Country Clipper CHALLENGER D510 Скачать руководство пользователя страница 86

 

General Emissions Warranty Coverage

 
 

.DZDVDNLZDUUDQWVWRWKHXOWLPDWHSXUFKDVHUDQGHDFKVXEVHTXHQWSXUFKDVHUWKDWWKHVPDOOR൵URDGHQJLQHLV

1. 

GHVLJQHGEXLOWDQGHTXLSSHGVRDVWRFRQIRUPZLWKDOODSSOLFDEOHUHJXODWLRQVDGRSWHGE\WKH$LU5HVRUFHV%RDUGSXUVXDQWWRLWVDXWKRULW\LQ&KDSWHUVDQG3DUW'LYLVLRQ
RIWKH+HDOWKDQG6DIHW\&RGHDQG

2.  free from defects in materials and workmanship that cause the failure of a warranted part to be identical in all material respects to the part as described in Kawasaki’s applica

WLRQIRUFHUWL¿FDWLRQ

7KHZDUUDQW\SHULRGEHJLQVRQWKHGDWHWKHHQJLQHRUHTXLSPHQWLVGHOLYHUHGWRDQXOWLPDWHSXUFKDVHURU¿UVWSODFHGLQWRVHUYLFH7KHHTXLSPHQWRUHQJLQHRZQHUZLOOQRWEH
FKDUJHGIRUGLDJQRVWLFODERUWKDWLVGLUHFWO\DVVRFLDWHGZLWKGLDJQRVLVRIDGHIHFWLYHHPLVVLRQUHODWHGZDUUDQWHGSDUWSURYLGHGWKDWVXFKGLDJQRVWLFZRUNLVSHUIRUPHGDWD.DZD

saki warranty station.

(QJLQHSDUWVRXWOLQHGLQWKH3HULRGLF0DLQWHQDQFH&KDUWIRXQGLQWKH2ZQHUV0DQXDOSURYLGHGZLWKWKLVHQJLQHDUHZDUUDQWHGDVIROORZV

1. 

$Q\ZDUUDQWHGSDUWWKDWLVQRWVFKHGXOHGIRUUHSODFHPHQWDVUHTXLUHGPDLQWHQDQFHLQWKH3HULRGLF0DLQWHQDQFH&KDUWLVZDUUDQWHGIRUWKHZDUUDQW\SHULRGVWDWHGDERYH,I

any such part fails during the warranty period, the part will be repaired or replaced by Kawasaki at no charge to the owner provided the repair or replacement is performed at a 
warranty station.  Any such part repaired or replaced under the warranty will be warranted for the remaining warranty period.

2.  Any warranted part that is scheduled only for regular inspection in the Periodic Maintenance Chart is warranted for the warranty period stated above.  Any such part repaired 

or replaced under warranty will be warranted for the remaining warranty period.

3. 

$Q\ZDUUDQWHGSDUWWKDWLVVFKHGXOHGIRUUHSODFHPHQWDVUHTXLUHGPDLQWHQDQFHLQWKH3HULRGLF0DLQWHQDQFH&KDUWLVZDUUDQWHGIRUWKHSHULRGRIWLPHEHIRUHWKH¿UVWVFKHGXOHG
UHSODFHPHQWGDWHIRUWKDWSDUW,IWKHSDUWIDLOVEHIRUHWKH¿UVWVFKHGXOHGUHSODFHPHQWWKHSDUWZLOOEHUHSDLUHGRUUHSODFHGE\.DZDVDNLDWQRFKDUJHWRWKHRZQHUSURYLGHGWKH
UHSDLURUUHSODFHPHQWLVSHUIRUPHGDWDZDUUDQW\VWDWLRQ$Q\VXFKSDUWUHSDLUHGRUUHSODFHGXQGHUZDUUDQW\ZLOOEHZDUUDQWHGIRUWKHUHPDLQGHURIWKHSHULRGSULRUWRWKH¿UVW

scheduled replacement point for the part.

 

.DZDVDNLLVOLDEOHIRUGDPDJHVWRRWKHUHQJLQHFRPSRQHQWVSUR[LPDWHO\FDXVHGE\DIDLOXUHXQGHUZDUUDQW\RIDQ\ZDUUDQWHGSDUW

7KURXJKRXWWKHHQJLQH¶VZDUUDQW\SHULRGGH¿QHGDERYH.DZDVDNLZLOOPDLQWDLQDVXSSO\RIZDUUDQWHGSDUWVVX൶FLHQWWRPHHWWKHH[SHFWHGGHPDQGIRUVXFKSDUWV$Q\UHSODFHPHQW

part may be used in the performance of any warranty maintenance or repairs and will be provided without charge to the owner.  Such use will not reduce the warranty obligations of 
Kawasaki
.  

