max. vertical height difference

Outdoor unit is higher 30m

2XWGRRUXQLWLVORZHUP

otes (1)

9DOXHVLQWKHWDEOHLQGLFDWHWKHRQHZD\SLSLQJOHQJWKEHWZHHQWKHLQGRRUDQGRXWGRRUXQLWV

(2)

:KHQ

JDVSLSHLVDSSOLHGWRDQGPD[LPXPRQHZD\OHQJWKLVOLPLWHGWRP

How to obtain the cooling and heating capacity

1HWFRROLQJFDSDFLW\

:KHQWKHRXWGRRUXQLWLVORFDWHGEHORZLQGRRUXQLWVLQFRROLQJPRGHRUZKHQWKHRXWGRRUXQLWLVORFDWHGDERYHLQGRRUXQ

its in

KHDWLQJPRGHWKHFRUUHFWLRQFRHIILFLHQWPHQWLRQHGLQWKHEHORZWDEOHVKRXOGEHVXEWUDFWHGIURPWKHYDOXHLQWKHDERYHWDEOH

Height difference between the indoor unit and
outdoor unit in the vertical height difference

8.4 Height difference between the indoor unit and outdoor unit

$GMXVWPHQWFRHIILFLHQ

([DPSOH7KHQHWFRROLQJFDSDFLW\RIWKHPRGHO)')919'ZLWKWKHDLJK´WKHSLSLQJOHQJWKRIPWKHRXWGRRUXQLW

ORFDWHGPORZHUWKDQWKHLQGRRUXQLWLQGRRUZHWEXOEWHPSHUDWXUHDW

㷄㩷

DQGRXWGRRUGU\EXOEWHPSHUDWXUH

㷄

1HWFRROLQJWRWDOFDSDFLW\
RI)')919'
2XWGRRUWHPS

㷄

,QGRRUWHPS

㷄

VKRZQLQWDEOH

$LJK
VKRZQLQWDEOH

3LSLQJOHQJWKP

(Gas pipe size is

VKRZQLQWDEOH

+HLJKWGLIIP
2XWGRRUXQLWEHORZ
VKRZQLQWDEOH

Содержание FDC100VNA

Страница 1: ... 3 phase use FDF100VSXVD 125VSXVD 140VSXVD MICRO INVERTER PACKAGED AIR CONDITIONERS Split system Air to air heat pump type Single phase use FDF140VNXPVD 3 phase use FDF140VSXPVD Single type Twin type FLOOR STANDING TYPE Single phase use FDF100VNVD 125VNVD 140VNVD 3 phase use FDF100VSVD 125VSVD 140VSVD Single phase use FDF140VNPVD 3 phase use FDF140VSPVD 200VSPVD 250VSPVD Single type Twin type ...

Страница 2: ...lation to air flow rate control fan speed 8 3 Correction of cooling and heating capacity in relation to one way length of refrigerant piping 8 4 Height difference between the indoor unit and outdoor unit 9 APPLICATION DATA 56 56 60 44 54 54 55 35 37 38 41 44 9 1 Installation of indoor unit 9 2 Electric wiring work instruction 9 3 Installation of outdoor unit 64 1 Model FDC71VNX 64 2 Models FDC100㨪...

Страница 3: ...unit 126 3 Troubleshooting at the indoor unit 123 5 Check of anomalous operation data with the remote controller 139 7 Inverter checker for diagnosis of inverter output 141 6 Power transistor module including the driver PCB inspection procedure 140 11 2 Troubleshooting flow 8 Outdoor unit controller failure diagnosis circuit diagram 142 How to read the model name FDF Floor standing type Example FD...

Страница 4: ...form Electric heater W 20 Crank case heater Remote controller RC E4 Installed wireless RCN KIT3 E option Room temperature control Thermostat by electronics Safety equipment Overload protection for fan motor Internal thermostat for fan motor Frost protection thermostat Abnormal discharge temperature protection Installation data Refrigerant piping size Connecting method Flare piping Flare piping Ref...

Страница 5: ...mote controller RC E4 Installed ᵍ wireless RCN KIT3 E option Room temperature control Thermostat by electronics Safety equipment Overload protection for fan motor Internal thermostat for fan motor Frost protection thermostat Abnormal discharge temperature protection Installation data Refrigerant piping size Connecting method Flare piping Flare piping Refrigerant line one way length Max 100m Vertic...

Страница 6: ...ess RCN KIT3 Eᴾ option Room temperature control Thermostat by electronics Safety equipment Overload protection for fan motor Internal thermostat for fan motor Frost protection thermostat Abnormal discharge temperature protection Installation data Refrigerant piping size Connecting method Flare piping Flare piping Refrigerant line one way length Vertical height difference between outdoor unit and i...

Страница 7: ...less RCN KIT3 E option Room temperature control Thermostat by electronics Safety equipment Overload protection for fan motor Internal thermostat for fan motor Frost protection thermostat Abnormal discharge temperature protection Installation data Refrigerant piping size Connecting method Flare piping Flare piping Refrigerant line one way length Vertical height difference between outdoor unit and i...

Страница 8: ...at Abnormal discharge temperature protection Installation data Refrigerant piping size Connecting method Flare piping Flare piping Refrigerant line one way length Vertical height difference between outdoor unit and indoor unit RefrigerantẅẅQuantity R410A 4 5kg Pre charged up to the piping length of 30m Outdoor unit Drain pump Drain Insulation for piping Necessary both Liquid Gas lines Standard Acc...

Страница 9: ...erload protection for fan motor Internal thermostat for fan motor Frost protection thermostat Abnormal discharge temperature protection Installation data Refrigerant piping size Connecting method Flare piping Flare piping Refrigerant line one way length Vertical height difference between outdoor unit and indoor unit RefrigerantẅẅQuantity R410A 4 5kg in outdoor unit incl the amount for the piping o...

Страница 10: ...n motor Internal thermostat for fan motor Frost protection thermostat Abnormal discharge temperature protection Installation data Refrigerant piping size Connecting method Flare piping Flare piping Refrigerant line one way length Vertical height difference between outdoor unit and indoor unit RefrigerantẅẅQuantity R410A 4 5kg in outdoor unit incl the amount for the piping of 30m Drain pump Drain I...

Страница 11: ...normal discharge temperature protection Installation data Refrigerant piping size Connecting method Flare piping Flare piping Refrigerant line one way length Vertical height difference between outdoor unit and indoor unit RefrigerantẅẅQuantity R410A 4 5kg in outdoor unit incl the amount for the piping of 30m Drain pump Drain Insulation for piping Necessary both Liquid Gas lines Standard Accessorie...

Страница 12: ...ength Vertical height difference between outdoor unit and indoor unit RefrigerantẅẅQuantity R410A 4 5kg Pre charged up to the piping length of 30m Outdoor unit Drain pump Drain Insulation for piping Necessary both Liquid Gas lines Standard Accessories Mounting kit Edging Notes 1 The data are measured at the following conditions 2 This packaged air conditioner is manufactured and tested in conformi...

Страница 13: ...nnecting method Flare piping Flare piping Refrigerant line one way length Vertical height difference between outdoor unit and indoor unit RefrigerantẅẅQuantity R410A 3 8kg in outdoor unit incl the amount for the piping of 30m Drain pump Drain Insulation for piping Necessary both Liquid Gas lines Standard Accessories Mounting kit Edging Notes 1 The data are measured at the following conditions 2 Th...

Страница 14: ...nt piping size Connecting method Flare piping Flare piping Refrigerant line one way length Vertical height difference between outdoor unit and indoor unit RefrigerantẅẅQuantity R410A 3 8kg in outdoor unit incl the amount for the piping of 30m Drain pump Drain Insulation for piping Necessary both Liquid Gas lines Standard Accessories Mounting kit Edging Notes 1 The data are measured at the followin...

Страница 15: ...e way length Vertical height difference between outdoor unit and indoor unit RefrigerantẅẅQuantity R410A 3 8kg in outdoor unit incl the amount for the piping of 30m Drain pump Drain Insulation for piping Necessary both Liquid Gas lines Standard Accessories Mounting kit Edging Notes 1 The data are measured at the following conditions 2 This packaged air conditioner is manufactured and tested in con...

Страница 16: ...nsulation for piping Necessary both Liquid Gas lines Standard Accessories Mounting kit Edging Notes 1 The data are measured at the following conditions 2 This packaged air conditioner is manufactured and tested in conformity with the ISO 3 Sound pressure level indicates the value in an anechoic chamber During operation ẅ these value are somewhat higher due to ambient temperature 4 The operation da...

Страница 17: ...between outdoor unit and indoor unit RefrigerantẅẅQuantity R410A 3 8kg in outdoor unit incl the amount for the piping of 30m Drain pump Drain Insulation for piping Necessary both Liquid Gas lines Standard Accessories Mounting kit Edging Notes 1 The data are measured at the following conditions 2 This packaged air conditioner is manufactured and tested in conformity with the ISO 3 Sound pressure le...

Страница 18: ...gerantẅẅQuantity R410A 3 8kg in outdoor unit incl the amount for the piping of 30m Drain pump Drain Insulation for piping Necessary both Liquid Gas lines Standard Accessories Mounting kit Edging Notes 1 The data are measured at the following conditions 2 This packaged air conditioner is manufactured and tested in conformity with the ISO 3 Sound pressure level indicates the value in an anechoic cha...

Страница 19: ...sulation for piping Necessary both Liquid Gas lines Standard Accessories Mounting kit Edging Notes 1 The data are measured at the following conditions 2 This packaged air conditioner is manufactured and tested in conformity with the ISO 3 Sound pressure level indicates the value in an anechoic chamber During operation ẅ these value are somewhat higher due to ambient temperature 4 The operation dat...

Страница 20: ...he following conditions 2 This packaged air conditioner is manufactured and tested in conformity with the ISO 3 Sound pressure level indicates the value in an anechoic chamber During operation ẅ these value are somewhat higher due to ambient temperature 4 The operation data indicates when the air conditioner is operated at 400V50Hz or 380V60Hz 5 Indoor unit specifications for one unit Capacity and...

Страница 21: ...the following conditions 2 This packaged air conditioner is manufactured and tested in conformity with the ISO 3 Sound pressure level indicates the value in an anechoic chamber During operation ẅ these value are somewhat higher due to ambient temperature 4 The operation data indicates when the air conditioner is operated at 400V50Hz or 380V60Hz 5 Indoor unit specifications for one unit Capacity an...

Страница 22: ...Internal thermostat for fan motor Frost protection thermostat Abnormal discharge temperature protection Installation data Refrigerant piping size Connecting method Flare piping Liquid Flare ᵍ Gas Brazing Refrigerant line one way length Vertical height difference between outdoor unit and indoor unit RefrigerantẅẅQuantity R410A 7 2kg Pre charged up to the piping length of 30m Outdoor unit Drain pump...

Страница 23: ...r rear piping 4 7 25 Slot Fresh air intake Both left and right Hole on wall for side piping M8 2 places φ100 Knock out φ100 Resin cap having φ20 VP20 Fall prevention metal fittings Metal fittings to fix to floor face Hole on wall for bottom piping Drain piping Liquid piping Gas piping H G F E D C B A C o n t e n t Symbol φ9 52 3 8 Flare φ15 88 5 8 Flare 143 82 15 622 5 15 17 5 35 25 50 or more or ...

Страница 24: ... is attached on the lower right corner of the front φ15 88 5 8 Flare Content C Pipe cable draw out hole D E Anchor bolt hole Drain discharge hole Symbol B A Service valve connection gas side M10 4places φ20 3places Minimum installation space L1 L3 L2 Intake Outlet Intake L2 L3 L4 L1 300 100 250 Open ＩＩＩ Open 250 100 500 ＩＩＩ 380 19 24 103 5 48 5 580 880 418 340 88 150 150 27 32 E A B C Terminal...

Страница 25: ...winds lay it in such a direction that the blower outlet faces perpendicularly to the dominant wind direction 4 Leave 1m or more space above the unit 5 A wall in front of the blower outlet must not exceed the units height 6 The model name label is attached on the lower right corner of the front panel 7 Connect the Service valve with local pipe by using the pipe of the attachment Gas side only Unit ...

