background image

108

P

LUMBING

 S

YSTEM

“CITY WATER” (Pressurized fresh water source)

1. 

Connect the fresh water hose to the city water inlet.

 

2. 

Set the color coded valves to the CITY WATER setting: 

 

(A) White handle pointing right

 

(B) Blue handle pointing down

 

(C) Black handle pointing right

 

(D) Red handle pointing up

 

  (E) Green handle pointing up

3. 

Connect other end of the hose to the pressurized fresh water source.

4. 

  Turn ON the pressurized water source.  

5. 

:DWHUVKRXOGQRZEHDYDLODEOHWRDOO¿[WXUHV

³:,17(5,=(´SOXPELQJOLQHVDQG¿[WXUHVYLDSXPS

(

Refer to the

 Winterizing Plumbing System 

section before starting the winterizing process

).

1.  Connect a garden hose to the city water inlet (do not use your fresh water hose to 

winterize the water lines) 

2. 

Set the color coded valves to the WINTERIZE setting: 

 

(A) White handle pointing down

 

(B) Blue handle pointing left

 

(C) Black handle pointing right

 

(D) Red handle pointing left

 

(E) Green handle pointing up

 

The water heater is bypassed automatically on this setting.

3. 

Insert the other end of the hose in a container holding RV antifreeze.

4. 

Turn the pump switch ON.

NOTE:

7RGLVFRQQHFW7XUQRIIZDWHUDWWKHSUHVVXUL]HGVRXUFH¿UVW

GLVFRQQHFWKRVHIURPWKHZDWHUVRXUFHWRUHOHDVHSUHVVXUHRIIWKH
V\VWHPWKHQGLVFRQQHFWWKHKRVHDWWKH&LW\:DWHU&RQQHFWLRQRQ
8WLOLW\&HQWHUODVW

TY WATER” (Pressurized fresh water source)

NOTE:

7R¿OOWKHIUHVKZDWHUWDQNZLWKRXWDSUHVVXUL]HGZDWHU

VRXUFHUHIHUWR6$1,7,=(6LSKRQ)LOOVHFWLRQDERYHDQGXVH
DFRQWDLQHUKROGLQJIUHVKSRWDEOHZDWHUDQGDKRVH:DWHUZLOOEH
GUDZQLQWRWKHWDQNE\WKHSXPS7KHUHLVQRJUDYLW\¿OOLQOHWRQWKH

recreation vehicle.

Содержание PINNACLE

Страница 1: ...2016 CAMPING TRAILERS PRINTED ON RECYCLED PAPER 0210677 2016 2016 PINNACLE TOWABLES...

Страница 2: ...B...

Страница 3: ...show that a little initiative can go a long way The Jayco EcoAdvantage is our way of making sure endless generations can enjoy the Great Outdoors 7 192 tons of wood 2 354 tons of scrap metal 1 428 ton...

Страница 4: ......

Страница 5: ...Window 19 Exit Window Label 19 Fire Safety 20 Fire Extinguisher 21 Smoke Alarm 21 Smoke detector warning label 22 Combination Carbon Monoxide Propane Alarm 23 Formaldehyde 27 Extended Or Full Time Us...

Страница 6: ...System If So Equipped 61 Slideout Systems 62 Slideout overlap outside 62 Fig 1 Through Frame Crank Extension w pin 68 Fig 3 Hex Head Crank Extension 68 Fig 2 Crank Handle 68 Fig 4 Ratchet 68 ELECTRICA...

Страница 7: ...98 Ensure a supply of fresh air Canada units only 98 Cooking comfort heating label 98 Traveling with Propane 99 Re fueling Warning Label 99 PLUMBING SYSTEM Plumbing System Maintenance 101 Monitor Pane...

Страница 8: ...If So Equipped 137 APPLIANCES Microwave 139 Cooktops If So Equipped 139 Kitchen Range Oven If So Equipped 141 Gas BBQ Grill If So Equipped 142 Bumper mounting bracket 143 Gas Grill Mounting Bracket 14...

Страница 9: ...or Safe If So Equipped 160 EXTERIOR Cleaning The Exterior 161 Frame 163 E Z Lube or Super Lube Axle If So Equipped 163 Exterior Roof Sidewall Vents 164 Windows 164 Exterior ladder If So Equipped 164 S...

Страница 10: ......

Страница 11: ...rvice and or maintenance could result in the loss of warranty The owner should review the Jayco limited warranty and the limited warranties WKDW DSSO WR VSHFL F FRPSRQHQWV WKDW DUH RIIHUHG ZLWK WKLV Y...

Страница 12: ...2...

Страница 13: ...is information for questions regarding operating maintenance servicing instructions and warranty coverage It is important you complete and mail warranty cards and registrations within the prescribed t...

Страница 14: ...is used to alert you to potential personal injury hazards Obey all safety messages that follow this symbol to avoid possible injury or death REPORTING SAFETY DEFECTS In the United States If you believ...

Страница 15: ...posted mail RU HPDLO DV LW HQDEOHV WKHLU LQYHVWLJDWRUV WR FRQ UP WKDW RXU LQIRUPDWLRQ LV FRUUHFW DQG WR answer your questions accurately For additional information please refer to the Transport Canad...