$GGRQRUPRGL¿HGSDUWVDVGH¿QHGLQ6HFWLRQEDQGE7LWOHWKDWDUHQRWH[HPSWHGE\WKH$LU5HVRXUFHV%RDUGPD\QRWEHXVHG7KHXVHRIDQ\QRQH[HPSWHG
DGGRQRUPRGL¿HGSDUWVE\WKHXOWLPDWHSXUFKDVHUZLOOEHJURXQGVIRUGLVDOORZLQJDZDUUDQW\FODLPPDGHLQDFFRUGDQFHZLWKWKLVDUWLFOH.DZDVDNLZLOOQRWEHOLDEOHXQGHUWKLVDUWLFOH
WRZDUUDQWIDLOXUHVRIZDUUDQWHGSDUWVFDXVHGE\WKHXVHRIDQRQH[HPSWHGDGGRQRUPRGL¿HGSDUW

 

To Obtain Warranty Service

 Notwithstanding the provisions herein, warranty services or repairs will be provided at all Kawasaki distribution centers that are franchised to service the subject engines.

<RXPXVWDW\RXURZQH[SHQVHWDNH\RXU.DZDVDNLVPDOOR൵URDGHQJLQHRUWKHSURGXFWRQZKLFKLWLVLQVWDOOHGDORQJZLWKSURRIRIRULJLQDOSXUFKDVHGDWHWRDQ\.DZDVDNL'HDOHU
ZKRLVDXWKRUL]HGE\.DZDVDNLWRVHOODQGVHUYLFHWKDW.DZDVDNLSURGXFWGXULQJWKH'HDOHU¶VQRUPDOEXVLQHVVKRXUV&ODLPVIRUUHSDLURUDGMXVWPHQWVIRXQGWREHFDXVHGVROHO\E\

defects in material or workmanship will not be denied because the engine was not properly maintained and used.

,I\RXDUHXQDEOHWRREWDLQHPLVVLRQZDUUDQW\VHUYLFHRUDUHGLVVDWLV¿HGZLWKWKHZDUUDQW\VHUYLFH\RXUHFHLYHGFRQWDFWWKHRZQHURIWKHGHDOHUVKLSLRZHYHULI\RXUHTXLUH
IXUWKHUDVVLVWDQFHFRQWDFWWKH.DZDVDNLR൶FHLQ\RXUUHJLRQ

Kawasaki Motors Corp., U.S.A.

&RQVXPHU6HUYLFHV'HSDUWPHQW

WK6WUHHW6(

*UDQG5DSLGV0,

7HOHSKRQH

(PDLONDZSRZHUZHEVLWH#NPFXVDFRP

Exclusions

1. 

7KHUHSDLURUUHSODFHPHQWRIDQ\ZDUUDQWHGSDUWRWKHUZLVHHOLJLEOHIRUZDUUDQW\FRYHUDJHDVVWDWHGDERYHPD\EHH[FOXGHGIURPVXFKZDUUDQW\FRYHUDJHLI.DZDVDNLGHPRQ

strates that the engine has been abused, neglected, or improperly maintained, and that such abuse, neglect, or improper maintenance was the direct cause of the need for repair 
or replacement of the part.

2. 

.DZDVDNLZDUUDQWV\RXUHQJLQHRQO\IRUWKHZDUUDQW\SHULRGVSHFL¿HGDERYH

3. 

([FHSWDVSURYLGHGDERYHDQ\DGMXVWPHQWRIDFRPSRQHQWWKDWKDVDIDFWRU\LQVWDOOHGDQGSURSHUO\RSHUDWLQJDGMXVWPHQWOLPLWLQJGHYLFHVXFKDVDQLGOHOLPLWHUFDSRUSOXJLV

eligible for warranty coverage as stated above.

Disclaimer of Consequential Damage and Limitation of Implied Warranties:

.DZDVDNL0RWRUV&RUSGLVFODLPVUHVSRQVLELOLW\IRULQFLGHQWDORUFRQVHTXHQWLDOGDPDJHVVXFKDVORVVRIWLPHRUWKHXVHRIWKHSRZHUHTXLSPHQWRUDQ\FRPPHUFLDOORVVGXHWRWKH
IDLOXUHRIWKHHTXLSPHQWDQGDQ\LPSOLHGZDUUDQWLHVDUHOLPLWHGWRWKHGXUDWLRQRIWKLVZULWWHQZDUUDQW\7KLVZDUUDQW\LVDSSOLFDEOHRQO\ZKHUHWKH&DOLIRUQLD86(3$RU(QYLURQ
PHQW&DQDGDHPLVVLRQFRQWUROV\VWHPZDUUDQW\UHJXODWLRQLVLQH൵HFW

Warranted Parts List: 