Страница 26: ...that the blower outlet faces perpendicularly to the dominant wind direction 4 Leave 1m or more space above the unit 5 A wall in front of the blower outlet must not exceed the units height 6 The model name label is attached on the lower right corner of the front φ15 88 5 8 Flare Content C Pipe cable draw out hole D E Anchor bolt hole Drain discharge hole Symbol B A Service valve connection gas side...

Страница 27: ... 7 8 Brazing φ30 2places front φ45 side φ50 back Notes 1 It must not be surrounded by walls on the four sides 2 The unit must be fixed with anchor bolts An anchor bolt must not protrude more the 15mm 3 Where the unit is subject to strong winds lay it in such a direction that the blower outlet faces perpendicularly to the dominant wind direction 4 Leave 1m or more space above the unit 5 A wall in f...

Страница 28: ... the pipe of the attachment Gas side only 8 Mark shows the connecting posotion of the local pipe Gas side only φ19 05 3 4 Flare Content C Pipe cable draw out hole D E Anchor bolt hole Drain discharge hole Symbol B A Service valve connection of the M10 4 places φ20 3 places Service valve connection liq u id side φ12 7 1 2 Flare L2 L3 L4 L1 300 150 5 Open ＩＩＩ Open 5 150 500 ＩＩＩ Open 5 300 5 F Ca...

Страница 29: ...nput v olt free contact CNWR RD L RD Orange OR BR Brown BK Black Blue Color Marks BL Mark Color Red RD Y WH Yellow White GR Gray Y GN Yellow Green Mark Color Mark Color Notes 1 indicates wiring on site 2 See the wiring diagram of outside unit about the line between 3 Use twin core cable 0 3mm X2 at remote controller line See spec sheet of remote controller in case that the total length is more tha...

Страница 30: ...mp Heat exchanger temp Suction pipe temp 63H1 BK BK BL BL 20S CNS RD BR BR CNR WH CH CNA2 WH CNA1 WH BL RD BL RD C1 RD BL CNH PK CNI3 WH CNI1 WH CNG1 BK BL BL BK CNG2 BK CNI4 WH CNI2 WH MS 3 CM U U V W RD WH BK V W T27 T26 T30 T28 T29 IPM PWB2 INV CN01 WH T22 T21 T24 T25 L1 YE BK RD WH YE GN YE GN T4 T5 T6 F 20A RD WH T2 F6 5A T1 T8 T9 T10 T11 T13 1 3 WH RD F3 4A CNO2 WH N F PWB3 CNW WH PWB1 N L1 ...

Страница 31: ...able size mm 2 A Power cable length m indoor outdoor wire size x number Earth wire size mm 125 29 31 Ø1 6mm x 3 Ø1 6 The specifications shown in the above table are for units without heaters For units with heaters refer to the installation instructions or the construction instructions of the indoor unit Switchgear of Circuit breaker capacity which is calculated from MAX over current should be chos...

Страница 32: ...r current Power cable size mm 2 A Power cable length m indoor outdoor wire size x number Earth wire size 125 18 23 Ø1 6mm x 3 The specifications shown in the above table are for units without heaters For units with heaters refer to the installation instructions or the construction instructions of the indoor unit Switchgear of Circuit breaker capacity which is calculated from MAX over current shoul...

Страница 33: ...r will be in the operation when Trial operation can be performed by using SW3 3 4 in a very snowy country set this switch to ON the compressor is not runnning when the unit is used when outdoor temperature falls to 3 or lower and fan will run for 30 seconds in every 10 minutes When this switch is turned ON the outdoor unit turned ON in the area where outside temperature by turning ON this switch T...

Страница 34: ...g operation interval becomes shorter 100 Model Power cable indoor outdoor connecting wires MAX over current Power cable size mm 2 A Power cable length m indoor outdoor wire size x number mm 2 Earth wire size mm 2 125 15 3 5 27 Ø1 6mm x 3 Ø1 6mm 100 Model At the connection with the duct type indoor unit MAX over current Power cable size mm 2 A Power cable length m indoor outdoor wire size x number ...

Страница 35: ...3 is finished 4 SW3 4 is ON SW3 3 is ON Method of trial operation Be sure to turn OFF SW3 3 after the trial operation SW3 4 is OFF and heating trial operation when Cooling trial operation will be performed when Compressor will be in the operation when Trial operation can be performed by using SW3 3 4 in a very snowy country set this switch to ON the compressor is not runnning when the unit is used...

Страница 36: ... side 1m Height 1m 63 125 250 500 Mid Octave Band Frequency Hz Souud Pressure Level standard 2 10 5 Pa 1000 2000 4000 8000 20 30 40 50 60 70 20 30 40 50 60 70 N30 N40 N20 N50 N60 N70 Models FDC125VNX 125VSX Models FDC125VNX 125VSX Heating noise level 50 dB A 63 125 250 500 Mid Octave Band Frequency Hz Souud Pressure Level standard 2 10 5 Pa 1000 2000 4000 8000 20 30 40 50 60 70 20 30 40 50 60 70 N...

Страница 37: ...3 125 250 500 Mid Octave Band Frequency Hz Souud Pressure Level standard 2 10 5 Pa 1000 2000 4000 8000 20 30 40 50 60 70 20 30 40 50 60 70 N30 N40 N20 N50 N60 N70 N30 N40 N20 N50 N60 N70 N30 N40 N20 N50 N60 N70 N30 N40 N20 N50 N60 N70 N30 N40 N20 N50 N60 N70 N30 N40 N20 N50 N60 N70 N30 N40 N20 N50 N60 N70 b Micro inverter Models FDC100VN 100VS Noise level 49 dB A Models FDC125VN 125VS Models FDC12...

Страница 38: ...Air flow Hi Louver position Horizontal 2 Heating Air flow Hi Louver position Horizontal Indoor temperature RROLQJ Û Û HDWLQJ Û N ote 7KHVH JXUHV UHSUHVHQW WKH W SLFDO PDLQ UDQJH RI WHPSHUDWXUH DQG YHORFLW GLVWULEXWLRQ DW WKH FHQWHU RI DLU RXWOHW ZLWKLQ WKH SXEOLVKHG FRQGLWLRQV Q WKH DFWXDO LQVWDOODWLRQ WKH PD GLIIHU IURP WKH W SLFDO JXUHV XQGHU WKH LQÀXHQFH RI DLU WHPSHUDWXUH FRQGLWLRQV FHLOLQJ KH...

Страница 39: ...A Cooling cycle Heating cycle Thermistor ThO R1 Receiver Service valve Flare connecting Electronic expansion valve heating EEVH Electronic expansion valve cooling EEVC Heat exchanger High pressure switch 63H1 Lower pressure sensor LPT Strainer Strainer Strainer Sub cooling coil Strainer Service valve Flare connecting 4way valve Suction Muffler Discharge Compressor Check joint Check joint Check joi...

Страница 40: ... 88 ø15 88 Liquid line Models 200 250 Thermistor Return air ThI A Thermistor Heat exchanger ThI R3 Thermistor Heat exchanger ThI R2 Thermistor Heat exchanger ThI R1 Heat exchanger Indoor unit Indoor unit Flare connecting Flare connecting Gas branch pipe Liquid branch pipe ø9 52 Gas line ø15 88 Liquid line Outdoor unit Thermistor ThO S Thermistor ThO H Thermistor ThO D Thermistor ThO A Cooling cycl...

Страница 41: ...g ThI R Indoor unit 2 Û 21 Û Thermistor for frost prevention 2 Û 21 Û Thermistor for protection high pressure in cooling Tho R TH1 Outdoor unit 2 Û 21 Û Thermistor for detecting dis charge pipe temp Tho D TH3 Outdoor unit 2 Û 21 Û 2 Û 21 Û High pressure switch for protection 63H1 Outdoor unit 2 03D 21 03D Low pressure sensor for protection LPT Outdoor unit 2 03D 21 03D ...

Страница 42: ... Flammable gas may leak 2 Carbon fiber metal particles powder etc are floating 3 Cosmetic or special sprays are used frequently 4 Exposed to oil splashes or steam e g kitchen and machine plant 5 Exposed to sea breeze e g coastal area or calcium chloride e g snow melting agent 6 Exposed to ammonia substance e g organic fertilizer 7 Matters affecting devices such as sulfuric gas chlorine gas acid al...

Страница 43: ...of operable temperature range mentioned above and cooling capacity may not be established under certain conditions Precaution In case of severely low temperature condition 1 Install the outdoor unit at the place where strong wind cannot blow directly into the outdoor unit 2 If there is no installation place where can prevent strong wind from directly blowing into the outdoor unit mount the flex fl...

Страница 44: ...way pipe length Gas piping FDC200VS FDC250VS Gas piping FDC100 125 140VNX FDC100 125 140VSX FDC200VS Liquid piping L H L L1 L L2 70m L1 L2 L2 L1 70m 30m Dimensional limitations Models for outdoor unit s n o i t p i r c s e D Marks appearing in the drawing Difference of pipe length after first branching point L1 L2 FDC100 125 140VNX FDC100 125 140VSX One way pipe length after first branching point ...

Страница 45: ... 6 87 4 97 7 30 5 33 7 52 5 26 7 74 5 19 8 18 5 42 29 6 34 5 10 6 75 4 93 7 19 5 29 7 41 5 22 7 64 5 16 8 09 5 40 31 6 23 5 05 6 64 4 88 7 08 5 25 7 31 5 19 7 54 5 13 7 99 5 37 33 5 77 4 70 6 05 4 98 6 53 4 84 6 97 5 21 7 20 5 15 7 44 5 10 7 90 5 34 35 5 67 4 65 5 95 4 94 6 42 4 80 6 86 5 17 7 10 5 12 7 34 5 06 7 81 5 32 37 5 58 4 61 5 85 4 90 6 31 4 76 6 72 5 12 6 95 5 07 7 18 5 02 7 64 5 27 39 5...

Страница 46: ...B 21 CDB 23 CDB 26 CDB 27 CDB 28 CDB 31 CDB 33 CDB 12 CWB 14 CWB 16 CWB 18 CWB 19 CWB 20 CWB 22 CWB 24 CWB CDB TC SHC TC SHC TC SHC TC SHC TC SHC TC SHC TC SHC TC SHC 11 10 41 8 00 11 05 8 58 11 37 8 52 11 72 8 46 12 42 8 88 13 12 8 72 13 10 79 8 17 11 46 8 75 11 79 8 68 12 16 8 63 12 91 9 06 13 65 8 89 15 11 16 8 34 11 87 8 92 12 22 8 86 12 61 8 80 13 39 9 23 14 17 9 06 17 11 54 8 51 12 27 9 09 1...

Страница 47: ...r air temperature 18 CDB 21 CDB 23 CDB 26 CDB 27 CDB 28 CDB 31 CDB 33 CDB 12 CWB 14 CWB 16 CWB 18 CWB 19 CWB 20 CWB 22 CWB 24 CWB CDB TC SHC TC SHC TC SHC TC SHC TC SHC TC SHC TC SHC TC SHC 11 11 66 9 16 12 38 9 89 12 73 9 77 13 13 9 66 13 91 10 17 14 70 9 89 13 12 08 9 31 12 83 10 04 13 21 9 92 13 62 9 80 14 45 10 32 15 28 10 03 15 12 50 9 47 13 29 10 20 13 68 10 07 14 12 9 96 14 99 10 46 15 87 1...

Страница 48: ...3 70 9 23 14 49 9 62 29 11 05 8 80 11 88 8 66 12 70 9 27 13 10 9 21 13 51 9 15 14 31 9 56 31 10 95 8 75 11 71 8 59 12 49 9 18 12 90 9 13 13 31 9 07 14 13 9 49 33 10 26 8 22 10 73 8 64 11 53 8 50 12 29 9 10 12 70 9 05 13 11 8 99 13 94 9 42 35 9 71 7 93 10 39 8 48 11 36 8 43 12 08 9 01 12 50 8 97 12 92 8 92 13 76 9 36 37 9 60 7 88 10 22 8 40 11 15 8 33 11 86 8 92 12 26 8 87 12 67 8 82 13 47 9 25 39 ...