Страница 16: ...ons we would like to make Contact your dealer at once Do not wait until you are ready to use your RV Your dealer may not be able to service it immediately and or the repair may require parts be ordere...

Страница 17: ...lity you are contacting Jayco to discuss Keep a maintenance log of your vehicle s service history This can often provide a clue to the current issue Be reasonable with your requests If you leave a lis...

Страница 18: ...J WR WKH D FR 7UDYHO OXE RX ZLOO QG QHZ ZD V WR HQMR RXU 59 DQG PDNH friends all across the country For more information please visit www Jaycorvclub com or call 1 800 262 5178 JAYPLUS EXTENDED SERVIC...

Страница 19: ...0DNH VXUH RX DUH VDWLV HG with the repair before you pay or leave the premises f For reimbursement either you or the RV repair facility must send a copy of your itemized repair bill and all requested...

Страница 20: ...vide an appropriate substitute TOWABLE LIMITED WARRANTY WHAT AND WHO IS COVERED The Jayco warranty covers this recreational vehicle RV when used only for its intended purpose of recreational travel an...

Страница 21: ...d or modify this limited warranty Any selling or servicing dealer is not Jayco s agent but an independent entity JAYCO SHALL NOT BE LIABLE FOR ANY INCIDENTAL OR CONSEQUENTIAL DAMAGES THAT MAY RESULT F...

Страница 22: ...R the RV or if the RV is purchased registered or titled in a business name any RV sold or used outside the United States U S Territories or Canada any RV not used solely for recreational travel and ca...

Страница 23: ...Owner s Manual unauthorized alteration off road use collision or accident whether or not foreseeable including any acts of weather or damage or corrosion due to the environment WKHIW YDQGDOLVP UH H SO...

Страница 24: ...ain Street P O Box 460 Middlebury IN 46540 Telephone 574 825 5861 or 800 283 8267 NOTICE TO JAYCO DEALERS This Owner s Manual contains the Towable Limited Warranty that applies to this RV However if t...

Страница 25: ...s obligation to notify Jayco of a claimed defect does not modify any obligation placed on the Dealer to contact Jayco directly when attempting to pursue remedies under state or federal law LIMITATION...

Страница 26: ...not cover any of the following defects in materials components or parts of the RV not attributable to Jayco items that are added or changed after the RV leaves the possession of Jayco additional equi...

Страница 27: ...portion of this limited warranty or any implied warranty shall be commenced within six 6 months after expiration of the warranty coverage period designated above Any performance of repairs shall not...

Страница 28: ...lure to maintain the RV as noted in those manuals voids this limited warranty and any damage to the RV as a result of your failure to perform such care is not covered by this limited warranty THIS WAR...

Страница 29: ...sure the ground below the window is solid and can be used as an escape path Practice opening the window before an emergency occurs and make sure all occupants know how to operate it The egress window...

Страница 30: ...OHFWURFXWLRQ LV SRVVLEOH ZLWK DQ HOHFWULFDO UH 5HIHU WR WKH IROORZLQJ VHFWLRQV IRU DGGLWLRQDO UH VDIHW LQIRUPDWLRQ Electrical Systems Q FDVH RI DQ HOHFWULFDO UH Appliances Q FDVH RI D JUHDVH UH Slider...

Страница 31: ...lso be done before beginning a vacation or during an extended trip Do not turn the electrical power back on or plug in any appliances after the use RI D UH H WLQJXLVKHU 3OHDVH UHIHU WR WKH UH H WLQJXL...

Страница 32: ...ds it may not be heard for many reasons These include but not limited to a closed or partially closed door the alarm may EH GURZQHG RXW E RWKHU QRLVH OLNH WKH 79 VWHUHR WUDI F ZHDWKHU DLU FRQGLWLRQHU...

Страница 33: ...detector user s guide Battery The smoke alarm will not function if the battery is missing disconnected dead the wrong type of battery is used or the battery is not installed correctly The smoke detec...

Страница 34: ...de fumes rests solely on you Installing a carbon monoxide propane alarm is just WKH UVW VWHS LQ SURWHFWLQJ RXU IDPLO IURP WR LF FDUERQ PRQR LGH SRLVRQLQJ 9 40 0 The alarm is wired directly to the 12 v...

Страница 35: ...hemicals used in its construction may be detected for months after the vehicle was constructed for more information refer to Section 2 Formaldehyde What you should do if the alarm sounds 1 Operate the...

Страница 36: ...ED light will remain steady and the alarm will sound 4 BEEPS then silent for 5 seconds These signals indicate immediate action is required 3URSDQH JDV DODUP 7KH UHG OLJKW ZLOO DVK DQG WKH DODUP ZLOO V...

Страница 37: ...unknown period of time Individuals who are allergic to formaldehyde gas fumes may experience irritation to eyes ears nose and throat Indoor air quality may also be affected by leaving your vehicle clo...

Страница 38: ...ocks slide outs windows vents etc for frozen moisture before operating to avoid damage to parts CONDENSATION Condensation is a natural phenomenon The amount of condensation will vary with climate cond...

Страница 39: ...on plate painted over damaged or removed should be replaced HHS D UHFRUG RI WKH GLJLW YHKLFOH LGHQWL FDWLRQ QXPEHU 9 1 WKH GLJLW VHULDO number and your license number in the event theft or vandalism r...