7KHIROORZLQJLVWKHHPLVVLRQZDUUDQW\SDUWVOLVWIRU\RXUVPDOOR൵URDGHQJLQH

L)XHO0HWHULQJ6\VWHP

$&DUEXUHWRUDQGLQWHUQDOSDUWVDQGRUSUHVVXUHUHJXODWRURUIXHOLQMHFWLRQV\VWHP

 

      (B) Cold start enrichment system

 

      (C) Intake valve(s)

 

(ii) Air Induction System

 

      (A) Intake manifold

%$LU¿OWHU

 

(iii) Ignition System

 

      (A) Spark plugs

 

      (B) Magneto or electronic ignition system

&6SDUNDGYDQFHUHWDUGV\VWHP

',JQLWLRQFRLODQGRUFRQWUROPRGXOH

 

(iv) Lubrication System

 

      (A) Oil pump and internal parts

 

(v) Positive Crankcase Ventilation (PCV) System

 

      (A) PCV valve

%2LO¿OOHUFDS

 

vi) Catalyst or Thermal Reactor System

 

      (A) Catalytic converter

%([KDXVWPDQLIROG

&([KDXVWYDOYHV

 
 
 
 
 
 
 
 
 
 
 
 

Kawasaki Motors Corp., U.S.A.

&RQVXPHU6HUYLFHV'HSDUWPHQW

WK6WUHHW6(

*UDQG5DSLGV0,

7HOHSKRQH

(PDLONDZSRZHUZHEVLWH#NPFXVDFRP

(൵HFWLYH

31

Содержание CHALLENGER D510

Страница 1: ...try Clipper Safety Instructions and Operation Country Clipper Repair Parts Warranty Country Clipper Warranty Kawasaki Engine Warranty Kohler Engine Warranty Hydro Gear Warranty Battery Warranty Additi...

Страница 2: ...s Tire Pressure Recommended 12 PSI 83kPa Front 10 to 16 PSI 69 to 110 kPa Rear 10 to 16 PSI 69 to 110 kPa Engine XLT Challenger Kawasaki FR730 Kohler KT745 Kawasaki FS730 Kohler ZT740 Engine Oil Filte...

Страница 3: ...Safety Instructions and Operation...

Страница 4: ...1 Pre Operation Checklist 4 1 Starting the Engine 4 2 Stopping the Engine 4 2 Mower Driving Operation 4 3 Deck Cut Height Adjustment 4 4 Blade Engagement 4 7 Mowing Recommendations 4 7 Transmission Fr...

Страница 5: ...urchase to validate the warranty As the new equipment owner you are expected to confirm that the form is completed and documentation forwarded to Country Clipper Mfg at the time of delivery Warranty r...

Страница 6: ...g backing up 2 10 Never direct mower discharge toward people or animals Avoid directing discharge material toward walls or obstructions as material may ricochet back toward the operator Disengage blad...

Страница 7: ...putting your foot or hand on the ground 2 31 Do not mow or drive near drop offs ditches or embankments sudden roll over could occur if a wheel goes over the edge 2 32 Avoid mowing slopes that have ro...

Страница 8: ...il re fueling is complete 2 58 If fuel is spilled do not attempt to start the engine and avoid creating any source of ignition until fuel vapors have dissipated 2 59 If fuel is spilled on clothing cha...

Страница 9: ...the driver s seat 2 79 The engine will stop if the Drive Control Lever s are not in the Neutral Lock position when the operator leaves the driver s seat 2 80 The engine will stop if the Park Brake is...

Страница 10: ...nt with a brief explanation for those requiring one Safety Decals P 11370 WARNING Operating Safety P 12557 CAUTION Fuel Handling Safety P 12706 WARNING Deck Discharge Opening Safety P 12496 DANGER Dis...

Страница 11: ...cient understanding of the function of these controls will assure the operator s confidence and safety during operation and servicing the mower Cut Height Foot Pedal Park Brake Lever Graduated Sight G...

Страница 12: ...ke knob up to assist starting a cold engine Push knob down after engine has started Hour Meter The hour meter records accumulative time while the engine is running Boulevard only Graduated Sight Gauge...

Страница 13: ...ference of the cutting blade height above the ground surface P 13482 Throttle Control Position Idle Rpm to Full Throttle P 13437 Transport Latch Lock position will permit the deck to lock in transport...

Страница 14: ...erlock System and missing or damaged safety shields or guards AVOID INHALING EXHAUST FUMES CARBON MONOXIDE GAS IS COLORLESS AND ODORLESS AND CAN CAUSE UNCONSCIOUSNESS AND IS POTENTIALLY LETHAL DO NOT...

Страница 15: ...osition Throttle Control Lever to mid range 4 1 9 Insert key into Ignition Switch With key inserted rotate clockwise to the Start position release key when engine starts The switch will automatically...