Страница 49: ...0 9 85 14 46 10 60 14 90 10 48 15 34 10 34 16 23 10 81 29 12 37 10 07 13 31 9 78 14 23 10 52 14 68 10 40 15 13 10 27 16 03 10 75 31 12 26 10 02 13 11 9 70 13 99 10 44 14 45 10 33 14 91 10 20 15 82 10 69 33 11 49 9 37 12 02 9 92 12 92 9 63 13 76 10 36 14 23 10 25 14 69 10 13 15 61 10 64 35 10 88 9 10 11 63 9 76 12 72 9 55 13 53 10 28 14 00 10 18 14 47 10 06 15 41 10 58 37 10 75 9 04 11 45 9 69 12 4...

Страница 50: ...97 7 92 1 0 2 8 27 8 22 8 18 8 13 8 08 1 0 0 8 44 8 39 8 34 8 29 8 24 2 0 1 8 52 8 47 8 42 8 37 8 32 3 0 2 9 08 9 03 8 98 8 94 8 90 5 0 4 10 21 10 15 10 09 10 08 10 07 7 0 6 11 33 11 27 11 20 11 22 11 23 9 0 8 11 78 11 71 11 64 11 62 11 59 11 5 10 12 23 12 16 12 09 12 02 11 94 13 5 12 12 91 12 83 12 75 12 65 12 60 15 5 14 13 59 13 50 13 42 13 29 13 26 16 5 16 13 93 13 84 13 75 13 61 13 59 Outdoor ...

Страница 51: ... 11 61 11 54 1 0 0 12 05 11 99 11 92 11 84 11 77 2 0 1 12 18 12 11 12 04 11 96 11 89 3 0 2 12 98 12 90 12 83 12 77 12 72 5 0 4 14 58 14 50 14 41 14 40 14 38 7 0 6 16 19 16 09 16 00 16 02 16 05 9 0 8 16 83 16 73 16 63 16 59 16 55 11 5 10 17 46 17 37 17 27 17 17 17 06 13 5 12 18 44 18 33 18 22 18 08 18 00 15 5 14 19 41 19 29 19 17 18 99 18 95 16 5 16 19 90 19 77 19 64 19 45 19 42 Outdoor air temp In...

Страница 52: ...2 8 18 8 13 8 08 1 0 0 8 44 8 39 8 34 8 29 8 24 2 0 1 8 52 8 47 8 42 8 37 8 32 3 0 2 9 08 9 03 8 98 8 94 8 90 5 0 4 10 21 10 15 10 09 10 08 10 07 7 0 6 11 33 11 27 11 20 11 22 11 23 9 0 8 11 78 11 71 11 64 11 62 11 59 11 5 10 12 23 12 16 12 09 12 02 11 94 13 5 12 12 91 12 83 12 75 12 65 12 60 15 5 14 13 59 13 50 13 42 13 29 13 26 16 5 16 13 93 13 84 13 75 13 61 13 59 Outdoor air temp Indoor air te...

Страница 53: ...11 75 11 68 11 61 11 54 1 0 0 12 05 11 99 11 92 11 84 11 77 2 0 1 12 18 12 11 12 04 11 96 11 89 3 0 2 12 98 12 90 12 83 12 77 12 72 5 0 4 14 58 14 50 14 41 14 40 14 38 7 0 6 16 19 16 09 16 00 16 02 16 05 9 0 8 16 83 16 73 16 63 16 59 16 55 11 5 10 17 46 17 37 17 27 17 17 17 06 13 5 12 18 44 18 33 18 22 18 08 18 00 15 5 14 19 41 19 29 19 17 18 99 18 95 16 5 16 19 90 19 77 19 64 19 45 19 42 Outdoor ...

Страница 54: ...or air temp Indoor air temperature 18 CDB 21 CDB 23 CDB 26 CDB 27 CDB 28 CDB 31 CDB 33 CDB 12 CWB 14 CWB 16 CWB 18 CWB 19 CWB 20 CWB 22 CWB 24 CWB CDB TC SHC TC SHC TC SHC TC SHC TC SHC TC SHC TC SHC TC SHC 11 21 71 16 40 23 02 17 54 23 67 17 40 24 38 17 28 25 79 18 10 27 21 17 76 13 22 38 16 70 23 74 17 84 24 42 17 70 25 16 17 58 26 63 18 40 28 11 18 05 15 23 04 17 00 24 46 18 14 25 17 18 01 25 9...

Страница 55: ...WDOO WKH SLSLQJ VR WKDW WKH SLSLQJ OHQJWK LV ZLWKLQ P RI WKH OLPLW OHQJWK DFWXDO OHQJWK IRU WKH UHVSHFWLYH W SHV 2 Models 200 250 TXLYDOHQW HQJWK FWXDO HQJWK TXLYDOHQW EHQG OHQJWK QXPEHU RI EHQGV LQ WKH SLSLQJ TXLYDOHQW OHQJWK SHU EHQG Gas Pipe Diameter mm Equivalent Bend Length 㱢㱢㱢㱢㱢㱢 Fan speed Coefficient Lo 0H 3 L RU i 55 40 45 50 30 35 15 20 25 1 1 1 1 1 7 5 10 1 1 1 1 1 1 Equivalent pipi...

Страница 56: ...RU XQLW LV ORFDWHG DERYH LQGRRU XQits in KHDWLQJ PRGH WKH FRUUHFWLRQ FRHIILFLHQW PHQWLRQHG LQ WKH EHORZ WDEOH VKRXOG EH VXEWUDFWHG IURP WKH YDOXH LQ WKH DERYH WDEOH Height difference between the indoor unit and outdoor unit in the vertical height difference 8 4 Height difference between the indoor unit and outdoor unit GMXVWPHQW FRHIILFLHQt DPSOH 7KH QHW FRROLQJ FDSDFLW RI WKH PRGHO 919 ZLWK WKH D...

Страница 57: ...akage circuit breaker is provided if could cause a ﬁre or electric shock ٨ Use the circuit breaker of correct capacity Circuit breaker should be the one that disconnect all poles under over current Using the incorrect one could cause the system failure and ﬁre ٨ Do not use any materials other than a fuse of correct capacity where a fuse should be used Connecting the circuit by wire or copper wire ...

Страница 58: ...e unit with the L ﬁttings Fixing position L fitting 622 5 17 5 35 15 2 φ8 Fixing position Fall prevention fitting Since the unit is tall secure the unit no sooner than setting it in place Pipes wires and small parts Accessory 1 Open the air inlet grill and Nos 1 will be found in the unit 2 Nos 2 2 4 will be found at the same place as 1 3 Fall prevention ﬁtting is mounting on the top panel of the u...

Страница 59: ...s ٨ Make sure to loosen the flare nut by holding the flared male fitting with a spanner and giving torque to the nut with another spanner in order to avoid unexpected stress to the copper pipe and then remove them ٨ When fastening the flare nut align the refrigeration pipe with the center of flare nut screw the nut for 3 4 times by hand and then tighten it with a spanner within the specified torqu...

Страница 60: ...illustrated at left Remove the cover and make connections WARNING CAUTION Drain socket Procedure Control box position and power cable connection Control box Control box Clamp for fixing Grounding line Power cable Clam For guide Terminal block for signal wire Terminal block for power cable Clamp For fixing Do not insert the drain pipe directly in the drain ditch where toxic gases such as sulffuric ...

Страница 61: ...wiring specification Factory setting Master Refer to the installation manual attached to the outdoor unit PCB SW SW5 1 OFF OFF OFF ON ON ON ON OFF SW5 2 㩷㽲㽳㽴㽲㽳㽴㩷㩷㩷㩷㩷㩷㩷㽲㽳㽴㩷㽲㽳㽴㩷㪣㩷㩷㪥 Remote controller Remote controller Remote controller controller line Power source line Indoor Outdoor Power source Circuit breaker Indoor Unit Indoor Unit Master Slave 1 Slave 2 Slave 3 㽲㽳㽴㩷㽲㽳㽴㩷㪣㪈㩷㪣㪉㩷㪣㪊㩷㩷㪥 ...

Страница 62: ...o 86ûF Lower limit setting valid except heating automatic cooling fan dry Possible to set in the range of 18 to 26ûC 62 to 79ûF When you set upper and lower limit by this function control as below 1 When TEMP RANGE SET remote controller function of function setting mode is INDN CHANGE factory setting During heating you cannot set the value exceeding the upper limit During operation mode except hea...

Страница 63: ...n for two hours After heating is stopped or heating thermostat is off the fan perform extra operation for six hours During heating is stopped or heating thermostat is off the fan perform intermittent operation for ﬁve minutes after twenty minutes off with low airﬂow During heating is stopped or heating thermostat is off the fan perform intermittent operation for ﬁve minutes after ﬁve minutes off w...

Страница 64: ... controller sensor interrupted Outdoor unit checking outdoor circuit board LED checking red checking green normal Content Display on remote controller LED on indoor circuit board Error Code of indoor unit ԝFunction of CNT connector of indoor printed circuit board ٨CNT connector local vendor model Connector Made by molex ޓ 5264 06 Terminals Made by molex ޓ 5263T ٨Function Output 1 Output 2 Output 3...

Страница 65: ...e service valves for liquid line and gas line until completed refrigerant piping work air tightness test and evacuation If the compressor is operated in state of opening service valves before completed connection of refrigerant piping work you may incur frost bite or injury from an abrupt refrigerant outﬂow and air can be sucked into refrigerant circuit which can cause burst or personal injury due...

Страница 66: ...leakage breaker is not installed it can cause ﬁre or electric shocks Do not use any materials other than a fuse with the correct rating in the location where fuses are to be used Connecting the circuit with copper wire or other metal thread can cause unit failure and ﬁre Do not install the unit near the location where leakage of combustible gases can occur If leaked gases accumulate around the uni...

Страница 67: ...it will not be affected by heat radiation from other heat source 〇 A place where snow will not accumulate 〇 A place where the unit can be kept away 5m or more from TV set and or radio receiver in order to avoid any radio or TV interference 〇 A place where good air circulation can be secured and enough service space can be secured for maintenance and service of the unit safely 〇 A place where the u...

Страница 68: ...ve tape so that water or foreign matters may not enter the piping Bend a pipe to a radius as large as practical R100 R150 Do not bend a pipe repeatedly to correct its form Flare connection is used between the unit and refrigerant pipe Flare a pipe after engaging a ﬂare nut onto it Flare dimensions for R410A are different from those for conventional R407C Although we recommend the use of ﬂaring too...

Страница 69: ...POEFOTBUJPO NQSPQFS IFBU JOTVMBUJPO BOUJ EFX ESFTTJOH DBO SFTVMU JO B XBUFS MFBL PS ESJQQJOH DBVTJOH EBNBHF UP IPVTFIPME FGGFDUT FUD 6TF B IFBU JOTVMBUJOH NBUFSJBM UIBU DBO XJUITUBOE PS B IJHIFS UFNQFSBUVSF 1PPS IFBU JOTVMBUJOH DBQBDJUZ DBO DBVTF IFBU JOTVMBUJPO QSPCMFNT PS DBCMF EFUFSJPSBUJPO MM HBT QJQFT NVTU CF TFDVSFMZ IFBU JOTVMBUFE JO PSEFS UP QSFWFOU EBNBHF GSPN ESJQQJOH XBUFS UIBU DPNFT GS...

Страница 70: ... DPEF EFTJHOBUJPO GPS TVQQMZ DPSET PG QBSUT PG BQQMJBODFT GPS PVUEPPS VTF SPVOE UIF VOJU P OPU DPOOFDU UIF HSPVOEJOH XJSF UP B HBT QJQF XBUFS QJQF MJHIUOJOH SPE PS UFMFQIPOF HSPVOEJOH XJSF G JNQSPQFSZ HSPVOEFE BO FMFDUSJD TIPDL PS NBMGVODUJPO NBZ SFTVMU HSPVOEJOH XJSF NVTU CF DPOOFDUFE CFGPSF DPOOFDUJOH UIF QPXFS DBCMF 1SPWJEF B HSPVOEJOH XJSF MPOHFS UIBO UIF QPXFS DBCMF 5IF JOTUBMMBUJPO PG BO JNQ...