Страница 40: ...ailer as it was manufactured and weighed at the factory It includes full propane tanks and full generator fuel if so equipped You may question the total weight capacity of the tires on your RV being l...

Страница 41: ...hicle Do not exceed your GVWR and ensure you are loading the vehicle as evenly as you can for the best possible handling Ensure heavy items are secured so they do not shift during travel 9 40 0 Receiv...

Страница 42: ...ned to carry cargo Items that extend beyond the bumper OR weigh over 100 lbs 45kg will place undo strain on the bumper The 100 lb bumper capacity includes the weight of the spare tire that may have be...

Страница 43: ...ZKHHOV XVXDOO WKH IWK ZKHHO SLQ ER LV adjustable for variance in trucks and truck suspension systems GMXVW WKH KLWFK DVVHPEO VR WKH WRZ YHKLFOH DQG WKH IWK ZKHHO DUH HVVHQWLDOO OHYHO KLJK KLWFK ZLOO...

Страница 44: ...how much cargo capacity is important for you personally 9 40 0 9 3OXJ WKH ZLUH KDUQHVV FRQQHFWRU SOXJ IURP WKH WRZ YHKLFOH WR WKH IWK ZKHHO 10 Remove the wheel chocks from the trailer wheels WIRE HARN...

Страница 45: ...uding the tongue weight while detached from the tow vehicle This actual overall weight must be less than or equal to the GVWR for safe operation If the overall weight is greater than the GVWR some con...

Страница 46: ...mponents tires wheels brakes springs etc on the heavier side could be overloaded even though the total axle load is within the GAWR It is important to redistribute the load to avoid component failure...

Страница 47: ...e parking lot where it is permissible Easing to a stop and starting smoothly saves wear and tear on your tow vehicle RV combination Be aware of road surface conditions Slow down well in advance of dip...

Страница 48: ...vehicles along the curb When making a turn check the road clearance and be aware of others Have someone KHOS JXLGH RX RXW RI D GLI FXOW SDUNLQJ VSDFH RU WUDI F SDWWHUQ 6ZHUYHV DQG VKDUS WXUQV especial...

Страница 49: ...Wire harness connector plug Trailer battery Breakaway switch Hydraulic brakes if so equipped Your recreation vehicle may be equipped with hydraulic surge brakes These brakes operate automatically as...

Страница 50: ...combination ENTRANCE DOOR STEP S Make sure your entrance step is fully extended before exiting the vehicle and retracted prior to towing Lubricating the step mechanism Carefully clean the area around...

Страница 51: ...the right of the buttons The buttons will illuminate once the Touch Pad is wakened This indicates that the touch pad is ready for the code to be entered Refer to the diagram on next page Preset Facto...

Страница 52: ...ry life is highly dependent upon battery quality usage and environment temperature Make sure there are no obstructions in the door frame to prevent Dead Bolt extension Do not wash with power washer or...

Страница 53: ...t found on this list please refer to the manufacturer s operators manual Battery Installation The entry system uses 4 AA batteries for operation We do not recommend zinc carbon batteries for this appl...

Страница 54: ...n refer to the manufacturers user guide The rear vision camera aids in the use of but does not replace vehicle side rear view mirrors 9 40 0 Objects in the camera view are closer than they appear When...

Страница 55: ...ecreation vehicle you need to ensure it is level Leveling is very important A level vehicle is more comfortable for sleeping and walking The refrigerator is designed to operate when level for best per...

Страница 56: ...F THE GROUND LIFTING THE RV SO THE WHEELS ARE NOT TOUCHING THE GROUND WILL CREATE AN UNSTABLE AND UNSAFE CONDITIONAND MAYRESULT IN SERIOUS PERSONAL INJURY OR DEATH THE LEVELING SYSTEM IS DESIGNED ONLY...

Страница 57: ...RACT button the front jacks can be retracted together by pushing the FRONT button or individually by pressing LEFT or RIGHT buttons while simultaneously pressing the FRONT button The rear jacks con on...

Страница 58: ...ck press the control switch until the jack is returned to the retracted position DO NOT USE THE STABILIZER JACKS TO LEVEL THE RV It is important to remember that the stabilizer jacks are to be used on...

Страница 59: ...WHU RXU UVW WULS FKHFN WKH ZKHHO OXJ WRUTXH SHULRGLFDOO IRU VDIHW KHFN WKH ZKHHO lugs after winter storage after a wheel removal before starting a trip or following extensive braking Use the correct s...

Страница 60: ...ration of the wheel s from your recreation vehicle The lug nuts on the wheels of your recreation vehicle must be maintained according to listed torque values see Wheel Lug Torque Chart Over torqued an...

Страница 61: ...inspection of your tires and checking tire pressures is absolutely mandatory Examine your tires frequently for unusual wear Alignment balance and bearing wear will affect tire wear Make sure to look...

Страница 62: ...ZHDU VKRXOG EH FKHFNHG IUHTXHQWO 2QFH D ZHDU SDWWHUQ EHFRPHV UPO HVWDEOLVKHG LQ D WLUH LW LV GLI FXOW WR VWRS HYHQ LI WKH XQGHUO LQJ FDXVH LV corrected 76 10 This recreational vehicle is equipped with...