Страница 16: ...d Move the Joystick Drive Control Lever in the opposite direction of travel To stop move Joystick Drive Control Lever to the neutral position 4 3 10 Stop and Park With the Joystick Drive Control Lever...

Страница 17: ...5 inches to achieve your desired cut height The Transport Latch is a two position latch in the Lock position the deck will lock in the transport position when raised with the Cut Height Foot Pedal in...

Страница 18: ...4 5 Section 4 Figure 1...

Страница 19: ...4 6 Section 4 Figure 2...

Страница 20: ...iliar with the steering characteristics of the mower before attempting full throttle operation 4 6 2 Turning on Turf Avoid turf damage by keeping both wheels rolling either forward or reverse when tur...

Страница 21: ...es growing straight and to disperse grass clippings evenly throughout the lawn 4 6 8 Keep Blades Sharp Dull blades and improperly sharpened blades can cause cut quality issues See Mower Blade Service...

Страница 22: ...th a mild detergent and tap water Avoid excessive water usage 4 9 2 Dry Mower Allow mower to dry completely before storing 4 9 3 Paint Touch up paint as necessary 4 9 4 Inspect Mower Inspect mower for...

Страница 23: ...11 The mower is equipped with single hole Hitch Plate 4 11 1 Max Pulling Weight The recommended maximum pulling capacity is 200 lbs 4 11 2 Max Tongue Weight The recommended maximum tongue weight is 35...

Страница 24: ...11 Check Hydraulic Transaxle Drive Oil Level Check Engine Rpm Kawasaki 3400 100 Kohler 3400 75 Dealer Check Deck Level Deck Leveling Adj 5 16 Roll Over Protection Structure ROPS If Equipped n a Mainte...

Страница 25: ...4 hours of use Refer to the manufacture s engine manual for the maintenance schedule oil recommendations and capacity IMPORTANT Change engine oil and filter within the first 5 hours of operation and t...

Страница 26: ...heck to make sure the air cleaner cover sealed and is secure 5 1 12 Check Air Cleaner Assembly Check all fittings and clamps periodically for tightness and inspect hoses for holes or cracks Make sure...

Страница 27: ...on should be at a rate of 10 pumps of NLGI 2 grease every 50hrs or annually 5 2 2 Caster Pivot The caster pivot grease zerk is located on the front axle caster pivot tube There is a zerk located on ea...

Страница 28: ...ur Country Clipper mower is a 12 volt negative ground system 5 5 1 Battery Country Clipper uses a 12 volt maintenance free battery with 300 Cold Cranking Amps CCA When a replacement is required use th...

Страница 29: ...swing away from the deck Turn the engine off and remove the key 5 6 2 Step 2 Transport Latch Move Transport Latch forward to the lock position and push the Cut Height Foot Pedal forward and lock the d...

Страница 30: ...lt Tension Disconnect Belt Locate the Deck Belt Tension Lever at the rear of the deck on the trim side Release the belt tension by slowly rotating the lever to remove the spring tension With the tensi...

Страница 31: ...ck Hooks re connect to the Deck Pins 5 6 11 Step 4 Reconnect Deck Drive Belt Re install deck drive belt to the Electric Clutch Pulley Check to make sure the belt routing is not impeded by the frame tr...

Страница 32: ...Balance Check the blade balance after sharpening There are a variety of blade balancing techniques and commercial blade balancing tools available through a majority of hardware supply stores If the bl...

Страница 33: ...7 7 Blade Wear Blades should be discarded if excessive wear cracks and or distortion are present 5 7 8 Re Install Blades Install blade and bolt to spindle assembly Torque blade bolt to 100 ft lbs 136...

Страница 34: ...ith an API classification of SL has been selected by the manufacture and is recommended for normal operating temperatures Oil Volume Approximately 2 quarts each transaxle 5 8 3 Fluid Change Recommenda...

Страница 35: ...vel Check oil level add oil as required after stopping the engine 5 8 15 Repeat As Necessary Repeat steps as necessary until all air is purged from the system 5 8 16 De Activate Bypass De Activate the...

Страница 36: ...10 Shorten Right Side Transaxle Linkage Hold the Joystick Control Lever firmly in the full speed forward position shorten the linkage to the right side transaxle by rotating the coupling nut until the...

Страница 37: ...bottom of the Joystick Assembly Loosen the two nuts just enough to allow the plate to move 5 9 19 Adjust Neutral Plate Start the engine With the Joystick Lever in the Neutral Lock Position grab the J...

Страница 38: ...is veering to the right then the left transaxle needs to be slowed down or vice versa 5 9 31 Position Mower Stop the mower engage Park Brake and shut the engine off 5 9 32 Adjust Tracking On the trans...

Страница 39: ...mately 3 inches and within 1 8 inch of each other Note To simplify this measuring an optional Blade Measuring Tool part number 629 374A is available from your local Country Clipper Dealer Important Do...