Страница 71: ...FE JO UIF JOTUBMMBUJPO NBOVBM UFNT UP DIFDLCFGPSF B UFTU SVO PPMJOH PQFSBUJPO FBUJOH PQFSBUJPO 4VDUJPO QSFTTVSF PX QSFTTVSF JTDIBSHF QSFTTVSF JHI QSFTTVSF IFDL KPJOU PG UIF QJQF IBSHF QPSU PG UIF HBT PQFSBUJPO WBMWF 4FUUJOH 48 48 1MFBTF SFNPWF B TFSWJDF QBOFM FGSPTU DPOUSPM TXJUDIJOH 48 8IFO UIJT TXJUDI JT UVSOFE 0 UIF VOJU XJMM SVO JO UIF EFGSPTU NPEF NPSF GSFRVFOUMZ 4FU UIJT TXJUDI UP 0 XIFO JOT...

Страница 72: ...GBO BOE SVO UIF VOJU GPS NJOVUFT GPS B DPPMJOH PQFSBUJPO SFUVSOJOH MJRVJE MPTF UIF MJRVJE TJEF PQFSBUJPO WBMWF PG UIF PVUEPPS VOJU BOE QVNQ EPXO SFGSJHFSBOU SFDPWFSZ MPX XJUI OJUSPHFO HBT G EJTDPMPSFE SFGSJHFSBUJPO PJM PS BOZ GPSFJHO NBUUFST JT EJTDIBSHFE CZ UIF CMPX XBTI UIF QJQF TZTUFN PS JOTUBMM B OFX QJQF TZTUFN PS UIF GMBSF OVU EP OPU VTF UIF PME POF CVU VTF UIF POF TVQQMJFE XJUI UIF PVUEPPS ...

Страница 73: ...e refrigerant Only use prescribed optional parts The installation must be carried out by the qualified installer If you install the system by yourself it can cause serious trouble such as water leaks electric shocks ﬁre Do not perform any change of protective device itself or its setup condition The forced operation by short circuiting protective device of pressure switch and temperature controlle...

Страница 74: ...unit is positioned lower 140VN 140VS 140VNX 140VSX Twin type Triple type 140VNX 140VSX 140VN 140VS 140VNX 140VSX 100VNX 125VNX 100VSX 125VSX 100VN 125VN 100VS 125VS 50m 100m 140VN 140VS 140VNX 140VSX 100VNX 125VNX 100VSX 125VSX H L H L L1 L2 L3 La L1 1 L L L L La L1 L2 L3 L L1 L2 L3 L La L1 L2 L3 L2 L3 L La L2 L1 La L3 1 La L2 La L3 1 L1 L2 L3 h1 h2 h3 H h1 h2 h3 L1 L2 L2 L3 L3 L1 L L1 L2 L1 L2 L1...

Страница 75: ...orm grounding system installation work with the power cord unplugged Power cable indoor outdoor connecting wires Model 100V 140V M4 Screw Do not connect to the grounding wire from another unit but install a dedicated wire up to the grounding wire from the distribution board Fasten cables and protect the terminal connection from external force It is attached on the back side of the service panel As...

Страница 76: ... Usability 1 1 Maximum one way pipe length 50 50 25 25 Length covered without additional charge 30 30 15 15 100VN 100VS 125VN 125VS 0 06kg m 0 08kg m 140VN 140VS NO Are the existing units our products Check whether an existing pipe system is reusable or not by using the following ﬂow chart NO NO NO Is the existing pipe system to reuse free of corrosion ﬂaws or dents Repair the damaged parts Remove...

Страница 77: ...g winds Unsuitable installation locations can cause the unit to fall and cause material damage and personal injury The electrical installation must be carried out by the qualified electrician in accordance with the norm for electrical work and national wiring regulation and the system must be connected to the dedicated circuit Power supply with insufﬁcient capacity and incorrect function done by i...

Страница 78: ...n anchor bolt on the front side must be kept within 15 mm Securely install the unit so that it does not fall over during earthquakes or strong winds etc Refer to the left illustrations for information regarding concrete foundations Install the unit in a level area With a gradient of 5 mm or less Improper installation can result in a compressor failure broken piping within the unit and abnormal noi...

Страница 79: ...ching pipe set Refrigerant piping branch pipe La L1 Refrigerant piping branch pipe La Lb Refrigerant piping branch pipe L2 L3 Indoor unit connected Refrigerant piping branch pipe L1 L2 L3 L4 In the case of asingle type In the case of atwin type In the case of a triple type A In the case of a triple type B In the case of a W twin type DIS WB1 DIS TB1 DIS WB1 DIS WB1 DIS WB1 DIS WB1 DIS WB1 DIS WA1 ...

Страница 80: ...Ǿ19 05 or larger pipes because O type pipes do not meet the pressure resistance requirement Pipe diameter mm Minimum pipe wall thickness mm Pipe material 6 35 0 8 O type pipe 9 52 0 8 O type pipe 12 7 0 8 O type pipe 15 88 1 0 O type pipe 22 22 1 0 1 2H type pipe 25 4 1 0 1 2H type pipe 28 58 1 0 1 2H type pipe NOTE Phosphorus deoxidized seamless copper pipe C1220T JIS H3300 Select pipes having a ...

Страница 81: ... 80 80 11 PAC T 160 ...

Страница 82: ... 81 81 11 PAC T 160 ...

Страница 83: ... 82 82 11 PAC T 160 ...

Страница 84: ...irection 4 Elbow 1 or 0 Procured in the field Not required for downward direction ٨ Be sure to use pipes of 1 2H material and wall thickness above 1mm Pressure resistance of O type pipe is not enough ٨ Switch ON SW5 1 on the control PCB if O type pipe must be used and bent with the bender During heating operation the high pressure protection may be actuated under the condition lower than the norma...

Страница 85: ...red in the field Braze the field pipe here Construction example Forward Accessory pipe A Straight pipe Ԙ Procured in the field 185 235mm Straight pipe ԙ Procured in the field above 125mm Elbow procured in the field Braze the field pipe here Construction example Rightward Accessory pipe A Straight pipe Ԙ Procured in the field 185 235mm Straight pipe ԙ Procured in the field above 405mm Elbow procure...

Страница 86: ...ions Outdoor unit model Indoor unit model 3HP 1 5HP 1 5HP 4HP 1 5HP 2 5HP 2HP 2HP 5HP 2 5HP 2 5HP 6HP 3HP 3HP 2HP 3HP 2HP 4HP 8HP 4HP 4HP 3HP 5HP 10HP 5HP 5HP 6HP 2HP 2HP 2HP Part lists Branching pipe set for a liquid pipe Branching pipe set for a gas pipe Different diameter pipe joint Heat insulation material ID9 52 ID9 52 ID9 52 ID9 52 ID9 52 ID15 88 ID15 88 ID15 88 ID9 52 ID9 52 ID15 88 ID12 7 ...

Страница 87: ...e Gas branching pipe ID9 52 Connecting pipe φ9 52 Flare joint φ6 35 Flare joint φ6 35 Joint A Joint A CAUTION Reference Connecting pipe φ9 52 ID9 52 ID9 52 Flare joint φ6 35 Joint A Joint B ID15 88 ID12 7 ID15 88 CAUTION Reference Joint B ID15 88 ID12 7 ID12 7 Joint B 2HP 2HP 2HP a DIS WA1 6HP b 3HP 3HP 3HP a DIS WB1 8HP b DIS WA1 ID9 52 ID9 52 ID9 52 ID25 4 ID15 88 ID15 88 ID15 88 ID15 88 ID15 88...

Страница 88: ...n is pressed Invalid Operation is displayed but it does not mean a failure Cover AIR CON No button Display the indoor unit number connected to this remote controller CHECK button This button is used at servicing TEST button This button is used during test operation Weekly timer display Displays the settings of the weekly timer Operation setting display area Displays setting temperature airflow vol...

Страница 89: ...ate of stop is memorized Although the timer mode is cancelled at the recovery from power failure the setting of weekly timer is changed to the holiday setting for all weekdays Operation mode LUÀRZ YROXPH PRGH Room temperature setting Louver auto swing stop However the stop position 4 position is cancelled so that it returns to Position 1 Remote controller function items which have been set with th...

Страница 90: ...functional items during cooling heating Cooling Heating Dehumidify Fan Operation Functional item Thermostat ON Thermostat ON Thermostat OFF Thermostat OFF Hot start Defrost Compressor 4 way valve Outdoor unit fan Indoor unit fan Louver motor Drain pump 3 2 2 Thermostat ON Thermostat OFF 2 2 Note 1 Operation Stop Turned ON OFF by the control other than the room temperature control 2 ON during the d...

Страница 91: ... Power ON This is not displayed under the Remote mode 2 If this display is not shown under the Center Remote mode check if the indoor unit power switch is turned on or not f Hot start Cold draft prevention at heating At the startup of heating operation at resetting of the thermostat during defrost operation and at returning to heating the indoor fan is controlled by the indoor heat exchanger tempe...

Страница 92: ...t is selected the fan is operated with the indoor unit fan tap at ULo 3 If Set fan speed is selected the fan is operated with the set fan speed even if the thermostat is turned OFF 4 If Intermittent is selected following controls take place a The indoor unit on which the thermostat is turned OFF during heating operation changes to the hot control and if the heat exchanger temperature sensors both ...

Страница 93: ... switch or by when the thermister turned OFF the change of operation mode If the thermostat is turned OFF during the forced operation control of heating compressor the louver position with the auto swing is returned to the level position Note 1 The compressor stops when it has entered the protective control k Indoor heat exchanger anti frost Frost protection 1 Forced compressor OFF 1 If the indoor...

Страница 94: ... invalid of fan control can be selected with the frost protection control of the wired remote controller indoor function l Heating overload protection 1 If the indoor heat exchanger temperature detected with ThI R2 R2 at 63 C or higher is detected for 2 seconds the heating overload protection control starts and is released if temperatures at 56 C or lower are detected 2 First detection of heating ...

Страница 95: ...to the remote controller a Center or each remote controller basis heating preparation the youngest unit No among the operating units in the remote mode or the center mode unless the remote mode is available is displayed b Inspection display filter sign Any of unit that starts initially is displayed c Confirmation of connected units Pressing AIR CON No button on the remote controller displays the i...

Страница 96: ...tion Unit stops 1 Only the LEVEL INPUT is acceptable for external input however when the indoor function setting of Level input Factory default or Pulse input is selected by the function for External input of the wired remote controller operation status will be changed as follows In case of Level input setting In case of Pulse input setting Unit operation from the wired remote controller becomes a...

Страница 97: ... Remote operation input connector CnT 6 is provided on the indoor control PCB However remote operation by CnT 6 is not effective when Center mode is selected by center controller In case of plural unit twin triple double twin remote operation input to CnT 6 on the slave indoor unit is invalid Only the LEVEL INPUT is acceptable for external input however when the indoor function setting of Level in...

Страница 98: ...nit 䇭 slave Indoor unit 䇭 slave Indoor unit 䇭 slave Cn External input Ⓝ Individual operation Factory default All units operation Local setting CnT 6 ON OFF ON OFF Only the unit directly connected to the remote controller can be operated Only the unit directly connected to the remote controller can be stopped opeartion All units in one remote controller system can be operated All units in one remot...

Страница 99: ...ver has the upper limit of 30 C Compressor Compressor Standard Operation Stop Setting temperature 1 1 Room temperature deg Operation Stop Setting temperature 2 4 Room temperature deg When it is set at 3 C t Return air temperature compensation This is the function to compensate the deviation between the detection temperature by the return air temperature thermistor and the measured temperature afte...

Страница 100: ...60 80 85 70 80 Outdoor air temperature is 10 C or higher 90 105 110 100 120 6 Selection of max required frequency by heat exchanger temperature 1 Maximum required frequency is selected according to the outdoor unit heat exchanger temperature Tho R during cooling dehumidifying or according to the indoor unit heat exchanger temperature ThI R during heating mode 2 When there are 3 indoor unit heat ex...

Страница 101: ...frequency operation control is performed during cooling dehumidifying Control contents Starts with the compressor s target frequency at A rps When the outdoor air temperature Tho A is 35 C or higher it starts at C rps At 30 seconds after the compressor start the compressor s target frequency is changed to B rps and the compressor s operation frequency is fixed for 10 minutes Model Operation mode A...