Страница 63: ...the brand installed on your RV They are not to be returned to your dealer or Jayco Do not use the stabilizer jacks to support the RV while under the vehicle or changing tires The stabilizer jacks are...

Страница 64: ...ally it is fastened to the sidewall of the compartment Insert the crank handle into the crank access port located either in the center of the rear bumper or in the sidewall of the RV Turn the crank ha...

Страница 65: ...emove the tire from the tire carrier 1 Remove the lug nuts holding the tire in place 2 Remove the support bracket from the bottom lug 3 Pull the tire from the tire carrier To install the tire on the t...

Страница 66: ...Packet for operating and safety information Awning care It is a good idea to keep the awnings in the closed position if you will be away from the recreation vehicle for an extended period of time Keep...

Страница 67: ...ng and safety information Adjusting the Awning Pitch The longitude arms have 6 pitch adjustment settings from minimum pitch to maximum pitch The awning can be extended and retracted in any of these po...

Страница 68: ...r The cover snaps onto the rear cover To remove press on both sides of the rear cover until the front cover releases then lift the cover off 2 Detach the RED and BLACK wires from the cable to the moto...

Страница 69: ...over a short time period may cause the circuit to sense an overheat condition and shut off the motor If this occurs wait approximately 15 minutes to allow the motor to cool then operate the awning in...

Страница 70: ...60 VEHICLE OPERATION Notes...

Страница 71: ...URRP V VWHP LV GHVLJQHG IRU DGGLWLRQDO RRU VSDFH DQG FRPIRUW 7KH PHFKDQLFDO components are gear driven Electric powered slideout room systems have a manual override to allow you to extend or retract t...

Страница 72: ...teps Check the auxiliary battery customer supplied for a full charge and good wire connections Check the 12 volt fuse or circuit breaker Check for loose connections at the slideout motor If the slideo...

Страница 73: ...H WR SRZHU RII the remote DO NOT try and time the end of the stroke by releasing the button early ALWAYS allow the controller to stop both motors before releasing the switch button Retracting slideout...

Страница 74: ...d or retract the room Consult Customer Service before attempting to jump the auxiliary battery Only 1 Side Moving The inwall room slide has a separate motor to operate each side of the room Does only...

Страница 75: ...elease the mode button 5 Use either a wall switch or one of the slide room switches located on the command center panel depending on the slideout Press the switch toward the word IN or RETRACT printed...

Страница 76: ...When an error code occurs during operation the board will use the LEDs lights to indicate ZKHUH WKH SUREOHP LV RU PRWRU VSHFL F IDXOWV WKH JUHHQ ZLOO EOLQN WLPH IRU PRWRU 1 and 2 times for motor 2 The...

Страница 77: ...f the slideout is retracted leave it in that position Contact your dealer or customer service for repair assistance If the slideout extends crooked or only one side moves follow these steps ROORZ VWHS...

Страница 78: ...f 4 major components Inner rail assemblies to support the room weight A 12 Volt DC gear motor to operate the room using power from the onboard battery A manual override that allows you to extend or re...

Страница 79: ...he room into position If the slideout switch is held after the room is fully extended the control will sense that the room has stopped and will shut the motor off after a few seconds 4 Install the tra...

Страница 80: ...er clockwise looking from Always disconnect battery from system prior to manually operating system Failure to disconnect battery can cause electricity to backfeed through the motor and cause serious d...

Страница 81: ...gearbox override optional use the crank handle to move the room 7 When the room is fully in or out have one person apply pressure to the wrench ratchet and return the brake lever to its engaged positi...

Страница 82: ...72 ELECTRICAL SYSTEM Notes...

Страница 83: ...condition 6HUYLFH DQG RU PRGL FDWLRQ RI WKH HOHFWULFDO V VWHP VKRXOG RQO EH SHUIRUPHG E TXDOL HG electrical technicians using approved materials components and methods meeting current safety and code...

Страница 84: ...MA 14 50 RV receptacle and not 240 volt AC 9 40 0 GFCI RECEPTACLE Grounding is your personal protection from electrical shock Each recreation vehicle has a ground fault current interrupter GFCI engine...

Страница 85: ...le is properly wired and grounded Reverse polarity and or improper grounding of your RV can cause personal injury or death 9 40 0 50 AMP POWER CORD IF SO EQUIPPED The 50 amp external utility power cor...

Страница 86: ...eaker 5 To help prevent power surges from damaging the connected loads please follow these instructions when hooking up to the external power source The shore line power cord should be unplugged when...

Страница 87: ...0 calculated by dividing appliance wattage consumed normally listed on the appliance by nominal design voltage 120 for a 120 volt appliance For example 1200 watts divided by 120 volts equals 10 amps...

Страница 88: ...onverts 120 volt AC power to useable 12 volt DC power when the shore power cord is connected to an external power source The converter has a built in protective thermal breaker that will shut it down...

Страница 89: ...HHQ DVKHV HYHU VHFRQGV 2XWSXW YROWDJH KDV EHHQ reduced to 13 2VDC the RV battery is fully charged and converter is maintaining the charge Also included is a Wizard Mode Button used to override the Cha...

Страница 90: ...power outlets in your recreation vehicle When the 12 volt DC outlet is used as a power source for an electric appliance make sure the appliance operates on 12 volt DC power and that it consumes less t...