Страница 40: ...Spring is used to reduce the effort required to raise and or lower the deck Changing the length of the spring stretch will have a direct effect on this effort Reducing the gap between the Spring Anch...

Страница 41: ...lt Dealer Contaminated or maladjusted carburetor Consult Dealer Other Consult Engine Owner Manual or Dealer Engine Starts but Runs Rough Erratically Misfires Cuts Out or Overheats Water in gasoline Dr...

Страница 42: ...rts Repair or replace loose parts Bypass assembly sticking Repair or replace linkage Air trapped in hydraulic system Purge hydraulic system Other Consult Dealer Engine Stalls when Blades are Engaged O...

Страница 43: ...mooth troughs in the lawn surface Uneven Cutting typically occurs due to mower deck damage or maladjustment Cause Remedy Cause Remedy Lawn uneven or bumpy Roll or level lawn Deck level correct Correct...

Страница 44: ...ion 7 Belt Routing XLT Challenger 48 52 60 Deck Belt Routing Hydro Belt Routing Right Hand Hydrostatic Transmission Pulley Left Hand Hydrostatic Transmission Pulley Motor Pulley Viewed from ground loo...

Страница 45: ...8 1 Section 8 Maintenance Record Date Hours Service Performed...

Страница 46: ...Repair Parts SERIAL RANGE 21286001 ________ P 13540 Rev B 11 21...

Страница 47: ...FRONT PANEL ASSEMBLY RELATED PARTS CON T 15 BATTERY BOX 16 BRAKE ASSEMBLY SECTION 3 TRACTOR DRIVE AND RELATED PARTS 17 FUEL TANK ASSEMBLY 18 JOYSTICK CONTROL RELATED PARTS 19 JOYSTICK ASSEMBLY 20 JOY...

Страница 48: ...3 F 2151 NUT 3 8 16 NYLOC FLANGED YZ 19 1 F 2155 BOLT CARRIAGE 1 4 20 X 5 8 YZ GR5 20 5 F 2161 FHCS 3 18 16 X 6 YZ GR5 21 2 F 2250 CLIP FIR TREE 1 4 X 1 BLACK NYLON 22 5 H 1948 ROLLER 3 3 4 DIA 23 4 H...

Страница 49: ...TCH 17 13 F 2151 NUT 3 8 16 NYLOC FLANGED YZ 18 5 F 2161 FHCS 3 18 16 X 6 YZ GR5 19 2 F 2250 CLIP FIR TREE 1 4 X 1 BLACK NYLON 20 5 H 1948 ROLLER 3 3 4 DIA 21 4 H 2239 1 2 RUE RING 22 4 H 2240 1 2 X 4...

Страница 50: ...FLAT 4 11 F 2063 NUT 5 16 18 NYLOC FLANGED YZ 5 8 F 2066 BOLT CARRIAGE 5 16 18 X 1 YZ GR5 6 3 F 2148 FHCS 5 16 18 x 1 YZ GR5 7 1 H 2723 CHUTE DISCHARGE SMALL 8 1 P 12496 DECAL CHUTE MISSING 4 5 6 3 4...

Страница 51: ...NG 1 H 2667 BLADE 20 86 X 63 GATOR 60 12 1 F 1650 HHCS 5 8 11 X 2 GR5 YZ 2 1 660 099P WASHER BLADE 5 8 13 4 F 2125 FHCS 3 8 16 X 1 1 4 YZ GR5 3 1 660 206P SPINDLE SPACER 14 1 F 2143 FHCS 1 2 13 X 1 YZ...

Страница 52: ...1 2 NOMINAL YZ 15 1 F 1307 HHCS 3 8 16 X 1 1 4 YZ GR5 16 1 F 1464 LOCKWASHER 1 2 17 1 F 1489 NUT HEX JAM 1 2 13 YZ 18 1 F 1521 WASHER 1 2 CUSTOM YZ 19 1 F 1733 DRIVE SCREW 1 4 X 1 2 RND HD 20 1 F 1822...

Страница 53: ...LOCKWASHER HVY 3 8 YZ 8 1 F 1394 HHCS 3 8 16NC X 1 GR 5 YELLOW PLATED 9 2 F 2124 FHCS 3 8 16 X 3 4 YZ GR5 10 3 F 2141 FHCS 3 8 16 X 1 11 4 F 2151 NUT 3 8 16 NYLOC FLANGED YZ 12 2 F 2152 NUT 1 2 13 NYL...

Страница 54: ...F 1489 NUT HEX JAM 1 2 13 YZ 9 1 F 1521 WASHER 1 2 CUSTOM YZ 10 1 F 1707 CARRIAGE BOLT 5 16 18 X 2 1 4 ZINC PLATED 11 1 F 1966 NUT THIN 1 2 13 NYLOC YZ 12 1 F 2047 CARRIAGE BOLT 1 2 13 X 3 ZINC YELLO...