Страница 102: ...7 zone 46 48 zone Outdoor unit heat exchanger temp C 20 30 zone 33 40 zone 43 53 zone 3 Fan tap control during heating operation Fan taps are selected depending on the outdoor unit heat exchanger temperature Tho R1 R2 and the outdoor air temperature Tho A Note 1 It is detected by Tho R1 or R2 whichever the lower Model 100 140 Model 200 250 zone zone zone zone zone zone zone Tap 3 Tap 3 Tap 4 zone ...

Страница 103: ...ency B rps Power transistor radiator fin temperature C C c Control contents i Raises the outdoor unit fan tap by 1 tap ii When the sampling is for 60 minutes and the value of power transistor radiator fin temperature Tho P is as follows When the power transistor radiator fin temperature Tho P C C the outdoor unit fan tap is raised by 1 speed further When C C power transistor radiator fin temperatu...

Страница 104: ...sor and the outdoor air temperature is as shown by the lower figure LPT detection Outdoor air temp C 2 4 LPT invalid b Defrosting conditions B i When previous defrosting end condition is the time out of defrosting operation and it is in the heating operation after the cumulative compressor operation time after the end of defrosting has become 30 minutes ii After 5 minutes from the start of compres...

Страница 105: ...ompressor stops ii When it is detected 2 times within 60 minutes or after continuous 60 minutes including the stop of compressor E36 is displayed on the remote controller and it enters the anomalous stop mode Compressor stop Compressor operation Discharge pipe temperature C 85 90 115 135 Note 1 Value in are for the model 200 250 c Reset of anomalous stop mode As it drops to the reset value of 85 C...

Страница 106: ... control i When a value detected by the low pressure sensor LPT satisfies any of the following conditions the compressor stops to run for its protection When the low pressure drops to 0 079MPa or under for 15 seconds continuously At 10 minutes after the start of compressor the suction overheat becomes 30 C and the low pressure becomes 0 15MPa or under for 60 seconds continuously ii E49 is displaye...

Страница 107: ...current value in the power transistor exceeds the setting value the compressor stops b If the current value in the power transistor exceeds the specified value and the compressor stops 4 times within 30 minutes E42 is displayed on the remote controller and it enters the anomalous stop mode 10 Anomalous inverter PCB If the power transistor detects any anomaly for 15 minutes including the stop of co...

Страница 108: ...ing and for 3 minutes after the end of defrosting it is not detected Outdoor unit heat exchanger thermistor 50 C or lower Outdoor air temperature thermistor 45 or lower Low pressure sensor 0V or under or 3 49V or over b Discharge pipe temperature thermistor suction pipe temperature thermistor and underneath temperature thermistor model 200 250 only If the following is detected for 5 second continu...

Страница 109: ...er supply is turned OFF 1 Control contents a Close the operation valve at the liquid side It is left open at the gas side b Compressor is started with the target speed frequency at 55 rps in the cooling mode c Red and green lamps LED flash continuously on the outdoor unit control PCB d Each of protection and error detection controls excluding the low pressure control anti frost control and dewing ...

Страница 110: ...3ºC or lower In the heating mode When the compressor is turned ON 2 Base heater OFF conditions When either one of following conditions is met the base heater is turned OFF Outdoor air temperature detected with Tho A is 5ºC or higher When the compressor stop has been detected for 30 minutes continuously In the cooling or dehumidifying mode Base heater ON Base heater OFF Outdoor air temperature ºC T...

Страница 111: ...ature in heating mode Maximum required frequency is selected according to the outdoor air temperature Tho A Unit rps Model 71 100 125 140 Max required frequency Outdoor air temperature is 18 C or higher 76 75 80 85 Outdoor air temperature is 10 C or higher 100 100 100 100 Outdoor air temperature is 5 C or higher 100 f Selection of max required frequency by heat exchanger temperature 1 Maximum requ...

Страница 112: ...of following start patterns according to the operation mode and the outdoor air temperature Tho A 1 Low frequency operation control during cooling dehumidifying Control condition Upon establishing the conditions of compressor protection start III the low frequency operation control is performed during cooling dehumidifying Control contents a Starts with the compressor s target frequency at A rps W...

Страница 113: ...ne Outdoor unit heat exchanger temp C 20 30 zone 33 40 zone 43 53 zone c Fan tap control during heating operation Fan taps are selected depending on the outdoor unit heat exchanger temperature Tho R1 R2 and the outdoor air temperature Tho A Note 1 It is detected by Tho R1 or R2 whichever the lower zone zone zone zone Tap 3 Tap 3 Tap 4 zone Tap 3 Tap 4 5 Tap 5 zone Tap 4 Tap 5 Tap 6 Note 1 Value in...

Страница 114: ...equency B rps c Power transistor radiator fin temperature C C 3 Control contents a Raises the outdoor unit fan tap by 1 tap b When the sampling is for 60 minutes and the value of power transistor radiator fin temperature Tho P is as follows When the power transistor radiator fin temperature Tho P C C the outdoor unit fan tap is raised by 1 speed further When C C power transistor radiator fin tempe...

Страница 115: ...1 2 Defrosting conditions B a When previous defrosting end condition is the time out of defrosting operation and it is in the heating operation after the cumulative compressor operation time after the end of defrosting has become 30 minutes b After 5 minutes from the start of compressor c After 5 minutes from the start of outdoor unit fan b Defrosting end conditions When any of the following condi...

Страница 116: ... with Tho D exceeds the setting value the compressor stops b When it is detected 2 times within 60 minutes or after continuous 60 minutes including the stop of compressor E36 is displayed on the remote controller and it enters the anomalous stop mode Compressor stop Compressor operation Discharge pipe temperature C 85 115 3 Reset of anomalous stop mode As it drops to the reset value of 85 C or low...

Страница 117: ...top control a When a value detected by the low pressure sensor LPT satisfies any of the following conditions the compressor stops to run for its protection When the low pressure drops to 0 079MPa or under for 15 seconds continuously At 10 minutes after the start of compressor the suction overheat becomes 30 C and the low pressure becomes 0 15MPa or under for 60 seconds continuously b E49 is displa...

Страница 118: ...e anomalous stop mode j Anomalous inverter PCB If the power transistor detects any anomaly for 15 minutes including the stop of compressor E51 is displayed on the remote controller and it enters the anomalous stop mode k Anti frost control by the compressor frequency control 1 If the indoor unit heat exchanger temperature detected with ThI R exceeds the setting value at 4 minutes after the start o...

Страница 119: ...e compressor ON the compressor stops After a delay of 3 minutes it restarts but if the same is detected repeatedly 3 times within 40 minutes the compressor stops with the anomalous stop Note 1 During defrosting and for 3 minutes after the end of defrosting it is not detected Outdoor unit heat exchanger thermistor 50 C or lower Outdoor air temperature thermistor 45 or lower Low pressure sensor 0V o...

Страница 120: ...3ºC or lower In the heating mode When the compressor is turned ON 2 Base heater OFF conditions When either one of following conditions is met the base heater is turned OFF Outdoor air temperature detected with Tho A is 5ºC or higher When the compressor stop has been detected for 30 minutes continuously In the cooling or dehumidifying mode Base heater ON Base heater OFF Outdoor air temperature ºC T...

Страница 121: ...F Keeps flashing Indoor heat exchanger tempera ture thermistor Defective indoor heat exchanger temperature thermistor defective element bro ken wire short circuit Poor contact of temperature thermistor connector Replacement repair of temperature thermistor 165 Indoor control PCB Defective indoor control PCB Defective temperature thermistor input circuit Replacement of PCB 1 time flash Keeps flashi...

Страница 122: ...PCB Anomalous inverter PCB communication Replacement of PCB Stays OFF Keeps flashing 1 time flash Keeps flashing 7 times flash Inverter PCB activefilter Defective outdoor inverter PCB Model FDC 71 Defective active filter of control Replacement 185 Stays OFF Keeps flashing 1 time flash Keeps flashing Keeps flashing Outdoor fan motor Anomalous outdoor fan motor Replacement repair 186 Outdoor control...

Страница 123: ...utes after initial detection of this anomalous temperature Indoor heat exchanger temperature thermistor anomaly 50 C or lower is detected for 5 seconds continuously within 60 minutes after initial detection of this anomalous temperature Or 70 C or higher is detected for 5 seconds continuously Outdoor Outdoor air temperature thermistor anomaly 45 C or lower is detected for 5 seconds continuously 3 ...

Страница 124: ...lows Details of respective inspection method will be described on later pages Trouble Confirmation of power supply Indoor outdoor unit Confirmation of remote controller and LEDs on the PCB of indoor unit and outdoor unit Indoor outdoor unit remote controller Check of the anomalous operation data on the remote controller Inspection of the unit controller Replacement repair of faulty part test run a...

Страница 125: ... 124 11 PAC T 160 4GRNCEG VJG 2 TGHGT VQ PGZV RCIG SAFETY PRECAUTIONS Part number b INSTRUCTION OF HOW TO REPLACE INDOOR UNIT POWER PCB PSB012D953C B ...

Страница 126: ...nvalid Normal See table 2 Model selection As per model See table 1 Remarks Address No setting at plural indoor units control by 1 R C 0 F Switches Description Default setting Master Slave setting Master Slave Table 1 Indoor unit model selection with SW6 1 SW6 4 0 OFF 1 ON 71VD 100VD 125VD 140VD 1 1 0 1 0 1 0 0 0 0 1 1 1 1 1 1 SW6 4 SW6 1 SW6 2 SW6 3 Table 2 Indoor unit Master Slave setting with SW...

Страница 127: ...YROWDJH KDV EHHQ GLVFKDUJHG VXI FLHQWO E PHDVXULQJ WKH YROWDJH EHWZHHQ ERWK WHUPLQDOV RI HOHFWURO WLF FDSDFLWRU Measurment of voltage may be disturbed by the moisture proof coating In such case remove the coating and measure it by taking care of avoiding electrical shock a Module of part to be replaced for outdoor unit controller Outdoor control PCB Inverter PCB Temperature thermistor of outdoor h...

Страница 128: ...NFAN CNEEV2 CNPS CNA2 1 Model FDC71VNX a Replace the PCB after elapsing 3 minutes from power OFF Be sure to measure voltage DC between T26 and T27 on inverter PCB and check that the voltage is discharged sufficiently 10V or less Refer to Fig 1 b Disconnect the connectors from the control PCB c Match the switches setting SW4 with the former PCB d Connect the connectors to the control PCB Confirm th...

Страница 129: ...1 on the PCB before replacing the PCB e Match the setting switches SW3 5 JSW SW J5 7 with the former PCB f Tighten up a screw after passing white or blue wiring through CT1 of the changed g Please connect the connectors with the same place Confirm the connectors are not half inserted PCA012D024F H after elapsing 3 minutes from power OFF 㩷 connectors are not half inserted Parts Arrangement View CNA...

Страница 130: ...ewhitewiringpassingthroughCT1onthePCBbeforereplacingthePCB d Matchthesettingswitches SW3 5 JSW withtheformerPCB e TightenupascrewafterpassingwhitewiringthroughCT1ofthechanged I RQQHFW WKH FRQQHFWRUV WR WKH FRQWURO 3 RQ UP WKH connectors are not half inserted after elapsing 3 minutes from power OFF connectors are not half inserted Parts No Parts arrangement view CNA2 CNIP CNTH CNPS CNI1 CNI3 CNA1 C...

Страница 131: ...singthroughCT1onthePCBbeforereplacingthePCB d Matchthesettingswitches SW3 5 JSW withtheformerPCB e TightenupascrewafterpassingwhitewiringthroughCT1ofthechanged I RQQHFW WKH FRQQHFWRUV WR WKH FRQWURO 3 RQ UP WKH connectors are not half inserted after elapsing 3 minutes from power OFF connectors are not half inserted Parts No Parts arrangement view CNA2 CNIP CNTH CNPS CNI1 CNI3 CNA1 CNFAN1 CNEEV2 CN...

Страница 132: ...he connectors from the control PCB c Disconnect the blue wiring passing through CT1 on the substrate before replacing the PCB d Match the setting switches SW3 5 JSW with the former PCB e Tighten up a screw after passing blue wiring through CT1 of the changed f Connect the connectors to the control PCB Confirm the connectors are not half inserted Parts No Parts Arrangement View Fig 1 Position of ca...