Страница 91: ...include any 12 volt lights water pump or any other 12 volt component If the furnace and refrigerator in the above example operated constantly a 75 amp hour battery would become fully discharged in 5 h...

Страница 92: ...l 12VDC power to the fuse panel in the RV Battery Disconnect Switch BATTERY ISOLATOR FOR YOUR TOW VEHICLE CUSTOMER SUPPLIED You may want to consider the installation of a battery isolator on your tow...

Страница 93: ...uble Lights 18 2 5 AMPS Furnace 12 0 AMPS Generator Start 95 0 AMPS Halogen Light 1 7 AMPS Illuminated Switch 125 AMP Inverter variable Leveling System 95 0 AMPS LP Detector 125 AMP Map Light 1 5 AMPS...

Страница 94: ...ll other appliances 3 Check for fuel exhaust and coolant leaks STOP the generator immediately if there is a fuel exhaust or coolant leak and have it repaired CARBON MONOXIDE IS DEADLY Do not run the g...

Страница 95: ...Exercising Your Generator it s also very important to run your generator regularly to keep Excessive cranking can overheat and damage the generator starter motor Do not crank for more than 20 seconds...

Страница 96: ...vary by model but may be located either on the sidewall on the A frame of the vehicle or in the outside utility center There are capped off wires located in the area of the battery These wires are th...

Страница 97: ...wning LED lights front cap LED accent lights Cargo bed red lighted master control switch Slideout control switches press and hold to extend retract Awning control switches press and hold to extend ret...

Страница 98: ...g the recreation vehicle Inverter panel power switch with display Generator start stop control with hour meter Cargo bed red lighted master control switch Power bunk bed lift control switch Fuel gauge...

Страница 99: ...xide safety If you are in a recreation vehicle with either a nearby tow vehicle engine running or the generator if so equipped running there is a potential for H KDXVW IXPHV WR OWHU EDFN LQWR WKH UHFU...

Страница 100: ...N Do not check for leaks using products that contain ammonia or chlorine these products can cause FUDFNV WR IRUP RQ WKH PHWDO WXELQJ DQG EUDVV WWLQJV 0 4 PROPANE SAFETY PROCEDURE 3URSDQH LV D FRORUOHV...

Страница 101: ...e on gas grills and other low pressure devices DOT cylinders equipped with DQ 23 DQG 0 W SH VHUYLFH YDOYH DUH LGHQWL HG E WKH WULDQJXODU VHUYLFH YDOYH NQRE DOT cylinders are typically marked with top...

Страница 102: ...s released from the container it changes to vapor which is then used for the operation of the appliances Propane will not run through the appliances in the liquid state Propane expands 1 percent for e...

Страница 103: ...HYHO DV LQGLFDWHG E WKH HG OLTXLG OHYHO JDXJH R QRW DOORZ WKH YLVLEOH JDXJH WR EH XVHG IRU OOLQJ 2YHU OOLQJ WKH propane container above the liquid capacity indicated on the container could allow liqui...

Страница 104: ...ousing so the vent is pointed downward 4 WWDFK WKH LQYHUWHG DUH 7 SH SLJWDLO KRVH WR WKH UHJXODWRU LQOHW DQG WKH right hand swivel nut to the cylinder valve Main Supply Hose Low Pressure WWDFK WKH PDL...

Страница 105: ...EH UH OOHG Do not attempt to repair any containers container valves regulator or appliances by yourself 8VH RQO WUDLQHG FHUWL HG SURSDQH JDV VHUYLFH WHFKQLFLDQV WR SHUIRUP UHSDLUV 3URSDQH F OLQGHU UHF...

Страница 106: ...DLQHU SUHVVXUH WR OEV 7KH VHFRQG stage reduces the 10 13 lbs of pressure further to an operating pressure of 11 W C water column or 6 35 oz of outlet pressure to your appliances 7KH VHFRQG VWDJH LV DG...

Страница 107: ...IUHH H XS 6KRXOG RX H SHULHQFH propane freeze up close the main valve and wait 15 minutes before trying again 3 LVWHQ FDUHIXOO DV SURSDQH EHJLQV WR RZ I D KLVVLQJ QRLVH LV KHDUG IRU PRUH WKDQ RQH or...

Страница 108: ...imited due to the size of the recreation vehicle Proper ventilation when using the cooking appliance s will help you avoid the danger of asphyxiation It is especially important that cooking appliances...

Страница 109: ...is properly fastened in place Some states prohibit propane appliances to be operated during travel especially in underground tunnels Make sure you know the laws for the areas where you travel 7KH ODEH...

Страница 110: ...100 FUEL PROPANE SYSTEM Notes...

Страница 111: ...care of all the components within the plumbing system and help discourage the growth of bacteria and other organisms that can contaminate the water supply 7 SLFDOO WKHUH DUH ODEHOV DI HG WR WKH H WHUL...

Страница 112: ...the water pump will run until it reaches 45 lbs of pressure It will recycle when pressure drops The switch will light up when it is turned ON Turn the switch OFF when the water pump is not being used...

Страница 113: ...use water in your recreation vehicle and it is not hooked up to city water RX ZLOO QHHG VXI FLHQW YROW SRZHU WR UXQ WKH ZDWHU SXPS Once activated the water pump also known as the demand pump will sel...