Страница 55: ...VIS PIN 1 2 X 1 3 4 YZ 11 2 F 1966 NUT THIN 1 2 13 NYLOC YZ 12 1 F 2127 FHCS 1 2 13 X 1 1 4 YZ GR5 13 4 F 2147 FHCS 3 8 16 X 1 1 2 YZ GR5 14 9 F 2151 NUT 3 8 16 NYLOC FLANGED YZ 15 5 F 2180 FHCS 3 8 1...

Страница 56: ...8 F 2162 FHCS 1 4 20 X 3 4 YZ GR5 16 2 F 2181 FHCS 1 2 13 X 4 50 YZ GR8 17 2 F 2182 FHCS 1 4 20 X 1 1 4 YZ GR5 18 2 F 2277 FHCS 1 2 13 X 3 1 2 GR5 YZ FULL THREAD 19 2 H 1635 SPRING EXT 3 4 OD X 4 OAL...

Страница 57: ...AL 16 1 H 2327 3 8 DIA X 1 LONG END CAP 17 1 H 3013 DECK HEIGHT PIN 18 1 H 3120 TRANSPORT LATCH RELEASE HANDLE 19 1 P 13421 DECAL CUT HEIGHT 20 1 P 13437 DECAL TRANSPORT LATCH 21 1 H 3117 EXTENSION SP...

Страница 58: ...1724 NUT HEX SLOTTED 1 14 YZ 8 1 F 1728 COTTER PIN 3 16 X 2 YZ 9 1 F 2078 NUT 3 4 16 TOP LOCK GR GT YZ 10 4 F 2141 FHCS 3 8 16 X 1 YZ GR5 11 4 F 2151 NUT 3 8 16 NYLOC FLANGED YZ 12 1 H 1924 GREASE CAP...

Страница 59: ...11 2 D 4021 5 GREASE SEAL S17828001 12 2 D 4021 6 SPACER SPCR005 13 2 D 4033 TIRE ASS Y 22 X 11 10 TURF FLAT BLACK 14 8 F 1499 LUG NUT 1 2 20 YZ 15 2 F 2141 FHCS 3 8 16 X 1 YZ GR5 16 2 F 2143 FHCS 1 2...

Страница 60: ...3 F 2162 FHCS 1 4 20 X 3 4 YZ GR5 12 8 F 2229 NUT RIVET 1 4 20 OPEN END 027 165 MAT L THK 13 1 H 2934 PIVOT BRAKE CRANK 14 1 H 2935 PLATE BRAKE HANDLE 15 1 P 12557 DECAL CAUTION FUEL 16 1 P 13000 DECA...

Страница 61: ...NUT 3 8 16 NYLOC FLANGED YZ 14 3 F 2162 FHCS 1 4 20 X 3 4 YZ GR5 15 4 F 2180 FHCS 3 8 16 x 3 YZ GR5 16 2 F 2219 HFCS 3 8 16 X 3 4 CZ THD FORMING 17 3 H 1920 SPRING SEAT 18 1 H 1926 1 4 X 1 HANDLE GRIP...

Страница 62: ...59 BATTERY YPS 35 5 1 F 2063 NUT 5 16 18 NYLOC FLANGED YZ 6 1 F 2120 FHCS 5 16 18 X 3 4 YZ GR5 7 4 F 2132 NUT 1 4 20 NYLOC FLANGED YZ 8 4 F 2162 FHCS 1 4 20 X 3 4 YZ GR5 9 2 F 2219 HFCS 3 8 16 X 3 4 C...

Страница 63: ...4 20 NYLOC FLANGED YZ 8 4 F 2134 HFCS 1 4 20 X 0 625 YZ SELF TAPPING 9 2 F 2148 FHCS 5 16 18 X 1 YZ GR5 10 1 F 2162 FHCS 1 4 20 X 3 4 YZ GR5 11 1 H 1635 SPRING EXT 3 4 OD X 4 OAL 12 2 H 1637 COMPRESS...

Страница 64: ...OD 8 1 H 2698 CLAMP 406 OD FUEL LINE 9 1 H 2741 GROMMET PICK UP TUBE DAPCO 12240 10 1 H 2742 PICK UP TUBE DAPCO INDUSTRIES 11 1 H 2743 RATCHET CAP W TETHER 3 5 DIA 12 1 H 3081 FUEL TANK 13 1 P 12922 V...

Страница 65: ...4 5 F 2063 NUT 5 16 18 NYLOC FLANGED YZ 15 2 F 2100 HHMS 10 32 X 7 8 CZ 16 1 F 2103 SHCS BUTTON HD 1 4 20 X 1 1 4 CZ 17 3 F 2120 FHCS 5 16 18 X 3 4 YZ GR5 18 1 F 2122 FHCS 5 16 18 X 1 1 4 YZ GR5 FULL...