Страница 133: ...harged sufficiently 10V or less Refer to Fig 1 b Take off the connection of inverter PCB terminal and connector and remove the screw of power transistor IC10 active filter IC2 and diode stack DS1 then remove the PCB Wipe off the silicon grease neatly on the controller s radiation heat fins Refer to Fig 1 and Parts arrangement view c Refer to table1 for the setting of switch JSW10 11 of new PCB d B...

Страница 134: ...SSO XQLIRUPO D EXQGOHG RI VLOLFRQ JUHDVH UVW RQ WKH surfaceofpowertransistor Mak esureitisappliedtoprev entdamageonpowertransistor e Tightenthescrewofpowertransistoroninv erterPCBandconnecttheterminalblock Confirmtheconnection anddon tusesolderingintheconnection Tightenproperly thepowertransistorwithascrewandmak esurethere isnoslack Powertransistorcanbedamageifnotproperly tighten Recommendedpowert...

Страница 135: ... SW5 3 OFF SW5 4 OFF J5 With J7 With Default setting Outdoor fan control when ducting Normal Hi tap Valid Normal Valid Invalid Keep OFF Keep OFF Keep OFF Keep OFF Keep OFF Keep OFF Reserved Overseas See table 1 Model selection 3 phase Single phase As per model Model selection Domestic Overseas Normal Test run mode Cooling Heating Cooling Test run SW Normal Test run Normal Snow protection control N...

Страница 136: ...SSO XQLIRUPO D EXQGOHG RI VLOLFRQ JUHDVH UVW RQ WKH surfaceofpowertransistor Mak esureitisappliedtoprev entdamageonpowertransistor H 7LJKWHQ WKH VFUHZ RI SRZHU WUDQVLVWRU RQ LQYHUWHU 3 DQG FRQQHFW WKH WHUPLQDO EORFN RQ UP WKH FRQQHFWLRQ DQG don tusesolderingintheconnection Tightenproperly thepowertransistorwithascrewandmak esurethereisno clearancegap Powertransistorcanbedamageifnotproperly tighten...

Страница 137: ... QHZ 3 SSO XQLIRUPO D EXQGOHG RI VLOLFRQ JUHDVH UVW RQ WKH surfaceofpowertransistor Mak esureitisappliedtoprev entdamageonpowertransistor H 7LJKWHQ WKH VFUHZ RI SRZHU WUDQVLVWRU RQ LQYHUWHU 3 DQG FRQQHFW WKH WHUPLQDO EORFN RQ UP WKH FRQQHFWLRQ DQG don tusesolderingintheconnection Tightenproperly thepowertransistorwithascrewandmak esurethereisno clearancegap Powertransistorcanbedamageifnotproperly ...

Страница 138: ... of replace the PCB c Make set switch SW1 2 as shown in Table 1 d Connect the terminal of terminal block and the connector to the inverter PCB Remove the short bar form the PCB before the replacement Connect it with P2 P3 pins of PCB after the replacement Connector CNR Terminal block TB2 Parts Arrangement View the inverter PCB Parts No R S T Noise filter substrate SW1 2 Fig 1 The front of control ...

Страница 139: ...ormal As per model See table 1 Switches Description Remarks Pump down operation Antifrost control Reserved Reserved Reserved Reserved Reserved 3 phase OFF Single phase ON Table 1 Outdoor unit model selection with JSW1 1 JSW1 4 and SW4 1 SW4 2 0 OFF 1 ON 100VN 100VS 125VN 125VS 140VN 140VS 200VS 250VS JSW1 1 0 0 1 1 0 0 1 0 JSW1 2 0 0 0 0 1 1 1 0 JSW1 3 0 0 0 0 0 0 0 1 JSW1 4 0 0 0 0 0 0 0 0 SW4 1 ...

Страница 140: ...ssure protection control P104 䋨䌦䋩 2 a 䋬P 105䋬䋨䌦䋩 3 a 5 High pressure anomaly P104 䋨䌦䋩 2 b 6 Low pressure protection control P105 䋨䌦䋩 5 a 䇭 7 Low pressure anomaly P105 䋨䌦䋩 5 b 8 Anti frost prevention control P106 䋨䌦䋩 11 9 Current cut P106 䋨䌦䋩 7 10 Power transistor protection control P106 䋨䌦䋩 8 11 Power transistor anomaly Overheat P106 䋨䌦䋩 9 12 Compression ratio control P105 䋨䌦䋩 6 13 Spare 14 Dewing...

Страница 141: ... PowertransistorNterminal U Endofredharnesstocompressor V Endofwhiteharnesstocompressor W Endofblack orblueharnesstocompressor Check forapowertransistorshortcircuit Wheny oudonothav eadiagnosticcheck erforj udgingiftheinv erter isdefectiv e measurebetweentheterminalsofthepowertransistor parts j udgewhetherthepowertransistorisdefectiv eornot Disconnectthecompressor thenmeasurewiththecontroller inco...

Страница 142: ...Turnoffthebreak er 2 Remov etheterminalcov erofcompressoranddisconnectthewires U V W fromcompressor 3 ConnectthewiresU Red V White andW Black ofcheck ertotheterminalofdisconnectedwires U V W fromcompressorrespectiv ely b Operationforj udgment 1 PowerONafterJSW10 4onoutdoorinv erterPCBwasturnedON 2 After15secondssincepowerhasturnedON L EDstartON OFFfor5secondscy clically anditrepeats10 times 3 Chec...

Страница 143: ...ms with the mark when the power is ON LED1 Green LED2 Red Power supply check Measure the power supply at L N It is normal if it is AC 220 240V Noise filter check There should be continuity There should be no shorts between phase Must be conductive When fuse is blown replace it or check wiring LED2 Red check 1 5 time flash Refer to page 121 No anomaly like breakage swell etc allowed Voltage between...

Страница 144: ... LPT CNTH CNB CNIP CNW CNW2 CNE CNH CNR CNS CNEEV1 CNEEV2 CNFAN1 CNA1 CNI3 CNI1 18V 15V FMO1 M M M SM2 SM1 20S CNF OPTION DH CH1 THo R2 THo P THo A THo S THo D THo R1 Power supply check Measure the power supply L1 N It is normal if it is AC220 240V Noise filter check There should be continuity There should be no shorts between phases DC Reactor continuity Check Max 25mǡ Capacitor check Check for a...

Страница 145: ... R1 CNW CNW2 CNE CNH CNR CNS DH CNF OPTION CNEEV1 CNEEV2 CNI2 CNW1 CNO1 CNE Power supply check Measure the power supply L1 L2 L3 It is normal if it is AC380 415V FDC100 125 140VSX ٨ Outdoor unit check points Check items with the mark when the power is ON Noise filter check There should be continuity There should be no shorts between phases Resistance check Resistance is measured 15ǡ DC Reactor con...

Страница 146: ...CNW2 2 2 CNE CNH CNR CNS CNEEV1 CNEEV2 CNFAN1 CNA1 CNI3 CNI1 18V 15V FMO1 SM2 SM1 20S CH1 THo R2 THo IPM THo A THo S THo D THo R1 Power supply check Measure the power supply L1 N It is normal if it is AC220 240V Noise filter check There should be continuity There should be no shorts between phases DC Reactor continuity Check Max 25mǡ Capacitor check Check for anomaly in appearance such as damage s...

Страница 147: ...ply check Measure the power supply L1 L2 L3 It is normal if it is AC380 415V FDC100 125 140VS ٨ Outdoor unit check points Check items with the mark when the power is ON Noise filter check There should be continuity There should be no shorts between phases Resistance check Resistance is measured 15ǡ DC Reactor contiuity check 55mǡ or less Capacitor check Check for anomaly in appearance such as dama...

Страница 148: ...it check points Cheek items with the mark when the power is ON LED2 Red LED1 Green LED2 Red LED1 Green F1 250V 3A Power supply check Measure the power supply L1 L2 L3 It is normal if it is AC380 415V Noise filter check There should be continuity There should be no shorts between phases Resistance check Resistance is measured 15ǡ DC Reactor contiuity check 55mǡ or less Capacitor check Check for ano...

Страница 149: ...ntrolling with one remote controller 168 E14 Communication error between master and slave indoor units 169 E16 Indoor fan motor anomaly 170 E19 Indoor unit operation check 171 E20 Indoor fan motor rotation speed anomaly 172 E28 Remote controller temperature thermistor anomaly 173 E35 Cooling overload operation 174 E36 Discharge pipe temperature error 175 E37 Outdoor heat exchanger temperature ther...

Страница 150: ...NO NO Is the compressor operating NO YES NO Note 1 Outdoor 35 C Indoor 27 C 1 WAIT It is normal This unit is designed to start in the soft start mode by detecting the under dome temperature of compressor when it restart after power reset It is necessary to replace to higher capacity one or to install additional unit Compressor refrigerant oil protection control at starting is activated For the con...

Страница 151: ...r operating NO YES NO Note 1 Outdoor 7 C Indoor 20 C 1 WAIT It is normal This unit is designed to start in the soft start mode by detecting the under dome temperature of compressor when it restart after power reset It is necessary to replace to higher capacity one or to install additional unit Compressor refrigerant oil protection control at starting is activated For the contents of control refer ...

Страница 152: ...igerant migrated in the compressor When the earth breaker is activated at lower insulation resistance check the following points 6 hours after power ON check if the insulation resistance recovers to normal When power ON crankcase heater heat up compressor and evaporate the refrigerant migrated in the compressor Check if the earth leakage breaker is conformed to higher harmonic regulation or not Si...

Страница 153: ... and etc E LQJ SLSHV RQ WKH ZDOO or wrapping rubber cushion around the pipe which goes through the hole in the wall or applying other appropriate means Strength of ceiling ZDOO ÀRRU HWF PD EH LQVXI FLHQW 5HYLHZ WKH installing position or reinforce it Check for leaning of installed unit or anomalous mounting of fan louver or motor and specify the contacting point and correct it When the heat exchan...

Страница 154: ...uring cooling or defrosting in the heating mode It is normal The noise vibration occurs when the refrigerant starts RU VWRSV ÀRZLQJ W LV normal When the defrosting starts or stops during heating WKH UHIULJHUDQW ÀRZ LV reversed due to switching 4 way valve This causes a large change in pressure which produces a blowing sound It may accompany also the hissing sounds as mentioned above They are norma...

Страница 155: ...nt vacuum dry and recharge refrigerant Since there could be many causes of noise vibration the above do not cover all In such case check the conditions when where how the noise vibration occurs according to following check point Indoor outdoor unit Cooling heating fan mode Startup stop during operation Operating condition Indoor outdoor temperatures pressure Time it occurred Operation data retaine...

Страница 156: ... isAC220 240V for 1 phase unit detected between 1 and 2 on the terminal block of outdoor unit YES YES YES YES Is JX1 open Defective outdoor control 3 1RLVH OWHU Misconnection or breakage of connecting wires Defective indoor control or power PCB ª Replace Replace FM LM etc Replace fuse Defective indoor power PCB ª Replace Open JX1 Defective indoor control PCB ª Replace 2 Error detection method 3 Co...

Страница 157: ...ntroller wires NO Is DC15V or higher detected between X Y of indoor unit terminal block YES YES YES YES NO NO NO Correct Replace wires Replace remote controller Defective indoor power PCBªReplace Defective indoor control PCBªReplace 2 Error detection method 3 Condition of Error displayed 4 Presumable cause Remote controller wire breakage short circuit Defective remote controller Malfunction by noi...

Страница 158: ... NO YES YES NO NO NO NO NO YES YES YES Set one remote controller for Master and the other for Slave Set SW1 on remote controller PCB at Master Set address again SW2 on indoor control PCB Separate remote controller wires from high voltage wires Defective indoor control PCBªReplace Defective remote controller ªChange 2 Error detection method Communication between indoor unit and remote controller is...

Страница 159: ...4 Presumable cause Improper setting Surrounding environment Defective remote controller communication circuit Faulty indoor control or power PCB Faulty outdoor control PCB Note If any error is detected 30 minutes after displaying WAIT on the remote controller the display changes to INSPECT I U NO NO NO NO NO Are more than 3 units of remote controller connected Does remote controller display Slave ...

Страница 160: ...nit terminal block Is approx DC20V detected between on the indoor unit terminal block WAIT Defective indoor control PCBªReplace Defective indoor control PCBª Replace Defective remote controllerªReplace Broken remote controller wire Yª Replace Correct connection wires between indoor and outdoor units Defective outdoor control PCBªReplace Defective connection wire Broken Noise Defective indoor contr...

Страница 161: ... outdoor control PCB blown NO YES Is DC5V detected on the outdoor control PCB Between of CNI1 NO YES Is DC5V detected if the connector of outdoor unit fan motor is disconnected NO Model 71 140 Is DC255 310V detected at CNA2 Model 200 250 Is 220 240 detected at CNW2 1 Note 2 Value in are for the model 200 250 2 Normal Malfunction by noise 5HSODFH QRLVH OWHU Check connection of diode stack and elect...

Страница 162: ... NO Replace the power supply fuse YES Isn t there a short circuit between phases of the noise filter Isn t there a short circuit between phases of inverter PCB input terminals Isn t there any crack burning on the power transistor module Is the reactor OK Is the electrolytic capacitor OK Note 1 For model 200 250 replace also the power transistor module 2 Error detection method 3 Condition of Error ...

Страница 163: ...er wires if the remote controller is removed Are wires connected properly between the indoor outdoor units NO Defective remote controller Defective remote controller Defective connecting wire Defective remote controller wire Short circuit etc Defective indoor control PCBªReplace 2 Error detection method 3 Condition of Error displayed 4 Presumable cause Faulty indoor control PCB Defective remote co...

Страница 164: ...ral environment Defective indoor control PCB ª Replace Defective remote controller ª Replace 2 Error detection method When normal communication between the remote controller and the indoor unit is interrupted for more than 2 minutes Detectable only with the remote controller 3 Condition of Error displayed Same as above 4 Presumable cause Defective communication circuit between remote controller in...

Страница 165: ...se that the outdoor unit red LED flashes 2 times Repair signal wires Repair signal wires To the diagnosis of WAIT Unit is normal Malfunction by temporary noise etc Defective outdoor control PCB Defective network communication circuit ª Replace Unit is normal Malfunction by temporary noise etc 2 Error detection method When normal communication between indoor and outdoor unit is interrupted for more...

Страница 166: ...trol PCB ª Replace Defective indoor unit heat exchanger temperature thermistor input circuit 2 Error detection method Anomalously low temperature or high temperature resistance is detected on the indoor heat exchanger thermistor ThI R1 R2 or R3 3 Condition of Error displayed When the temperature thermistor detects 50 C or lower for 5 seconds continuously the compressor stops After 3 minutes delay ...

Страница 167: ...e Defective indoor control PCB ª Replace Defective return air temperature thermistor input circuit 2 Error detection method Anomalously low temperature or high temperature resistance is detected by indoor return air temperature thermistor Thi A 3 Condition of Error displayed When the temperature thermistor detects 50 C or lower for 5 seconds continuously the compressor stops After 3 minute delay t...

Страница 168: ...see the error display E6 YES NO YES NO Error stop Reset Indoor heat exchanger temperature C 56 63 Wash Defective indoor heat exchanger temperature thermistor connectorª Correct Defective indoor heat exchanger temperature thermistor Check refrigerant system Adjust 2 Error detection method Indoor heat exchanger temperature thermistor ThI R1 R2 R3 3 Condition of Error displayed When it is detected 5 ...

Страница 169: ... 17 indoor units connected to one remote controller NO YES Defective remote controller ª Replace Reduce to 16 or less units 2 Error detection method When it detects more than 17 of indoor units connected to one remote contorller 3 Condition of Error displayed Same as above 4 Presumable cause Excessive number of indoor units connected Defective remote controller Note Error code Remote controller L ...

Страница 170: ...ower supply Note 1 Set dip switches SW5 1 and SW5 2 as shown in the following table Factory default setting Master Master Slave a Slave b Slave c SW5 1 OFF OFF ON SW5 2 OFF ON OFF ON ON Dip switch Indoor unit YES NO NO YES Correct unit address setting Correct wiring Defective indoor control PCB Replace Malfunction by noise Check surrounding environment 2 Error detection method When communication e...

Страница 171: ... persists after replacing the fan motor replace the indoor control PCB Malfunction by temporary noise 2 Error detection method Detected by rotation speed of indoor fan motor 3 Condition of Error displayed When actual rotation speed of indoor fan motor drops to lower than 200rpm for 30 seconds continuously the compressor and the indoor fan motor stop After 2 seconds it starts again automatically bu...

Страница 172: ...ve SW7 ªReplace Turn SW7 1 on the indoor control PCB OFF and reset the power 2 Error detection method After indoor operation check when the communication between indoor and outdoor unit is established and SW7 1 is still kept ON 3 Condition of Error displayed Same as above 4 Presumable cause Mistake in SW7 1 setting Due to forgetting to turn OFF SW7 1 after indoor operation check Note Error code Re...

Страница 173: ...an motor If the anomaly persists after replacing the fan motor replace the indoor control PCB Malfunction by temporary noise 2 Error detection method Detected by rotation speed of indoor fan motor 3 Condition of error displayed When the actual fan rotation speed does not reach to the speed of required speed ņ USP DIWHU PLQXWHV KDYH been elapsed since the fan motor rotation speed command was output...

Страница 174: ... Faulty connection of remote controller temperature thermistor Defective remote controller temperature thermistor Defective remote controller PCB Note After 10 seconds has passed since remote controller thermistor was switched from valid to invalid E28 will not be displayed even if the thermistor harness is disconnected At same time the thermistor which is effective is switched from remote control...

Страница 175: ...r temperature thermistor Check unit side Isn t the air circulation of outdoor unit short circuited Are installation spaces adequate Isn t there any fouling or clogging on heat exchanger Control operation check Defective outdoor control PCBªReplace Excessive refrigerant amount Recharge refrigerant by weighing proper amount on a scale 2 Error detection method For the error detection method refer to ...

Страница 176: ...nt on a scale Control operation check Defective outdoor control PCBªReplace Check unit side Isn t filter clogged Are adequate indoor outdoor unit installation spaces Isn t there any short circuit of air Isn t there any fouling clogging on indoor heat exchanger 2 Error detection method For the error detection method refer to the protective control by controlling compressor rotation speed and coolin...

Страница 177: ...ve outdoor control PCBªReplace Defective outdoor heat exchanger temperature thermistor input circuit 2 Error detection method Detection of anomalously low temperature resistance on the outdoor heat exchanger temperature thermistor 3 Condition of Error displayed When the temperature thermistor detects 50 C or lower for 20 seconds continuously within 2 minutes to 2 minutes 20 seconds after the compr...

Страница 178: ...l PCBªReplace Defective outdoor air temperature thermistor input circuit 2 Error detection method Detection of anomalously low temperature resistance on outdoor air temperature thermistor 3 Condition of Error displayed When the temperature thermistor detects 45 C or lower for 5 seconds continuously within 2 minutes to 2 minutes 20 seconds after the compressor ON the compressor stops After 3 minute...

Страница 179: ...e characteristics Temperature thermistor resistance k Temperature C Broken wire Shot circuit Correct connector Defective discharge pipe temperature thermistorª Replace Defective outdoor control PCBªReplace Defective temperature thermistor input circuit 2 Error detection method Detection of anomalously low temperature resistance on the discharge pipe temperature thermistor 3 Condition of Error disp...

Страница 180: ...on OK YES YES If the power supply breaker is turned OFF and ON too quickly E40 may be displayed This is normal NO YES If any anomaly exists on the electronic expansion valve connector connection the power supply must be reset NO Open service valve Correct 63H1 connector Correct electronic expansion valve connector Defective outdoor control PCBªReplace Defective 63H1 input circuit 2 Error detection...

Страница 181: ... When less than 14VDC of the output voltage is detected between and on CNI3 E41 is displayed See Note mentioned below When less than 14VDC of the output voltage is detected between and on CNI3 E41 is displayed See Note mentioned below Inverter PCB anomaly Outdoor fan motor anomaly Control PCB anomaly Noise filter PCB anomaly Note 2 How to check the voltage between and of CNI3 㹢See E51 㩷 Is DC15V d...

Страница 182: ...sistor temperture thermistor anomaly Inadequate installation space of outdoor unit Is it possible to reset the error for 10 minuted after compressor stopped Can error be reset NO NO YES Is the installation space of outdoor unit enough Is the outdoor fan running Replace inverter PCB Are the characteristics of power transitor temperature thermistor OK Is the fixing of power transistor to radiator fi...

Страница 183: ...4 or more at 20 C Models FDC200 250 NO NO NO Check power supply Open the valves Check refrigerant amount and refregerant circuit In case of transitional increase of high pressure and or test run several times restarting may recover it because liquid refrigerant migrated in the compresser is discharged from the compressor Replace compressor 2 Error detection method In order to prevent from overcurr...

Страница 184: ...rom previous page YES FDC71 250 Defective inverter PCBª Replace For model 200 250 replace also the power transistor module FDC71 250 Defective inverter PCBª Replace For model 200 250 replace also the power transistor module 2 Error detection method In order to prevent from overcurrent of inverter if the current exceeds the VSHFL FDWLRQV LW PDNHV WKH compressor stopping 3 Condition of Error display...

Страница 185: ... between inverter PCB and outdoor control PCB Outdoor control PCB anomaly Outdoor fan motor anomaly YES NO NO YES Are both switches of JSW10 11 SW1 2 on the inverter PCB set correctly NO YES Is the connection of connectors between the inverter PCB and the outdoor control PCB OK NO YES Is the communication wire between the inverter PCB and the outdoor control PCBconnectedproperly Replace the outdoo...

Страница 186: ...detection method In order to prevent from overcurrent of A F if the current H FHHGV WKH VSHFL FDWLRQV LW makes the compressor stopping 3 Condition of error displayed If the output current of A F H FHHGV WKH VSHFL FDWLRQV it makes the compressor stopping 4 Presumable cause Defective inverter PCB Note Error code Remote controller LED Green Red Outdoor control PCB Outdoor Inverter PCB 1 time flash Ke...

Страница 187: ... motor 3 Condition of Error displayed When actual rotation speed of outdoor fan motor FMo1 drops to 100min 1 or lower for 30 minutes continuously the compressor and the outdoor fan motor stop After 3 minutes delay it starts again automatically but if this anomaly occurs 5 times within 60 minutes after the initial detection 4 Presumable cause Defective outdoor control PCB Foreign material at rotati...

Страница 188: ...ontrol PCBªReplace Replace low pressure sensor 2 Error detection method Detected by low pressure drop and suction superheat 3 Condition of Error displayed When the low pressure sensor detects 0 079MPa or lower for 15 seconds continuously compressor stops and it restarts automatically after 3 minutes delay And if this anomaly occurs 3 times within 60 minutes 10 minutes after the compressor starts i...

Страница 189: ...ssure sensor and suction pipe temprerature thermister connector OK NO YES NO YES Are the characteristics of low pressure sensor suction pipe temperature thermistor OK Is the low pressure normal during operation Continued from previous page Open fully Correct Defective low pressure sensor suction pipe temperature thermistorª Replace Charge refrigerant Defective outdoor control PCBªReplace Defective...

Страница 190: ...PCB 1 time flash Keeps flashing Yellow or Red LED Green Indoor control PCB Stays OFF Keeps flashing Keeps flashing Content 6 times flash or 2 times flash Inverter and fan motor anomaly Outdoor fan motor anomaly Inverter PCB anomaly Outdoor control PCB anomaly Note 2 How to check the voltage between and of CNI3 For FDC71 㧦 15V 㧦 G ND For FDC100 140 and FDC200 250 Model FDC71 140VN Model FDC100 140V...

Страница 191: ...tdoor control PCBªReplace Defective suction pipe temperature thermistor input circuit 2 Error detection method When the suction pipe temperature thermistor detects anomalously low temperature 3 Condition of Error displayed If the temperature thermistor detects 50 C or lower for 5 seconds continuously within 10 minutes to 10 minutes 20 seconds after compressor ON the compressor stops When the compr...