Страница 114: ...VZLWFK XVHG WR WXUQ LW RQ H J LI WKH SXPS LV turned on at the utility center it cannot be turned off with the switch LQVLGH WKH 59 DW WKH FRPPDQG FHQWHU t it h h ld b i th OFF iti h th RV i l ft tt d...

Страница 115: ...n winterizing to avoid damage to the water heater 7 Rinse the black tank to help control odors and prevent waste buildup 8 Rinse off items outside the unit with hot cold faucet 9 Connect up to 3 coax...

Страница 116: ...s the functions of the utility center water valves as displayed on the valve operation label located on the utility center front panel POWER FILL TANK Pressurized fresh water source 1 Connect the fres...

Страница 117: ...d of the hose in a container holding sanitizing solution 4 Turn the pump switch ON 5 Fresh water tank should begin drawing solution out of the container To aid siphoning place the container on a surfa...

Страница 118: ...ize the water lines 2 Set the color coded valves to the WINTERIZE setting A White handle pointing down B Blue handle pointing left C Black handle pointing right D Red handle pointing left E Green hand...

Страница 119: ...rn off water supply using two valves located on the water lines on each side of the canister 2 3ODFH GULS SDQ EHORZ OWHU KRXVLQJ WR FDWFK DQ VSLOODJH 3 3UHVV WKH UHG EXWWRQ RQ WRS RI WKH OWHU KRXVLQJ...

Страница 120: ...microbiologically unsafe or of unknown quality Maximum operating pressure is 125 psi 8 75 bar Maximum water temperature is 125 F 52 C 76 10 WATER HEATER 7KH ZDWHU KHDWHU LV GHVLJQHG WR KHDW ZDWHU TXLF...

Страница 121: ...Double check the bypass valves make sure they are set properly Always RSHQ ERWK WKH KRW DQG FROG ZDWHU IDXFHWV ZKHQ OOLQJ WKH IUHVK ZDWHU WDQN WR DOORZ air pockets to be forced out of the water heate...

Страница 122: ...erating the water heater without the proper anode rod protection will decrease tank life and will void the tank manufacturer s warranty on the tank To extend the anode life drain the water from the wa...

Страница 123: ...ate a defective relief valve One way to reduce the frequency of this occurrence is to maintain an air pocket at the top of the water heater tank This air pocket will form in the tank by design however...

Страница 124: ...o the water heater either at the switch from the electrical element of at the breaker 2 Shut off the propane supply to the water heater 3 Turn off the pressure pump on the water system 4 Open both hot...

Страница 125: ...KHDW WKH ZDWHU 2 Open the outside shower compartment door 3 If dry camping be sure the 12 volt water pump is ON 4 Remove the handheld shower from its holder 5 Turn ON the hot and cold faucet knobs an...

Страница 126: ...e the recreation vehicle does not contain a water pressure balance valve If someone is using the shower it is recommended that the fresh water system NOT BE USED XQWLO WKH DUH QLVKHG Maintenance Refer...

Страница 127: ...H H WHULRU VLGHZDOO JR LQVLGH WKH PRWRU KRPH WR QG WKH corresponding location of the drains 5 Drain the sink by removing the drain cap 6 Turn ON the water pump and allow it to run as needed 7 I WKH 59...

Страница 128: ...water system If a 100 ppm concentration is required as discussed in step 12 use cup of household bleach with one gallon of water to prepare the chlorine solution One gallon of the solution should be u...

Страница 129: ...drain the chlorine solution from the fresh water system see Draining the Fresh Water System Rinse the system with fresh water 13 Fill the fresh water tank full of clean potable water Use water from ei...

Страница 130: ...U ZDWHU OWHU UHPRYH WKH FDQLVWHU WDNH RXW WKH OWHU WKHQ UH DWWDFK the empty canister After draining the system 1 Water heater power should still be OFF both switches electric LP Gas 2 Put the vinegar...

Страница 131: ...PRXQW 12 5H OO WKH IUHVK ZDWHU V VWHP ZLWK FOHDQ ZDWHU 13 After the water tank set the valves to either DRY CAMPING or CITY WATER in order IRU ZDWHU WR RZ WKURXJK WKH ZDWHU KHDWHU DJDLQ WINTERIZING T...

Страница 132: ...rain could potentially damage the seals and cause water leaks If you have questions consult with your RV dealer Using RV antifreeze is the preferred method of winterization 9 40 0 Pressure Method NOTE...

Страница 133: ...ility center 2 Level the RV and drain the fresh water plumbing system See Draining the Fresh Water System 3 5HSODFH WKH ZDWHU OWHU FDUWULGJH ZLWK WKH SODVWLF E SDVV KRVH LI VR HTXLSSHG 2Q IXOO V VWHP...

Страница 134: ...nk There are no dedicated water heater bypass valves BLACK GREY WATER SYSTEM DWHU IURP WKH VLQNV DQG VKRZHU RZV LQWR WKH JUD ZDWHU RU ZDVWH ZDWHU KROGLQJ WDQN DWHU IURP WKH WRLOHW ZLOO RZ LQWR WKH VHZ...