Страница 66: ...17 1 F 1005 05 NUT 1 2 13 CENTERLOCK YZ GR5 18 1 F 1293 HHCS 1 2 13 X 2 YZ GR5 19 1 F 1462 JAM NUT 1 2 20 RH YZ 20 1 F 1503 PIN SPIROL 3 16 DIA X 1 X 010 THK 21 1 F 1521 WASHER 1 2 CUSTOM YZ 22 1 F 21...

Страница 67: ...LOWER 11 2 H 3031 SIDE FLANGE BRG 0 500 BRONZE 12 2 638 028P DAMPER BOLT 5 16 18 X 3 4 13 1 721 121P BRACKET DAMPER OFFSET LH 14 1 721 121P BRACKET DAMPER OFFSET RH 15 2 F 1610 RETAINING RING 16 2 F...

Страница 68: ...4 YZ GR5 11 1 F 2122 FHCS 5 16 18 X 1 1 4 YZ GR5 FULL THD 12 4 F 2129 FHCS 5 16 18 X 1 1 2 YZ GR5 13 4 F 2132 NUT 1 4 20 NYLOC FLANGED YZ 14 2 F 2229 NUT RIVET 1 4 20 OPEN END 027 165 MAT L THK 15 2...

Страница 69: ...16 18 12 1 F 1125 NUT CENTERLOCK 5 16 18 YZ GR5 13 1 F 1306 HHCS 3 8 16 X 1 1 2 FULL THRD CZ GR5 14 1 F 1486 NUT JAM 3 8 16 YZ 15 1 F 1903 SETSCREW 3 8 16 X 3 4 W NYLON 16 5 F 2063 NUT 5 16 18 NYLOC F...

Страница 70: ...8 SLOTTED CZ 7 2 F 1071 WASHER FLAT 10 ZINC PLATED 10 SAE FLAT WASHER 8 2 F 1448 LOCKNUT 10 32 NYLOC YELLOW PLTD 9 1 H 2287 CHOKE CABLE 43 1 2 10 1 H 2610 THROTTLE CABLE 38 KAWASAKI 1 H 2611 THROTTLE...

Страница 71: ...1 4 20 X 0 625 YZ SELF TAPPING RH 9 12 F 2162 FHCS 1 4 20 X 3 4 YZ GR5 10 1 P 11370 DECAL WARNING 11 1 P 13188 DECAL INSTRUCTIONS 12 2 P 13366 DECAL C C LOGO SM VINYL 7 3 8 11 7 7 12 1 4 9 CONTROL PA...

Страница 72: ...5 7 1 D 3992 01 TRANSAXLE ZT 3400 RH 20 1 F 2216 FHCS 1 4 20 X 1 3 4 YZ GR5 8 1 D 3992 02 TRANSAXLE ZT 3400 LH 21 1 F 2218 FHCS 3 8 16 X 2 1 4 YZ GR5 9 2 F 1009 03 WASHER FLAT 3 8 YZ 22 1 H 2907 SPRIN...

Страница 73: ...TAINING RING 6 4 F 2063 NUT 5 16 18 NYLOC FLANGED YZ 7 2 F 2129 FHCS 5 16 18 X 1 1 2 YZ GR5 8 2 F 2141 FHCS 3 8 16 X 1 YZ GR5 9 2 F 2151 NUT 3 8 16 NYLOC FLANGED YZ 10 2 H 2896 DAMPER NC300 JS 5 4 6 1...

Страница 74: ...TRANSAXLE OIL FILTER 6 1 H 2762 VENT TUBE ADAPTER 7 1 H 3033 HYDRO TANK ASSEMBLY 8 2 H 3084 HOSE 1 2 DIA X 16 1 2 9 4 H 3089 HOSE CLAMP 0 78 HOSE O D 4 H 3155 HOSE CLAMP 0 88 HOSE O D 10 1 P 11052 DE...

Страница 75: ...LANGED YZ 4 1 F 2129 FHCS 5 16 18 X 1 1 2 YZ GR5 5 2 F 2141 FHCS 3 8 16 X 1 YZ GR5 6 2 F 2148 FHCS 5 16 18 X 1 YZ GR5 7 2 F 2151 NUT 3 8 16 NYLOC FLANGED YZ 8 1 H 2460 SPRING EXTENSION CABLE SECURE SP...

Страница 76: ...16 18 NYLOC FLANGED YZ 7 4 F 2121 FHCS 5 16 18 X 1 LOCK PATCH YZ GR5 8 4 F 2129 FHCS 5 16 18 X 1 1 2 YZ GR5 9 1 F 2141 FHCS 3 8 16 X 1 YZ GR5 10 1 H 2760 TRACK KIT HD 6 TRAVEL 11 1 H 2764 HANDLE JOYST...