Страница 192: ...Is refrigerant amount charged properly Is there any anomaly on the refrigeration circuit Defective outdoor control PCBªReplace Defective low pressure sensor input circuit OK 2 Error detection method When anomalous voltage pressure is detected 3 Condition of Error displayed If the pressure sensor detects 0V or lower and 3 49V or higher for 5 seconds continuously within 2 minutes to 2 minutes 20 sec...

Страница 193: ...on of underneath temperature thermistor connector Defective underneath temperature thermistorª Replace Replace outdoor control PCB Defective underneath temperature thermistor input circuit 2 Error detection method When anoumalous low temperature resistance is detected by the underneath temperature thermistor 3 Condition of Error displayed If the temperature thermistor detcts 50 C or lower for 5 se...

Страница 194: ... Error detection method Judge insufficient refrigerant amount by detecting the temperature differnce between indoor heat exchanger ThI R and indoor return air ThI A It detects at initial startup in cooling or dehumidifying mode after power ON In case of model 71 it cannot detect 3 Condition of Error displayed KHQ WKH LQVXI FLHQW UHIULJHUDQW amount is detected 3 times within 30 minutes In case of M...

Страница 195: ...rant oil in compressor can be evaporated KHFN ZKHWKHU WKH HOHFWULF OHDNDJH EUHDNHU FRQIRUPV WR KLJK KDUPRQLF VSHFL FDWLRQV As INV PAC units has inverter in order to prevent from improper operation be sure to use the breaker of high harmonic type Error code Remote controller L ED G reen Red Outdoor control PCB Outdoor inverter PCB 1 time flash Keeps flashing Yellow or Red L ED G reen Indoor control...

Страница 196: ...ime flash Keeps flashing Yellow or Red L ED G reen Indoor control PCB Stays OFF Keeps flashing Keeps flashing Content Stays off or 4 times flash Compressor startup failure 2 2 Is it model 200 or 250 Is the power transistor module OK YES From previous page Try to restart several times Does it start Note Several times restarting may recover it because liquid refrigerant migrated in the compressor co...

Страница 197: ...detection operation the compressor stops When it is restart automatically after 3 minutes it is detected 4 times within 15 minutes 4 Presumable cause Defective outdoor fan motor Defective outdoor control PCB Defective inverter PCB Anomalous power supply voltage Improper refrigerant amount and refrigerant circuit Defective compressor motor bearing Note Insulation resistance The unit is left for lon...

Страница 198: ...pening Installation hole Installation hole ԘPut through the wiring from the back side to the hole of the lower case ԙFit the lower case into the ceiling opening Make sure that the clearance between the convex part of the back of the lower case and the ceiling opening must be as equal as possible on both sides ԚUsing the two installation holes shown above fix the lower case onto the ceiling with th...

Страница 199: ... conditioner series set the indoor unit address with SW2 on the indoor unit PCB from 0 to F so as not to duplicate ԚFor VRF series set the indoor unit address with SW1 SW2 and SW5 2 on the indoor unit PCB from 000 to 127 so as not to duplicate KIT Restrictions on the thickness and length of wire Maximun total extension 600m Within 100m x 0 3 mm2 Within 200m x 0 5 mm2 Within 300m x 0 75mm2 Within 4...

Страница 200: ...㪦㫇㪼㫉㪸㫋㫀㫆㫅㪆㪠㫅㫊㫇㪼㪺㫋㫀㫆㫅㩷㫃㪸㫄㫇㪛㫌㫉㫀㫅㪾㩷㫆㫇㪼㫉㪸㫋㫀㫆㫅㪑㩷㪞㫉㪼㪼㫅㪽㪸㫀㫃㫌㫉㪼㪑㩷㪩㪼㪻㩷㪩㪼㫄㫆㫋㪼㩷㪺㫆㫅㫋㫉㫆㫃㫃㪼㫉㩷㫊㪼㫅㫊㫆㫉㪦㪥㪆㪦㪝㪝㩷㪹㫌㫋㫋㫆㫅㪙㫌㫋㫋㫆㫅㩷㫋㫆㩷㫊㫋㪸㫉㫋㪆㫊㫋㫆㫇㩷㫋㪿㪼㩷㪸㫀㫉㩷㪺㫆㫅㪻㫀㫋㫀㫆㫅㪼㫉㪝㪘㪥㩷㪪㪧㪜㪜㪛㩷㪹㫌㫋㫋㫆㫅㪙㫌㫋㫋㫆㫅㩷㫋㫆㩷㫊㪼㫋㩷㫋㪿㪼㩷㪽㪸㫅㩷㫊㫇㪼㪼㪻㩷㪘㪠㪩㩷㪚㪦㪥㩷㪥㫆㪅㩷㪹㫌㫋㫋㫆㫅㪠㫅㪻㫀㪺㪸㫋㪼㫊㩷㫋㪿㪼㩷㪥㫆㪅㩷㫆㪽㩷㪸㫀㫉㩷㪺㫆㫅㪻㫀㫋㫀㫆㫅㪼㫉㩷㫎㪿㫀㪺㪿㩷㫀㫊㩷㪺㫆㫅㫅㪼㪺㫋㪼㪻㪅㪤㪦㪛㪜㩷㪹㫌㫋㫋㫆㫅㪬㫊㪼㩷㫋㫆㩷㫊㪼㫃㪼㪺㫋㩷㫋㪿㪼㩷㫄㫆㪻㪼㪅㪫㪜㪤㪧㩷㪹㫌㫋㫋㫆㫅㪬㫊㪼㩷㫋㫆㩷㫉㪸㫀㫊㪼㩷㫋㪿㪼㩷㫊㪼㫋㫋㫀㫅㪾㩷㫋㪼㫄㫇㪼㫉㪸㫋㫌㫉㪼㪅㪫㪜㪤㪧㩷㪹㫌㫋㫋㫆㫅㪬㫊㪼㩷㫋㫆㩷㫃㫆㫎㪼㫉㩷㫋㪿㪼㩷㫊㪼㫋㫋㫀㫅㪾㩷㫋㪼㫄㫇㪼㫉㪸㫋㫌㫉...

Страница 201: ...㫃㫃㪼㫉㩷㫊㪿㫆㫌㫃㪻㩷㫌㫊㪼㩷㪇㪅㪊㫄㫄㪉㩷㩷㪉㩷㪺㫆㫉㪼㩷㫎㫀㫉㪼㫊㩷㫆㫉㩷㪺㪸㪹㫃㪼㫊㪅㩷㩿㫆㫅㪄㫊㫀㫋㪼㩷㪺㫆㫅㪽㫀㪾㫌㫉㪸㫋㫀㫆㫅㪀㩷㩿㪉㪀㩷㪤㪸㫏㫀㫄㫌㫄㩷㫇㫉㫆㫃㫆㫅㪾㪸㫋㫀㫆㫅㩷㫆㪽㩷㫉㪼㫄㫆㫋㪼㩷㪺㫆㫅㫋㫉㫆㫃㫃㪼㫉㩷㫎㫀㫉㫀㫅㪾㩷㫀㫊㩷㪍㪇㪇㫄㪅㩷㩷㩷㩷㩷㪠㪽㩷㫋㪿㪼㩷㫇㫉㫆㫃㫆㫅㪾㪸㫋㫀㫆㫅㩷㫀㫊㩷㫆㫍㪼㫉㩷㪈㪇㪇㫄㪃㩷㪺㪿㪸㫅㪾㪼㩷㫋㫆㩷㫋㪿㪼㩷㫊㫀㫑㪼㩷㪹㪼㫃㫆㫎㪅㩷㩷㩷㩷㩷㪙㫌㫋㪃㩷㫋㪿㪼㩷㫎㫀㫉㫀㫅㪾㩷㫀㫅㩷㫋㪿㪼㩷㫉㪼㫄㫆㫋㪼㩷㪺㫆㫅㫋㫉㫆㫃㫃㪼㫉㩷㪺㪸㫊㪼㩷㫊㪿㫆㫌㫃㪻㩷㪹㪼㩷㪇㪅㪊㫄㫄㪉㩷㩿㫉㪼㪺㫆㫄㫄㪼㫅㪻㪼㪻㪀㩷㫋㫆㩷㪇㪅㪌㫄㫄㪉㪅㩷㩷㩷㩷㩷㪚㪿㪸㫅㪾㪼㩷㫋㪿㪼㩷㫎㫀㫉㪼㩷㫊㫀㫑㪼㩷㫆㫌㫋㫊㫀㪻㪼㩷㫆㪽㩷㫋㪿㪼㩷㪺㪸㫊㪼㩷㪸㪺㪺㫆㫉㪻㫀㫅㪾㩷㫋㫆㩷㫎㫀㫉㪼㩷㪺㫆㫅㫅㪼㪺㫋㫀㫅㪾㪅㩷㪮㪸㫋㪼㫉㫇㫉㫆㫆㪽㩷㫋㫉㪼㪸㫋㫄㪼㫅㫋㩷㫀㫊㩷㩷㩷...

Страница 202: ...ormer state so as not to crimp the remote controller cord and secure with the removed screw In case of exposing cord Make certain to remove a screw on the bottom surface of the remote controller Remove the upper case of the remote controller Insert a flat blade screwdriver to a concave portion of the bottom surface of the remote control and slightly twist it and the case is removed The remote cont...

Страница 203: ...hod for return air temperature Return air temperature can be confirmed by the remote controller operation Press AIR CON NO button for over 5 seconds 88 blinks on the temperature setting indicator 88 blinks for approximately 2 seconds while data is read Then the return air temperature is displayed Example return air temperature 27 C blinking Note For the return air temperature in the normal case th...

Страница 204: ...ed offset temperature at 2 0 C 07 Remote controller thermistor 3 0 C At the time of heating in the case of remote controller thermistor enabled offset temperature at 3 0 C 05 Ventilation setting 01 No ventilator connection 02 Ventilator links air conditioner In case of Single split series by connecting ventilation device to CNT of the indoor printed circuit board in case of VRF series by connectin...

Страница 205: ...he function number 01 blinks in the upper right Press TEMP or TEMP button Select the function number Press MODE button Decide the function number In the case of selecting the remote controller function 01 06 The current setting number of the selected function number blinks Example Function number 01 lighting Setting number 01 blinking Press TEMP or TEMP button Select the setting number Press MODE ...

Страница 206: ...d on the unit which is installed in an area mentioned above it may be regarded as installation failure and warranty may not be given 1 Remove the top panel of the outdoor unit 11 pcs of tapping screws Follow the law or regulation of the country where it is installed Do not alter the heater Lay down the heater so that the edge of the sheet metal does not damage the heater Bending radius must be big...

Страница 207: ...hanger and align the end of heater with the end plate of heat exchanger Step 6 3 Remove the front panel 11 pcs of tapping screws Pull the panel straightforward so that the panel doesn t touch the fan blade Step 3 4 Remove the fan blade if necessary Note Do not rotate the axis of fan motor when removing the fan blade It may cause malfunction of the fan motor Step 4 ...

Страница 208: ...ating part comes to the corner of the base 4 Be careful not to be injured by aluminum fin when fixing the heater with screw Step 7 9 Lay down the wiring on the same route of fan motor wiring and fix the wire with attached plastic band 2 places at the same place where the fan motor wiring is banded Step 9 Note Be sure to cut the excess part of plastic band It may cause abnormal noise when hit by fa...

Страница 209: ... such as suction pipe check valve and check joint Step 12 3 Top panel Note 1 When reassembling the service panel take care not to damage the front panel with the edge 2 There are two different length of screws Be sure to use correct screw Long screw A used for Top panel other than fixing fan bracket Short screw B other place than A Step 11 A B 2 Service panel 1 Front panel 11 Reassemble the fan bl...

Страница 210: ...ditioning Refrigeration Systems 16 5 Konan 2 chome Minato ku Tokyo Japan Fax 03 6716 5926 Copyright MITSUBISHI HEAVY INDUSTRIES LTD Because of our policy of continuous improvement we reserve the right to make changes in all specifications without notice C ...

Результаты поиска

Содержание FDC100VNA

Отзывы:

Похожие инструкции для FDC100VNA

Бренды по названию

Популярные бренды

Mitsubishi Electric FDC100VNA, Техническое руководство

Результаты поиска

Содержание FDC100VNA

Отзывы:

Похожие инструкции для FDC100VNA

Бренды по названию

Популярные бренды