Страница 135: ...pes With Dry Sealing Valve If So Equipped Your RV may be equipped with a dry sealing valve that prevents the escape of odors from your waste system and eliminates the need for P traps Should the RV dr...

Страница 136: ...refrigerator water line until only air comes out of the dispenser 8 5HPRYH WKH UHIULJHUDWRU ZDWHU OWHU DQG H WUDFW ZDWHU RXW RI WKH OWHU XVLQJ D VZLIW ZULVW LFN PRWLRQ OLNH LFNLQJ ZDWHU RXW RI D SDLQ...

Страница 137: ...e of the icemaker and pulling the tray out Discard any ice or water in the bin 5 Find the Test Switch on the icemaker photo at right Press and hold this button for 8 seconds to initiate a test cycle w...

Страница 138: ...eeze down into the pump Stop the washer and unplug it Wipe out any excess antifreeze in the drum De winterizing the Whirlpool Clothes Washer Run a full empty wash cycle before camping season begins Wi...

Страница 139: ...all s Rand McNally Camp Guide Good Sam Camp Guide KOA Kampgrounds Camp Guide and various other publications Some fuel stations also have dump stations Please contact your RV dealer for assistance in t...

Страница 140: ...s and dump valves BLACK TANK FLUSH RINSING THE WASTE TANK 7KH WDQN XVK LQOHW DOVR NQRZQ DV WKH QR IXVV XVK is the black inlet located on the utility center panel 7KLV LQOHW LV SURYLGHG WR DVVLVW LQ XV...

Страница 141: ...18 C All of the heaters are controlled by a single ON OFF switch Typically this red tank heater ON OFF switch is located on the command center panel or in the bathroom The switch lights up red when it...

Страница 142: ...outside temperature approaches and maintains freezing conditions 35 F 2 C or colder The tank heater switch should be turned OFF When there is NO liquid present tanks are empty When dumping the black a...

Страница 143: ...RZ LQWR WKH KROGLQJ tank Waste grey holding tank preparation No special preparation is required however placing a small quantity of chemicals into this tank such as baking soda or an approved RV chem...

Страница 144: ...134 PLUMBING SYSTEM Notes...

Страница 145: ...f So Equipped The wall mounted air conditioning system is controlled by a thermostat Cooled air enters WKH 59 WKURXJK WKH JULOO 0DNH VXUH RX KDYH VXI FLHQW SRZHU DYDLODEOH EHIRUH RSHUDWLQJ WKH DLU FRQ...

Страница 146: ...ceiling fan is controlled by the pull chain switch The sequence of operation for the pull chain switch is OFF High Medium Low OFF The slide switch located on the fan controls the direction of operati...

Страница 147: ...personal injury or loss of life 9 40 0 To ensure your personal safety do not obstruct or alter the furnace in any manner Do not install screens over the vent for any reason Screens will become restric...

Страница 148: ...138 HEATING COOLING Notes...

Страница 149: ...cleaner Turntable mild soap and water or dishwasher Rack s mild soap water and washcloth Dishwasher cleaning is not recommended Convection Microwave if so equipped For details on operation cleaning an...

Страница 150: ...if so equipped Never leave cooking food unattended Turn pan handles inward but not over the tops of the other range burners Ensure that pans used are large enough to contain the food and avoid boil o...

Страница 151: ...n griddle or any other large utensil that covers more than one burner at a time This will create excessive heat that may cause melting sooting or discoloration The use of undersized pans could expose...

Страница 152: ...f vent or the range hood vent LI VR HTXLSSHG GAS BBQ GRILL IF SO EQUIPPED Be sure to read understand and follow all information supplied with your recreation vehicle concerning the use of propane befo...

Страница 153: ...nd mounting bar The pin must be installed to insure the mounting bar is secure during use Tighten the T handle on the bracket mounted to the bumper Set the BBQ grill on the mounting bar by inserting t...

Страница 154: ...quick coupler connection and support bracket for easy installation of the BBQ grill Attaching the quick coupler connection The quick coupler is directly connected to the RV propane system The quick co...

Страница 155: ...ed with this appliance Use of an extension cord is not recommended If one must be used use the shortest length possible Do not connect 2 or more extension cords together Keep connections off the groun...

Страница 156: ...sed from the cart by pressing two red buttons on the cart The cart includes two hooks to hang grill tools on The cart folds up as shown and the grill lid can be secured with a webbed velcro strap When...

Страница 157: ...and free of debris Check for obstructions in the exterior refrigerator vent area i e spider webs bird nests etc Use a soft cloth to dust off the debris RU RSWLPXP HI FLHQF DQG SHUIRUPDQFH LW LV UHFRPP...

Страница 158: ...the condenser 5HSODFH WKH EDVH JULOOH ZKHQ QLVKHG Cleaning the exterior Painted metal exteriors wash with a clean sponge or soft cloth and a mild detergent in warm water Stainless steel exteriors was...

Страница 159: ...your recreation vehicle Dryer prep has been designed for electric dryer operation ONLY 9 40 0 CENTRAL VACUUM SYSTEM IF SO EQUIPPED The following is an overview of the central vacuum system operation F...

Страница 160: ...ufacturer s user guide for important safeguards and operating instructions Read all instructions before operating the vacuum cleaner WATER HEATER SEE PLUMBING SECTION DO NOT PICK UP FLAMMABLE OR COMBU...

Страница 161: ...2 Switch the power supply ON and OFF to see if there is a difference in the picture quality while watching TV If there is no difference refer to manufacturer s manual for further testing procedures Lo...

Страница 162: ...ON sends 12 volt DC through the cable to the TV roof antenna The voltage energizes the WUDQVLVWRUV LQ WKH DQWHQQD KHDG DPSOL HU 7KH 79 VLJQDO WKHQ FRPHV GRZQ the cable to the outlets Turn the TV powe...

Страница 163: ...not to get the power cord or the antenna cable caught in the mechanism 3 Push it all the way back into the compartment until it stops Firmly push it into place until the yellow tipped lever locks it...

Страница 164: ...154 ELECTRONICS...

Страница 165: ...eather if so equipped It is recommended the Ultraleather be professionally cleaned if it becomes stained or VRLOHG RU PRUH LQIRUPDWLRQ UHIHU WR WKH VSHFL F IXUQLWXUH PDQXIDFWXUHU V FDUH LQVWUXFWLRQV L...

Страница 166: ...brics of the shades on a regular basis Shades should be kept in the closed or up position when not in use to maintain pleat retention and minimize dirt and soil build up Do not store shades in the dow...

Страница 167: ...PED The dinette is designed to seat up to four adults Depending on your model there may be a storage area in the dinette bench To access this storage remove all the cushions and lift up on the bottom...

Страница 168: ...s load capacity is designed by weight not volume so you cannot necessarily use all available space If your pantry or hutch has sliding pantry shelves they have been equipped with a locking mechanism t...

Страница 169: ...unnecessary damage to the countertops Do not cut directly on the solid surface countertop Use potholders or trivets before placing hot pots and pans on the countertop Heat will damage the countertop R...

Страница 170: ...RQ WKH HQWLUH RRU 2 127 62 7 225 1 8VH FDUH WR DYRLG ZHWWLQJ WKH FDUSHW HGJHV 7R DYRLG SUREOHPV RI HOORZLQJ OLQROHXP WKH RRULQJ PDQXIDFWXUHU UHFRPPHQGV avoiding cleaners that contain oil based solvent...

Страница 171: ...using a mild liquid soap Dry wiping with a dry cloth is not recommended Make sure the recreation vehicle s surface temperature is cool under 90 F and out of direct sunlight A shaded area is ideal for...

Страница 172: ...YHKLFOH V QLVK H VXJJHVW XVLQJ a damp natural or synthetic chamois There are other drying products such as lint free PLFUR EHU WRZHOV WKDW ZRUN MXVW DV ZHOO During cold weather Salt and other chemica...

Страница 173: ...se warm water and a soft cloth or chamois to remove any white residue from dark colored plastic surfaces Do not use a scrubbing brush other hard tools or wax containing abrasives as they may damage th...

Страница 174: ...ct the refrigerator and holding tank vents for blockages from bird nests spider webs leaves etc All exterior access doors and vents need to be kept clean and free of obstructions i e insect nests mud...

Страница 175: ...elp you obtain the correct sealant s The sealants may become damaged due to road vibration ultraviolet exposure air pollution freezing temperatures and exposure to other elements If deteriorated repai...

Страница 176: ...166 EXTERIOR Notes...

Страница 177: ...ry De winterize and sanitize the fresh water system Connect your tow vehicle to the RV and test all connections and lights READY TO LEAVE MAINTENANCE CHECKLIST Before leaving or returning home it is c...

Страница 178: ...ipped Water hose electric cord unhooked and stored Test brakes for proper operation Secure any loose heavy or sharp objects in the RV or exterior compartments Fasten all interior and exterior doors se...

Страница 179: ...hen storing your RV it is recommended that the auxiliary battery customer supplied be disconnected to avoid battery discharge Prior to Storage If storing for the winter be sure the RV is winterized re...

Страница 180: ...e Remove all perishables from the cabinets Leave the cabinets and doors ajar to allow air circulation and prevent mildew and musty odors Remove all perishables from the cabinets Leave the cabinets and...

Страница 181: ...terprises www kib us Outside Shower Utility Center B B Molders www bandbmolders com Propane Tank Manchester Tank www mantank com P r o p a n e C a r b o n Monoxide Alarm See manufacturers user guide P...

Страница 182: ...172 ADDITIONAL INFORMATION VEHICLE MAINTENANCE RECORD Make Model Model Year Vehicle Serial Service Date Mileage Work Performed Performed By Notes...

Страница 183: ...173 ADDITIONAL INFORMATION Service Date Mileage Work Performed Performed By Notes Table of Contents Table of Contents Maintenance Record Maintenance Record...

Страница 184: ...174 ADDITIONAL INFORMATION Notes...

Страница 185: ...175 ADDITIONAL INFORMATION Notes Table of Contents Table of Contents Maintenance Record Maintenance Record...

Страница 186: ...________________________ City ____________________ State Province ______ Zip Code_________ Phone ___________________ E Mail Address _________________________ Previous Owner Information Purchased Date...

Страница 187: ...177 ADDITIONAL INFORMATION Notes Table of Contents Table of Contents Maintenance Record Maintenance Record...

Отзывы:

Похожие инструкции для PINNACLE