Страница 77: ...M8 1 25 X 12 YZ GR8 5 1 H 3034 MUFFLER KOHLER ZT740 5 1 H 3020 MUFFLER KAWASAKI FR730 6 1 M 5418 ENGINE KOH 25HP ZT740 3400RPM 6 1 M 5420 ENGINE KAW 24HP FS730 3400RPM 7 1 P 10077 11 DECAL PERIODIACAL...

Страница 78: ...6 x 3 YZ GR5 12 2 F 2219 HFCS 3 8 16 X 3 4 CZ THD FORMING 13 1 P 12918 DECAL HYDRO BELT ROUTING 14 1 E 6575 HARNESS ADAPTER CLUTCH PIGTAIL 13 75 15 1 720 124P WASHER OGURA CLUTCH 0 471 ID X 1 875 OD X...

Страница 79: ......

Страница 80: ...33...

Страница 81: ...of usage maybe requiredtoretainthe ConsumerLimitedWarranty Commercial LimitedWarranty WhenusedforCommercial business productionagriculture horticultural ornon profitinstitutional use the LimitedWarra...

Страница 82: ...ies orsuppliesusedonthe equipmentotherthanrecommendedinthe operator smanual orotherinstructional guides providedbyCountryClipper ReplacementParts ReplacementpartsforResidential andCommercial use mower...

Страница 83: ...ippertoincorporate saiddesignchangesinto previouslymanufacturedproducts norshall saidchangesbe construedasanadmissionthatprevious designswere defective All impliedWarranties includingthoseof merchanta...

Страница 84: ...acements improperly installed v use of replacement parts or accessories not conforming to Kawasaki specifications which adversely affect performance and or durability vi alterations or modifications n...

Страница 85: ...PHQWV IRXQG WR EH FDXVHG solely by defects in material or workmanship will not be denied because the engine was not properly maintained and used I KRZHYHU RX UHVLGH PRUH WKDQ PLOHV IURP DQ DXWKRUL HG...

Страница 86: ...DWH SXUFKDVHU ZLOO EH JURXQGV IRU GLVDOORZLQJ D ZDUUDQW FODLP PDGH LQ DFFRUGDQFH ZLWK WKLV DUWLFOH DZDVDNL ZLOO QRW EH OLDEOH XQGHU WKLV DUWLFOH WR ZDUUDQW IDLOXUHV RI ZDUUDQWHG SDUWV FDXVHG E WKH XVH...

Страница 87: ...NCLUDING WARRANTIES OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE ARE EXPRESSLY LIMITED TO THE DURATION OF THIS WRITTEN WARRANTY WE MAKE NO OTHER EXPRESS WARRANTY OR IS ANYONE AUTHORIZED TO M...

Страница 88: ...a problem exists The warranty repairs should be completed in a reasonable amount of time not to exceed 30 days If you have a question regarding your warranty coverage you should contact a Kohler Deale...

Страница 89: ...lead Gaseous fuel regulator Electronic control unit Carburetor or fuel injection system Fuel metering valve Air filter fuel filter and spark plugs only to first scheduled replacement point Evaporative...

Страница 90: ...Warranty Policies and Procedures All Models BLN 50225_P18 Revision March 2019...

Страница 91: ...ve those speeds weights limits pressures or temperatures recommended by Hydro Gear Use of the product in a manner or for a purpose not originally intended for by Hydro Gear or failure to use in strict...

Страница 92: ...months 4 years from the date of manufacture II REPLACEMENT PARTS AND UNITS A HYDRO GEAR REPLACEMENT PARTS i All parts shall be warranted for 90 days from the date of first sale or the balance of the o...

Страница 93: ...a warranty claim which does not comply with the stated proce dures F Warranty labor rate s will be set by Hydro Gear G Labor rate time guidelines will be as follows Electric Units Electric Unit Transa...

Страница 94: ...ine necessary recharge time a 15 60 minute charge WILL NOT be a sufficient recharge for a discharged battery and will be refused for warranty Open Circuit Voltage Battery Voltage State of Charge Recom...

Страница 95: ...d Features Hour Meter Electric Start Deluxe Adjustable Seat Sewn Arm Rest Cup Holder Pivoting Front End and Front Step CHALLENGER Twinstick Steering MODEL 2452KAT D510 2460KAT D510 Engine 24 H P Kawas...

Страница 96: ...PRODUCT MANUAL Country Clipper Division Shivvers Manufacturing Inc 613 W English St Corydon IA 50060 0467 Ph 641 872 2544 Fax 641 872 1593 P 13540 Rev B 11 21...

Отзывы: