manualshive.com logo in svg

Mitsubishi MOTORS Outlander 2007, Руководство по обслуживанию, техническая информация и данные по ремонту кузова, Страница: 357 / 473

Поделиться
Скачать
Mitsubishi MOTORS Outlander 2007 Скачать руководство пользователя страница 357

The rear washer relay turns ON after the rear washer
switch has been ON for 0.3 second, then turns the rear
wiper  drive  signal  ON  to  operate  the  rear  wiper
simultaneously.  When  the  rear  washer  switch  is
turned OFF, after 3 seconds the rear wiper is turned
OFF.

If the rear washer switch is turned ON during the rear
wiper  operation,  7.4  seconds  after  turning  OFF  the
rear  wiper  drive  signal  turns  OFF,  the  intermittent
action is resumed in 8 second intervals.

016'

7UKPIVJGEQPHKIWTCVKQPHWPEVKQPVJG

YCUJGTNKPMGFTGCTYKRGTHWPEVKQPECPDGVWTPGF
QHH4GHGTVQ2

OUTSIDE MIRROR

M25100000081USA0000010000

CONSTRUCTION DIAGRAM

ZC6002290001

Door mirror assembly

Mirror glass

Remote control 
mirror switch

Door mirrors have the following features:

Remote controlled door mirrors have been adopted.

Door  mirrors  with  heater  element  have  been
adopted.

Large size mirror glass has been adopted for easy
confirmation of safety around the vehicle.

Low  air  resistance  door  mirror  shape  has  been
introduced.

Flag  type  which  secures  sufficient  distance
between the door mirror and delta pillar has been
adopted to reduce the blind spot area of the forward
view.

CONFIGURATION FUNCTION

M25100000092USA0000010000

Using the M.U.T.-III scan tool, the following functions
can be programmed. The programmed information is

kept  in  memory  even  when  the  battery  is
disconnected.

':6'4+14

1765+&'/+4414

Содержание Outlander 2007

Страница 1: ...1 2007 Outlander Service Manual Technical Information Body Repair Manual Data Volume 1 Volume 2 Volume 3 Technical Information Manual Body Repair Manual ...

Страница 2: ... 4172 0 4 106 065 19 61 75 6 5 07 6 4 65 1 8 12 06 6 0 674 5 6 4 14 06 4 14 0 0 64 05 5752 05 10 6 8 5 6 2 55 8 5 6 08 410 06 2416 6 10 5 48 6 0 4 6 8 06 6 10 0 4 6 0 52 6 105 ...

Страница 3: ...e hand Security Transmitter F A S T key TARGETS OF DEVELOPMENT M20000000040USA0000010000 The new OUTLANDER has an improved SUV appearance and cruising performance in any road conditions This car has been developed as the new generation of SUV proposed by Mitsubishi aiming to be an all round car for various applications from daily use to cruising and leisure use 6 0 674 5 EXTERIOR M20000000170USA00...

Страница 4: ...with a sense of integrity with the glass area presenting a high tech image INTERIOR M20000000180USA0000010000 DESIGN PURPOSE Presenting well trimmed interior space with a sporty feel Combining high functionality with stylish design Neat and carefully established details MAIN FEATURES ZC6022030000 Sporty and dynamic styled instrument panel with uplifting feeling Unique audio panel integrated in the...

Страница 5: ...00010001 The F6AJA type FWD or the W6AJA type AWD 6 speed sport mode automatic transaxle has been developed to achieve excellent fuel economy further improved operation and driving pleasure SUSPENSION M20000000230USA0000010000 ZC601177 Front suspension 0000 Stabilizer bar Coil spring Shock absorber Stabilizer link Lower arm Front axle crossmember Flat crossmember 0 4 6 0 674 5 ...

Страница 6: ...tabilizer bar Coil spring Shock absorber AWD Shock absorber Stabilizer bar Rear crossmember Coil spring Trailing arm Toe control arm Upper arm 0000 The well proven McPherson strut suspension front and trailing arm type multi link suspension rear have been adopted 0 4 6 0 674 5 ...

Страница 7: ...ed sensor Magnetic encoder for wheel speed detection 0001 The ABS 1has been installed as standard equipment to prevent the wheels from locking and optimize the longitudinal brake force distribution depending on the road surface and loading conditions In addition the ASC 2has also been installed to suppress side slip and wheel spin during steep steering or on a slippery road surface ensuring the id...

Страница 8: ...AIRBAGS AND CURTAIN AIR BAGS During a side collision the SRS side airbags embedded in the front seat side area soften blows to the front passenger s chest area and the SRS curtain air bags integrated into the roof side area soften blows to the front rear passenger s head area FRONT SEAT BELT A seat belt with double pre tensioner for shoulder and lap has been installed on the driver s seat A seat b...

Страница 9: ...al recede control device ENVIRONMENTAL PROTECTION M20000000270USA0000010000 RECYCLING Recyclable thermoplastic resin and recycled materials have been actively used and multilayer materials have been integrated into thermoplastic resin Classification Main contents Components made of recycled materials Chip materials produced during manufacturing process have been reused for the following components...

Страница 10: ...dition it is also possible to read the diagnosis codes by the flashing of the warning light in some systems Multiport fuel injection system MFI Electronically controlled AWD 6 speed sport mode automatic transaxle ABS with EBD Active Stability Control ASC Power windows Keyless Operation System KOS SRS air bag Immobilizer Combination meter Headlight auto leveling 6 disc CD changer and AM FM radio ET...

Страница 11: ...ll vehicle identification numbers contain 17 digits The vehicle number is a code which tells country make vehicle type etc No Item Content 1 Country J Japan 2 Make A Mitsubishi 3 Vehicle type 4 Multi purpose vehicle 4 Others GROSS VEHICLE WEIGHT RATING BRAKE SYSTEM M 5001 6000 lbs HYDRAULIC 5 Line S OUTLANDER FWD T OUTLANDER AWD 6 Price class 3 Medium 4 High 7 Body 1 5 door wagon 8 Engine X 3 0L 6...

Страница 12: ...REGULATION VIN except sequence number Brand Engine displacement Model code JA4MS31X_7U MITSUBISHI OUTLANDER 3 0L CW6WXLSYL7M JA4MS41X_7U CW6WXLHYL7M CW6WXLXYL7M JA4MT31X_7U CW6WXLSYZL7M JA4MT41X_7U CW6WXLHYZL7M CW6WXLXYZL7M VEHICLES FOR PUERTO RICO VIN except sequence number Brand Engine displacement Model code JA4MS31X_7U MITSUBISHI OUTLANDER 3 0L CW6WXLSYL2M CW6WXLMYL2M JA4MS41X_7U CW6WXLXYL2M J...

Страница 13: ...heelbase 4 2 670 105 1 2 670 105 1 2 670 105 1 2 670 105 1 Tread front 5 1 540 60 6 1 540 60 6 1 540 60 6 1 540 60 6 Tread rear 6 1 540 60 6 1 540 60 6 1 540 60 6 1 540 60 6 Overhang front 7 965 38 0 965 38 0 965 38 0 965 38 0 Overhang rear 8 1 005 39 6 1 005 39 6 1 005 39 6 1 005 39 6 Ground clearance 9 215 8 5 215 8 5 215 8 5 215 8 5 Vehicle weight kg lb Curb weight 1 615 3 560 1 635 3 604 1 680...

Страница 14: ... 60 6 1 540 60 6 Tread rear 6 1 540 60 6 1 540 60 6 1 540 60 6 Overhang front 7 965 38 0 965 38 0 965 38 0 Overhang rear 8 1 005 39 6 1 005 39 6 1 005 39 6 Ground clearance 9 215 8 5 215 8 5 215 8 5 Vehicle weight kg lb Curb weight 1 675 3 692 1 670 3 681 1 735 3 825 Gross vehicle weight rating 2 300 5 071 2 350 5 181 Gross axle weight rating front 1 090 2 403 Gross axle weight rating rear 1 280 2...

Страница 15: ...0 60 6 1 540 60 6 1 540 60 6 1 540 60 6 Tread rear 6 1 540 60 6 1 540 60 6 1 540 60 6 1 540 60 6 Overhang front 7 965 38 0 965 38 0 965 38 0 965 38 0 Overhang rear 8 1 005 39 6 1 005 39 6 1 005 39 6 1 005 39 6 Ground clearance 9 215 8 5 215 8 5 215 8 5 215 8 5 Vehicle weight kg lb Curb weight 1 615 3 560 1 680 3 703 1 670 3 681 1 735 3 825 Gross vehicle weight rating 2 300 5 071 2 350 5 181 2 300 ...

Страница 16: ... 4172 0 0 106 065 0 4 5 4 26 10 5 0 0 ...

Страница 17: ...aft MAJOR SPECIFICATIONS ITEMS SPECIFICATIONS Total displacement cm3 cu in 2 998 182 9 Bore Stroke mm in 87 6 3 45 82 9 3 26 Compression ratio 9 5 Combustion chamber Pentroof type Camshaft arrangement SOHC Valve timing Intake Open 1 BTDC Low speed cam 18 BTDC High speed cam Intake Close 37 ABDC Low speed cam 86 ABDC High speed cam Exhaust Open 55 BBDC Exhaust Close 17 ATDC Maximum output kW r min ...

Страница 18: ... intake and exhaust ports have been adopted Two intake ports and two exhaust ports are provided independently on the right and left sides Four camshaft bearings are provided at the intake and exhaust sides respectively The No 4 bearing sustains the thrust load of the camshaft VALVE SEAT The valve stem seals use springs with good seal performance to prevent oil draining down The oversize valve guid...

Страница 19: ... Water hole A 2 layer metal gasket with good sealability and heat resistance is used for the cylinder head gasket ROCKER COVER ZK602584AA00 Timing belt side Blow by nipple P C V valve Blow by nipple A lightweight resin material is used for the cylinder gasket cover 0 0 5 0 0 ...

Страница 20: ...loy material is used for the cylinder block to be lightweight The crankshaft journal has 4 bearings The No 3 bearing carries the thrust load of the crankshaft A full Siamese type water jacket is used Items Specifications Bore mm in 87 6 3 45 Bore pitch mm in 98 3 86 Stroke mm in 82 9 3 26 0 0 5 0 0 ...

Страница 21: ...nter towards the thrust side Out side surface of piston skirt has striation like finishing better oil holding ability and superior durability against scuffing Items Specifications Basic diameter mm in 87 6 3 45 Pin hole diameter mm in 22 0 87 Overall height mm in 47 78 1 88 PISTON PIN ZK602587AA00 D d1 h d2 Semi floating piston pin is adopted Piston pin is into the small end of connecting rod so t...

Страница 22: ...rail Maker mark Oil ring AA00 Piston ring consists of ring No 1 No 2 and oil ring Items Piston ring No 1 Piston ring No 2 Oil ring Shape Barrel Taper 3 piece Barrel Surface treatment cylinder contact surface Chrome nitride PVD Parkerizing resin coating Hard plated Parkerizing Supplier mark 1T 2T None 0 0 5 0 0 ...

Страница 23: ...end hole diameter D mm in 56 2 20 Center to center distance L mm in 145 5 71 CONNECTING BEARING ZK602592 AA00 H A Identification color Upper and lower bearings are same parts This part consists of overlay surface copper alloy plate middle and steel plate back side To reduce friction loss width of connecting rod bearing is designed as short as possible composed with crankshaft journal Items Specifi...

Страница 24: ...n outer diameter mm in 53 2 09 Journal outer diameter mm in 69 2 72 CRANKSHAFT BEARING AND THRUST BEARING ZK602594 Oil hole Oil groove Identification color Identification color Lower bearing Upper bearing Groove Thrust bearing Engine front Crankshaft bore identification mark Cylinder bore identification mark Main bearing consists of aluminum alloy surface and steel plate backside Thrust bearing wh...

Страница 25: ...ing has 6 rib for power steering pump and 4 rib for alternator and air compressor drive belt Timing mark notch is applied at the flange of 4 rib side DRIVE PLATE ZK602596AA00 The drive plate is made of sheet metal The drive plate is mounted with 8 bolts 0 0 5 0 0 ...

Страница 26: ...sing the highly strengthen timing belt the belt is narrow and long lasting This allows the friction to be decreased and the engine weight to be lightweight By abolishing a traditional eccentric pulley the tensioner is designed to be lightweight By applying the projection of the timing belt cover the timing belt is prevented from coming off the tooth VALVE ZK602600 Intake Exhaust L L D d d D 0 0 5 ...

Страница 27: ... good sealing spring on the valve stem seal VALVE SPRINGS ZK602590 h AA00 To prevent surging during high speed variable pitch springs are used Items Intake valve Exhaust valve Free height h mm in 59 15 2 33 57 7 2 27 Total number of windings 10 61 9 39 CAMSHAFT ZK602602AA00 AB C A B AB C A B AB C A B AB C A B AB C A B AB C A B The camshaft has the two kinds of the cams for high speed and low speed...

Страница 28: ...valve lifts high In the range of the low engine speed the flow within the valves is enhanced by the difference between the valve lifts Also the stabilization of the combustion is designed for low fuel economy low exhaust gas and high torque At high engine speeds the high output due to the increment in the intake air amount is reached by increasing the open valve period and the lift A T lever moves...

Страница 29: ...he exhaust rocker shaft Oil supply to the intake rocker shaft is controlled by ON OFF of the oil control valve OCV and carries out the switching for the low middle and high lift cams ZK602603 Oil control valve filter AA00 Rocker arm piston T lever Power train control module PCM Oil control valve OFF When the OCV is in the OFF position the switch over piston does not operate because the switch over...

Страница 30: ...er When the OCV is in the ON position the switch over piston is pushed by the oil pressure because the switch over oil pressure within the intake rocker shaft is above the specified pressure and so the wing of the T lever reaches the switch over piston Accordingly the intake valve is driven by the T lever 0 0 5 0 0 ...

Страница 31: ...O ring Spool Housing Oil drain The oil feeder control valve uses electromagnetic valve mechanism to change oil pressure to rocker arm and rocker shaft that drive MIVEC The oil feeder control valve uses electromagnetic valve mechanism to change oil pressure to rocker arm and rocker shaft that drive MIVEC 0 0 5 0 0 ...

Страница 32: ...54 1 GROUP 54 CHASSIS ELECTRICAL CONTENTS CHASSIS ELECTRICAL 54A AUDIO AND NAVIGATION SYSTEM 54B LOCAL INTERCONNECT NETWORK LIN 54C CONTROLLER AREA NETWORK CAN 54D ...

Страница 33: ... 4172 0 0 7 4 6 10 106 065 0 4 0 14 6 10 1 2 55 1 27 2 1 6 4 1 2 0 ...

Страница 34: ...lief valve the oil passes through the oil filter Then it flows from the oil passage in the cylinder block to the individual crankshaft journals and the cylinder head After the oil is pumped to the individual crankshaft journals it passes through a passage in the crankshaft and is fed to the pins After the oil is pumped to the cylinder head it flows to the camshaft journals and the oil feeder contr...

Страница 35: ...shaft left OIL PUMP M21200000020USA0000010000 The oil pump is a trochoid type directly driven by the crankshaft On cycloid oil pump as the inner rotor is rotated by the crankshaft the outer rotor also rotates The resultant change in spatial volumes between the rotors generates pumping action Specifically oil is sucked into the expanding space and is pushed out from the shrinking space 0 0 7 4 6 10...

Страница 36: ...method Full flow filtering Paper element Filtration area m2 0 11 Rated flow L min 30 OIL PAN M21200000060USA0000010000 ZK602606AA00 Gasket Drain plug Oil pan lower Oil pan upper Screw hole The oil pan consists of the upper and the lower oil pans The upper oil pan is made of aluminum and the lower one is made of high damping steel The screw holes for removing and installing the upper oil pan are de...

Страница 37: ...641 8 KVUWDKUJK PPQXCVKXG 8CNXG NGEVTQPKE QPVTQN 5 UVGO 8 4 0 7 6 10 10641 7 6 2146 7 0 6 10 4 10641 7 27 2 4 10641 56 46 4 4 10641 6 1 0 5 0514 6 4 10641 1 24 5514 4 10641 0 4 614 10641 8 214 6 8 55 10 274 10641 756 5 4 4 7 6 10 10641 10641 4 4 0 6914 0 8 214 6 8 55 10 10641 5 56 0 144 6 274 19 10 614 64 2 6 6 108 46 4 6 4 14 6 10 10 614 10 1 4 0156 5 ...

Страница 38: ...tion of variable induction system Improvement of torque at low or middle engine speed and improvement of output at high engine speeds MIVEC in which right bank and left bank cams are switched using single engine oil control valve is used System simplified 016 6JG EJCPIGU OCTMGF CTG DCUKECNN VJG UCOG CU HQT VJG GPIKPG VJCV KU GSWKRRGF QP VJG 106 41 7 6 2146 7 5 56 0 4 0 14 6 10 ...

Страница 39: ...r Power steering pressure sensor Engine oil pressure switch for warning lamp Left bank Knock sensor Generator L terminal Ignition switch ST Power supply Ignition switch IG CAN communication input signal A C switch Vehicle speed Fuel level sensor Inhibitor switch CAN communication output signal Engine oil control valve A C compressor relay No 2 injector No 3 injector No 5 injector No 6 injector No ...

Страница 40: ...Control System Diagram 7 6 2146 7 5 56 0 4 0 14 6 10 ...

Страница 41: ...tilation solenoid Ignition coil ignition power transistor Multiport fuel injection MFI relay Fuel pump relay Starter relay Throttle actuator control motor relay Generator G terminal Heated oxygen sensor heater A C compressor relay Diagnostic output CAN communication out put signal Sense Act AA00 Left bank heated oxygen sensor rear 14 Fuel tank differentical pressure sensor 15 Fuel tank temperature...

Страница 42: ...fuel injection MFI relay Fuel pump relay Starter relay Throttle actuator control motor relay Generator G terminal Heated oxygen sensor heater A C compressor relay Diagnostic output CAN communication out put signal Sense Act AA00 Left bank heated oxygen sensor rear 14 Fuel tank differential pressure sensor 16 Fuel tank temperature sensor 17 Fuel tank Fuel level sensor Fuel pump Fuel pressure regura...

Страница 43: ...t also uses Electrically Erasable Programmable Read Only Memory EEPROM so that studied compensation data is not deleted even if battery terminals are disconnected ECM CONNECTOR INPUT OUTPUT PIN ARRANGEMENT ZK602508AA00 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 91 90 89 87 86 84 85 83 82 88 92 93 94 95 96 97 98 99 109 108 107 106 105 104 103 102 112 113 114 115 116 117 118 100 101 111 1...

Страница 44: ...k heated oxygen sensor front 39 Left bank heated oxygen sensor front offset voltage 40 Left bank heated oxygen sensor rear 41 Left bank heated oxygen sensor rear offset voltage 42 Left bank knock sensor ground 43 Power supply voltage applied to power steering pressure sensor 44 Power supply voltage applied to manifold absolute pressure sensor 45 Manifold absolute pressure sensor 46 Manifold absolu...

Страница 45: ...offset voltage 117 Evaporative emission ventilation solenoid 118 Center exhaust pipe heated oxygen sensor heater SENSOR M21302000010USA0000010000 MASS AIRFLOW SENSOR ZK600234AA01 Sensing area Silicon substrate Heat sensing resistor Intake air Diaphragm Mass airflow sensor is installed in the air intake hose Mass airflow sensor is composed of an extremely small heatsensing resistor The mass airflow...

Страница 46: ...sor detects intake air temperature through thermistor s resistance change and outputs the voltage according to intake air temperature to ECM ECM uses this output voltage to compensate fuel injection control and ignition timing control Sensor properties are as shown in the figure ZK600237 ECM Resistance k Output voltage V Intake air temperature sensor thermistor 5 V AA02 Intake air temperature C F ...

Страница 47: ...s shown in the figure ZK600233 5V 0 101 5V Ground Output voltage V Pressure kPa in Hg Manifold absolute pressure sensor ECM Power supply Output signal AA02 ENGINE COOLANT TEMPERATURE SENSOR ZK600238AA00 Sensory part thermistor Thw engine coolant temperature sensor is installed in the thermostat housing Engine coolant temperature sensor uses thermistor s resistance change to detect coolant temperat...

Страница 48: ...tation angle ECM uses this signal to detect the throttle valve opening angle to perform throttle actuator control motor feedback control This throttle position sensor uses Hall IC and is a non contact type STRUCTURE AND SYSTEM ZK602509AA00 Yoke Fixed to the motor cover Hall IC Stator Magnet Throttle shaft To ECM Throttle position sensor is composed of a permanent magnet fixed on the throttle shaft...

Страница 49: ...tput voltage for throttle actuator control motor feedback control Also ECM compares output voltage of the throttle position sensor main and throttle position sensor sub to check for abnormality in the throttle position sensor The relationship between throttle opening angle and output voltage of the throttle position sensor main and throttle position sensor sub is as shown in the figure below ZK600...

Страница 50: ...ate throttle valve opening angle and fuel injection volume This accelerator pedal position sensor uses Hall IC and is a non contact type STRUCTURE AND SYSTEM ZK500423AA00 Magnet Pedal shaft Hall IC Accelerator pedal position sensor is composed of a permanent magnet fixed on the magnet carrier of the pedal shaft Hall IC outputs voltage according to magnetic flux density and a stator that efficientl...

Страница 51: ...ses accelerator pedal position sensor main output voltage for appropriate throttle valve opening angle control and fuel injection volume control Also ECM compares output voltage of the accelerator pedal position sensor main and accelerator pedal position sensor sub to check for abnormality in sensor The relationship between accelerator opening angle and output voltage of the accelerator pedal posi...

Страница 52: ...ical air fuel ratio Electro motive force V Rich Lean Air fuel ratio This sensor uses the oxygen concentration cell principle of solid electrolyte zirconia and displays the property of sudden change in output voltage near theoretical air fuel ratio This property is used to detect oxygen density in exhaust gas Feedback to ECM allows it to judge whether air fuel ratio is rich or lean compared to theo...

Страница 53: ...ion sensor A crankshaft position sensor is installed to the right bank side on the cylinder block The crankshaft position sensor monitors rotation of crankshaft sensing blade 36 teeth including 4 missing teeth installed on the crankshaft and converts to voltage pulse signal that is output to ECM ECM uses crankshaft position sensor s output pulse to detect crankshaft position 7 6 2146 7 5 56 5 0514...

Страница 54: ...ment and the resistance decreases The crankshaft position sensor converts this change in resistance of the magnetic resistance element to a 5 V pulse signal and outputs it to ECM ZK603920 5V 5V AA01 Crankshaft position sensor ECM Output signal Magnetic resistance element CAMSHAFT POSITION SENSOR ZK602512 AA00 Camshaft position sensor Camshaft Camshaft position sensing cylinder A camshaft position ...

Страница 55: ... to magnetic resistance element and resistance decreases The camshaft position sensor converts this change in resistance of the magnetic resistance element to a 5 V pulse signal and outputs the signal to ECM ZK603921 5V 5V AA01 Camshaft position sensor ECM Output signal Magnetic resistance element KNOCK SENSOR ZK600258 AA00 Piezoelectric element A knock sensor is installed on the cylinder block bo...

Страница 56: ...ppropriate air fuel ratio for that altitude ENGINE OIL PRESSURE SWITCH for MIVEC AA00 ZK600263 Engine oil pressure switch for MIVEC Terminal Oil pressure An engine oil pressure switch for MIVEC is installed on the engine oil control valve housing The engine oil pressure switch for MIVEC uses contact switch to detect High Low of oil pressure When the engine oil control valve functions and oil press...

Страница 57: ...the oil pressure is high or low using the contact switch When the oil pressure becomes higher than the specified value after the engine starts the contact point of the engine oil pressure switch for warning lamp opens This allows the ECM to detect the oil pressure is higher than the specified value The ECM outputs the OFF signal to the combination meter through the CAN and then turns off the oil p...

Страница 58: ...wer steering fluid pressure MPa in Hg Power steering pressure sensor ECM Power supply Output signal AA00 FUEL TANK DIFFERENTIAL PRESSURE SENSOR Pressure Fuel tank differential pressure sensor ZK602527AA00 The fuel tank differential pressure sensor is installed to the fuel pump module The fuel tank differential pressure sensor outputs the voltage to the ECM using the piezo resistive semiconductor i...

Страница 59: ...tank temperature sensor detects the temperature inside the fuel tank using the resistance change in the thermistor and outputs the voltage to the ECM in accordance with the temperature inside the fuel tank The ECM monitors the evaporative leak in accordance with the fuel tank temperature The sensor characteristics are as shown in the diagram ZK600239 ECM Resistance k Output voltage V 5 V AA02 Fuel...

Страница 60: ... 7 V The ratio of power transistor ON time ON duty is output from generator FR terminal to ECM ECM uses this signal to detect generator s output current and drives throttle actuator control motor according to output current electric load This prevents change in idle speed due to electric load and helps maintain stable idle speed ZK600269 FR B S AA01 Field coil IC regulator Generator ECM Ignition s...

Страница 61: ... input to the voltage regulator through the commutation diode After the electric generation begins the current is supplied to the field coil from this circuit In addition the generated voltage is output from the generator L terminal to the ECM This allows the ECM to detect that the electric generation begins The ECM outputs the ON signal to the combination meter through the CAN and then turns off ...

Страница 62: ...on the injection signal sent by ECM 1 injector is installed in the intake manifold of each cylinder and fixed to the fuel rail When electricity flows through the solenoid coil the plunger gets sucked in The ball valve is integrated with the plunger and gets pulled together with the plunger till the fully open position so that the injection hole is fully open and the fuel gets injected 7 6 2146 7 5...

Страница 63: ...throttle body The throttle actuator control motor performs the Open Close of the throttle valve through the reduction gear ECM changes current direction according to the Open Close direction and also changes current to the motor coil to control the throttle actuator control motor Throttle actuator control motor is composed of a good response low energy and small DC motor with brush and can generat...

Страница 64: ...rom battery IGNITION COIL Refer to GROUP 16 Ignition System Ignition Coil P 16c 2 EXHAUST GAS RECIRCULATION EGR VALVE Refer to GROUP 17 Emission Control Exhaust Gas Recirculation EGR System P 17c 7 EVAPORATIVE EMISSION PURGE SOLENOID Refer to GROUP 17 Emission Control Evaporative Emission Control System P 17c 5 7 6 2146 7 5 56 67 614 ...

Страница 65: ...eed r min From MFI relay ENGINE OIL CONTROL VALVE ZK600277 Plunger Coil Port A to oil pan Oil drain Oil drain Spring Spool AA00 Port B from oil pump Port C to piston An engine oil control valve is installed on the cylinder head The engine oil control valve is a duty control type solenoid valve and is used in oil pressure control for cam change When no current is passing through the engine oil cont...

Страница 66: ...huts off air When the current is not flowing through the coil the air flows between the nipples A and B and through the evaporative canister When the current is flowing through the coil the air is sealed in the nipple A and the air through the evaporative canister is shut off When monitoring the evaporative leak the ECM turns the evaporative emission ventilation solenoid on to create the slight va...

Страница 67: ...r output voltage is about 14 7 V generator outputs current to produce electricity In case electric load is generated suddenly ECM controls generator G terminal s On duty to limit the sudden increase in generator load due to generation and thus prevents change in idle speed ZK600279 Field coil IC regulator Generator G AA01 ECM Ignition switch IG Battery B S FUEL INJECTION CONTROL M21302000030USA000...

Страница 68: ...linder and is done once in two engine rotations 5 UVGO QPHKIWTCVKQP KCITCO ZK602750 ECM Injector Mass airflow sensor Manifold sbsolute pressure sensor Intake air temperature sensor Engine coolant temperature sensor Throttle position sensor Crankshaft position sensor Camshaft position sensor Knock sensor Ignition switch ST Heated oxygen sensor AA00 1 INJECTOR ACTUATION FUEL INJECTION TIMING Injecto...

Страница 69: ...signal ECM compares the crankshaft position sensor output pulse signal and camshaft position sensor output pulse signal to identify the cylinder Using this as a base it performs sequential injection in the sequence of cylinders 1 2 3 4 5 6 FFKVKQPCN WGN PLGEVKQP WTKPI EEGNGTCVKQP ZK600288 No 6TDC No 6TDC No 1TDC No 2TDC No 3TDC No 4TDC No 5TDC H L Cylinder Stroke No 1 cylinder No 2 cylinder No 3 c...

Страница 70: ...ume is calculated according to driving conditions WGN PLGEVKQP 8QNWOG QPVTQN NQEM KCITCO ZK600289 Mass airflow sensor Crankshaft position sensor Heated oxygen sensor Engine coolant temperature compensation Engine coolant temperature sensor Manifold absolute pressure sensor Fuel pressure compensation Barometric pressure sensor Battery voltage compensation Battery voltage Basic fuel injection time d...

Страница 71: ... time the ECM makes the following compensations to control the optimum fuel injection volume according to driving conditions List of main compensations for fuel injection control Compensations Content Heated oxygen sensor feedback compensation The heated oxygen sensor signal is used for making the compensation to get air fuel ratio with best cleaning efficiency of the 3 way catalytic converter Thi...

Страница 72: ...ive rise of catalytic converter temperature and to improve fuel efficiency Fuel cut control when over run When engine speed exceeds a prescribed limit 7 500 r min ECM cuts fuel supply to prevent overrunning and thus protect the engine Also if engine speed exceeds 4 000 r min for 15 seconds while vehicle is stationary no load it cuts fuel supply to protect the engine IGNITION TIMING AND CONTROL FOR...

Страница 73: ...aft position sensor Ignition switch ST Inhibitor switch CAN Engine coolant temperature sensor 1 Ignition power control Based on the crankshaft position sensor signal and camshaft position sensor signal ECM decides the ignition cylinder calculates the ignition timing and sends the ignition coil primary current connect disconnect signal to the power transistor of each cylinder in the ignition sequen...

Страница 74: ... operation After determining the basic spark advance based on the intake air volume and engine speed ECM makes compensations based on input from various sensors to control the optimum spark advance and current carrying time List of main compensations for spark advance control and current carrying time control Compensations Content Intake air temperature compensation Compensation is made according ...

Страница 75: ...on timing 5 BTDC synchronized with crankshaft position sensor signal THROTTLE VALVE OPENING ANGLE CONTROL AND IDLE SPEED CONTROL M21302000035USA0000010000 ECM detects the amount of accelerator pedal depression as per operator s intention through the accelerator pedal position sensor Based on pre set basic target opening angles it adds various compensations and controls the throttle valve opening a...

Страница 76: ... low So the target opening angle is compensated based on atmospheric pressure Engine coolant temperature compensation Compensation is made according to the engine coolant temperature The lower the engine coolant temperature the greater the throttle valve opening angle Electric load compensation Throttle opening angle is compensated according to electric load The greater the electric load the great...

Страница 77: ...or MIVEC ECM turns OFF Duty 0 the engine oil control valve at low engine speed 4 750 r min or less As a result oil pressure does not act on the piston in the rocker arm and inlet valve is driven by the low speed cam ECM turns ON Duty For 2 seconds after change 100 after 2 seconds 60 the engine oil control valve at high engine speed 4 750 r min or more As a result oil pressure acts on the piston in...

Страница 78: ...d mode Cam lift amount Exhaust Intake Camshaft operation angle Overlap large Driving condition Valve timing Action Benefit Low engine speed ZK602519 TDC Intake valve Exhaust valve BDC Close AA00 Valve opening time is shortened to limit spit back volume by intake air Improvement of low speed torque 7 6 2146 7 5 56 8 KVUWDKUJK PPQXCVKXG 8CNXG NGEVTQPKE QPVTQN 5 UVGO ...

Страница 79: ...port is opened closed 5 UVGO QPHKIWTCVKQP KCITCO ZK600298 Crankshaft position sensor AA01 ECM MFI relay Vacuum tank Primary port Vacuum actuator Secondary port Control valve Intake manifold tuning solenoid Battery When engine is at low or middle speed 3 600 r min or less ECM turns ON the intake manifold tuning solenoid As a result intake manifold negative pressure acts on vacuum actuator and contr...

Страница 80: ...e ignition switch IG ON signal is input ECM turns ON the power transistor for control of the MFI relay As a result current flows through the MFI relay s coil the relay switch turns ON and power is supplied to each sensor and actuator Also when ignition switch IG OFF signal is input ECM performs the following controls and then turns OFF the power transistor for control of MFI relay Throttle valve i...

Страница 81: ...l pump relay the relay turns ON and the fuel pump is driven The fuel pump relay is built into the ETACS ECU When the ignition switch ST signal is input ECM turns ON the power transistor for control of the fuel pump relay As a result power is supplied to the fuel pump Also if engine speed falls below a set value the fuel pump relay is turned OFF Thus it deals with sudden stoppages such as engine st...

Страница 82: ...P Ds D N R OFF ON OFF ON ECM Starter relay control Inhibitor switch Ignition switch ST Battery Starter relay Starter When the ignition switch ST signal is input ECM turns ON the power transistor for control of the starter relay 7 6 2146 7 5 56 6 1 0 5 0514 6 4 10641 ...

Страница 83: ...by raising the sensor temperature by passing current through the heater at a low exhaust gas temperature such as in the immediate aftermath of the engine start or during the warm up operation and in cutting the fuel during deceleration Based on driving conditions and the heated oxygen sensor activation state ECM changes the amount of current duty ratio to the heater to quicken the activation of th...

Страница 84: ...gnetic clutch The ECM turns on the power transistor when the A C switch ON signal is input by the A C ECU through the CAN This allows the A C compressor relay to be ON and to be operated During the high load operation such as the acceleration with the fully opened accelerator the ECM secures the acceleration capability by turning off the A C compressor relay for the specified period to produce no ...

Страница 85: ...sudden increase in generator s output current and output current is increased only gradually Battery current is supplied to the headlamp etc till generator produces sufficient current Thus ECM prevents change in idle speed due to sudden increase of engine load EVAPORATIVE EMISSION PURGE CONTROL M21302000120USA0000010000 Refer to GROUP 17 Emission Control Evaporative Emission Control System P 17c 5...

Страница 86: ...in operation range the ECM drives the evaporative emission purge solenoid and the evaporative emission ventilation solenoid This allows slight vacuum to be produced in the fuel tank The ECM measures the vacuum condition through the fuel tank differential pressure sensor signal By comparing the normal expected value and the actual value the ECM detects whether the fuel vapor leakage exists or not f...

Страница 87: ...t low bank 2 sensor 2 㬍 P0058 Heated oxygen sensor heater circuit high bank 2 sensor 2 㬍 P0069 Abnormal correlation between manifold absolute pressure sensor and barometric pressure sensor 㬍 P0101 Mass airflow circuit range performance problem 㬍 P0102 Mass airflow circuit low input 㬍 P0103 Mass airflow circuit high input 㬍 P0106 Manifold absolute pressure circuit range performance problem 㬍 P0107 ...

Страница 88: ...ank 2 sensor 1 㬍 P0153 Heated oxygen sensor circuit slow response bank 2 sensor 1 㬍 P0154 Heated oxygen sensor circuit no activity detected bank 2 sensor 1 㬍 P0157 Heated oxygen sensor circuit low voltage bank 2 sensor 2 㬍 P0158 Heated oxygen sensor circuit high voltage bank 2 sensor 2 㬍 P0159 Heated oxygen sensor circuit slow response bank 2 sensor 2 㬍 P0160 Heated oxygen sensor circuit no activi...

Страница 89: ...ircuit 㬍 P0450 Evaporative emission control system pressure sensor malfunction 㬍 P0451 Evaporative emission control system pressure sensor range performance 㬍 P0452 Evaporative emission control system pressure sensor low input 㬍 P0453 Evaporative emission control system pressure sensor high input 㬍 P0455 Evaporative emission control system leak detected gross leak 㬍 P0456 Evaporative emission cont...

Страница 90: ...ensor plausibility torque monitor 㬍 P1239 Engine RPM plausibility 㬍 P1240 Ignition angle P1241 Torque monitor 㬍 P1242 Fail safe control monitor 㬍 P1243 Inquiry response error 㬍 P1244 RAM test for all area 㬍 P1245 Cycle RAM test engine 㬍 P1246 Communication error 㬍 P1247 A T plausibility 㬍 P1248 AWD plausibility AWD P1540 LIN communication check by ECM sending message to radiator sensor California ...

Страница 91: ...ygen sensor inactive bank 1 sensor 1 㬍 P2197 Heated oxygen sensor inactive bank 2 sensor 1 㬍 P2228 Barometric pressure circuit low input 㬍 P2229 Barometric pressure circuit high input 㬍 P2252 Heated oxygen sensor offset circuit low voltage 㬍 P2253 Heated oxygen sensor offset circuit high voltage 㬍 P2423 HC adsorber HC trap catalyst efficiency below threshold California 㬍 P2567 LIN communication ch...

Страница 92: ...gnition switch ST ON OFF Crankshaft position sensor 2 Crankshaft position sensor r min ECT sensor 6 Engine coolant temperature sensor C F EGR step motor 31 EGR valve stepper motor Step Engine control relay 95 Engine control relay ON OFF ETV relay 96 Throttle actuator control motor relay ON OFF EVAP emission purge SOL duty 49 Evaporative emission purge solenoid duty Fan duty 47 Fan motor duty Fuel ...

Страница 93: ...2 sensor 1 left front V Oxygen sensor bank 2 sensor 2 AF Heated oxygen sensor bank 2 sensor 2 left rear V Power steering pressure 24 Power steering pressure sensor mV Power supply voltage 1 Power supply voltage V Radiator sensor temperature 1 111 Radiator sensor temperature 1 C Radiator sensor temperature 2 112 Radiator sensor temperature 2 C Relative TP sensor BC Relative throttle position sensor...

Страница 94: ...cleared Completion status of continuous monitors since DTC cleared Misfire monitoring MIS_RDY YES or NO Fuel system monitoring FUEL_RDY YES or NO Comprehensive component monitoring CCM_RDY YES or NO Supported tests run at least once per trip Supported status of non continuous monitors Catalyst monitoring CAT_SUP YES Heated catalyst monitoring HCAT_SUP NO Evaporative system monitoring EVAP_SUP YES ...

Страница 95: ... Bank 2 SHRTFT2 xxx x 09 Long Term Fuel Trim Bank 2 LONGFT2 xxx x 0B Intake Manifold Absolute Pressure MAP xxx kPa xx x inHg 0C Engine RPM RPM xxxxx min 1 0D Vehicle Speed Sensor VSS xxx km h xxx mph 0E Ignition Timing Advance for 1 Cylinder SPARKADV xx 0F Intake Air Temperature IAT xxx C xxx F 10 Air Flow Rate from Mass Airflow Sensor MAF xxx xx g s xxxx x lb min 11 Absolute Throttle Position TP ...

Страница 96: ... status of continuous monitors this monitoring cycle Misfire monitoring MIS_ENA NO or YES Fuel system monitoring FUEL_ENA NO or YES Comprehensive component monitoring CCM_ENA YES Completion status of continuous monitors this monitoring cycle Completion status of continuous monitors this monitoring cycle Misfire monitoring MIS_COMPL YES or NO Fuel system monitoring FUEL_COMP YES or NO Comprehensive...

Страница 97: ...xxx x 49 Accelerator Pedal Position D APP_D xxx x 4A Accelerator Pedal Position E APP_E xxx x 4C Commanded Throttle Actuator Control TAC_PCT xxx x Actuator Test Function The actuator test items are shown in the following table M U T III SCAN TOOL DISPLAY ITEM NO INSPECTION ITEM ACTIVATING CONTENT A C relay 16 A C compressor clutch relay The relay turns from OFF to ON EVAP emission purge SOL valve ...

Страница 98: ...tor No 6 injector 6 Cut fuel to No 6 injector Oil control valve 17 Engine oil control valve Engine oil control valve turns from OFF to ON PWM Radiator fan 14 Radiator fan A C condenser fan Drives the fan motor at high speed Variable intake solenoid 21 Intake manifold tuning solenoid The solenoid valve turns from OFF to ON 7 6 2146 7 5 56 10 1 4 0156 5 ...

Страница 99: ... 4172 7 5722 106 065 0 4 0 14 6 10 7 6 0 ...

Страница 100: ...l tank capacity dm3 gal FWD 63 16 6 AWD 60 15 8 Fuel pump type Electric Fuel filter type Cartridge incorporates fuel pump module Fuel return system Returnless Fuel pump pressure regulator pressure kPa psi 324 47 Fuel injector Type Elector magnetic Quantity 6 Evaporative emission control system Canister CONSTRUCTION DIAGRAM ZC600632 Fuel injector Fuel rail Fuel pipe Fuel pump module Evaporative emi...

Страница 101: ...ing the amount of evaporated gas FUEL TANK M21304000010USA0000010000 The fuel tank assembly consists of the fuel pump module the fuel level sensor sub AWD the fuel tank and so on and features the following characteristics The fuel tank is mounted underneath the second seat to improve safety at a collision The fuel tank itself is made of a pre coat zinc alloy galvanized steel sheet that contains no...

Страница 102: ...CONSTRUCTION DIAGRAM ZC6020810000 Fuel tank Fuel pump module FWD ZC601844 Fuel cut off valve Fuel cut off valve Fuel tank 2 way valve Fuel tank leveling valve 0000 7 5722 7 6 0 ...

Страница 103: ...20000 Fuel tank Fuel pump module Fuel level sensor sub AWD ZC601845 Fuel cut off valve Fuel cut off valve Fuel tank 2 way valve Fuel tank leveling valve 0000 In tank fuel filter Fuel suction hose 7 5722 7 6 0 ...

Страница 104: ...MEMO 7 5722 ...

Страница 105: ... 4172 0 0 11 0 106 065 0 4 0 14 6 10 9 6 4 2 55 9 6 4 27 2 ...

Страница 106: ...s been applied to the radiator core 016 2TGO KT KU C TGIKUVGTGF VTCFGOCTM QH PIGNJCTF QTRQTCVKQP SPECIFICATIONS Item Specification Cooling method Water cooled pressurized forced circulation with electrical fan Radiator Type Pressurized corrugate type Performance kJ h kcal h 266 400 63 640 260 280 62 178 Water pump Type Centrifugal impeller Drive method Timing belt Thermostat Type Wax pellet with j...

Страница 107: ... Cylinder head right bank Cylinder head left bank Heater Thermostat housing AA00 WATER PUMP M21400000030USA0000010000 ZK602608 Impeller AA00 The water pump is installed in the front of the cylinder block and driven by the timing belt Item Specifications Discharge volume L min 70 3000 140 6000 Impeller diameter mm 64 Pulley outer diameter mm 61 7 0 0 11 0 9 6 4 2 55 ...

Страница 108: ...MEMO 0 0 11 0 ...

Страница 109: ... 4172 06 0 756 106 065 4 06 5 56 4 7 6 0 4 0 4 06 0 1 756 5 56 756 0 1 756 2 2 0 7 4 ...

Страница 110: ...vely sucks cooling air from the front through the top of the radiator has been adopted in order to improve engine performance and reduce air intake noise 105647 6 10 4 ZC6003310000 Air cleaner intake duct Air cleaner to throttle body duct Mass airflow sensor Air cleaner assembly 06 0 756 4 06 5 56 ...

Страница 111: ... manifold and the lower intake manifold The induction control valve assembly is made of resin the upper intake manifold and the lower one are made of an aluminum cast to be lightweight The induction control valve assembly and the upper intake manifold cannot be overhauled They must be replaced as an assembly Exhaust Gas Recirculation EGR distribution aisle is had by upper intake manifold built in ...

Страница 112: ...vances the early warm up of the catalyst and improves the exhaust gas performance especially right after the engine start by installing the manifold catalytic converter just under the exhaust manifold EXHAUST PIPE AND MUFFLER M21500000030USA0000010000 The exhaust system is composed of the front exhaust pipe center exhaust pipe and main muffler and it has the following characteristics 06 0 756 756 ...

Страница 113: ... 105647 6 10 4 ZC6005170000 Front exhaust pipe RH Front exhaust pipe Center exhaust pipe heated oxygen sensor Vehicles for California Center exhaust pipe Exhaust main muffler 06 0 756 756 5 56 ...

Страница 114: ...MEMO 06 0 756 ...

Страница 115: ... 4172 C 56 46 0 5 56 106 065 56 46 4 1614 C C ...

Страница 116: ... M21601000020USA0000010000 ZK602761AA00 Front bearing Yoke assembly Armature Gear assembly Lever Switch assembly Gear shaft assembly Internal gear assembly Planetary drive system is used C 56 46 0 5 56 56 46 4 1614 ...

Страница 117: ... 4172 D 4 0 5 56 106 065 6 40 614 D D ...

Страница 118: ...ALTERNATOR M21602000010USA0000010000 ZK602762AA00 Front bearing Rotor Rear bearing Pulley Bearing retainer Internal L terminal detection method is used D 4 0 5 56 6 40 614 ...

Страница 119: ... 4172 E 0 6 10 5 56 106 065 0 6 10 1 E 52 4 2 7 E E ...

Страница 120: ...000010USA0000010000 ZK602764 Plug boots Rain cover Coil AA00 Plug top type is used SPARK PLUG M21603000050USA0000010000 Iridium is used in the central electrode and platinum in the ground electrodes E 0 6 10 5 56 0 6 10 1 ...

Страница 121: ... 4172 C 0 0 10641 106 065 0 4 0 14 6 10 C C ...

Страница 122: ...tor cable This system detects the amount of pressure applied to the accelerator pedal by using a accelerator pedal position sensor APP sensor in the accelerator pedal assembly for electronic control of the throttle valve angle 105647 6 10 4 ZC6014820000 Accelerator pedal assembly Built in accelerator pedal position sensor APP sensor C 0 0 10641 0 4 0 14 6 10 ...

Страница 123: ... 4172 D 761 47 5 10641 5 56 106 065 0 4 0 14 6 10 D 105647 6 10 0 12 4 6 10 D D ...

Страница 124: ...lectronically controls the throttle valve 105647 6 10 4 ZC601485 ZC601822 ZC601484 ZC601483 ZC601051 ZC601159 Stoplight switch Engine control module ECM Transmission range switch Throttle body Built in throttle position sensor TP sensor and throttle actuator control motor TAC motor CRUISE indicator light Transaxle control module TCM Data link connector Accelerator pedal Built in accelerator pedal ...

Страница 125: ...lector lever operation it detects the N position Data link connector If the M U T III scan tool is connected the input check code from the ECM can be read Engine control module ECM Based on the input signal from each sensor and switch it outputs the throttle opening instruction signal to the throttle actuator control motor TAC motor Based on the input signal from each sensor and switch it outputs ...

Страница 126: ...h TCM CRUISE indicator light ECM TAC motor Target accelerator pedal opening angle signal Engine control section Cruise control section Actual accelerator pedal opening angle signal Transaxle control signal Target throttle valve opening angle signal Vehicle speed signal Output shaft speed sensor signal CRUISE indicator light ON OFF signal SYSTEM FUNCTIONS Set function During driving with the vehicl...

Страница 127: ...le to keep pressing the ACC RES switch until the vehicle speed is accelerated to approximately 160 km h 100 mph or above However after the ACC RES switch is released the vehicle speed of approximately 160 km h 100 mph becomes the newly memorized vehicle speed Thereafter the constant speed driving is performed at that speed Cancel function When any of the following conditions is satisfied the const...

Страница 128: ...tate the system check check the service data output with the M U T III 016 QT FKCIPQUVKE KVGOU UGTXKEG FCVC QWVRWV KVGOU CPF EJGEM OGVJQF TGHGT VQ VJG 5GTXKEG CPWCN D 761 47 5 10641 5 56 105647 6 10 0 12 4 6 10 ...

Страница 129: ... 4172 E 55 10 10641 106 065 0 4 0 14 6 10 E 4 0 5 8 06 6 10 5 56 E 8 214 6 8 55 10 10641 5 56 E 756 5 4 4 7 6 10 4 5 56 E 55 10 4 7 6 10 5 56 5 E E ...

Страница 130: ...or Fuel tank Fuel level sensor Fuel pump Evaporative emission canister Three way catalytic converter EGR valve stepper motor Positive crankcase ventilation valve Right bank heated oxygen sensor front Left bank heated oxygen sensor front Left bank heated oxygen sensor rear Right bank heated oxygen sensor rear Fuel tank differential pressure sensor Fuel pressure regulator AA00 Evaporative emission v...

Страница 131: ...tive emission purge solenoid Evaporative emission ventilation valve Exhaust gas cleaning devices list System Objective Function Composition parts Crankcase ventilation system HC decrease Re combustion of blow by gas Positive crankcase ventilation valve Evaporative emission control system HC decrease Re combustion of fuel vapor gas Canister Evaporative emission purge solenoid Exhaust gas recirculat...

Страница 132: ...duction of NOx so that all 3 component gases are cleaned simultaneously Monolith catalyst HC trap catalytic converter California HC decrease During cold operation of engine exhaust HC is temporarily absorbed And then Exhaust HC is released when temperature reaches to level at which catalyst is activated This allows HC to be reduced Monolith catalyst CRANKCASE VENTILATION SYSTEM M21701000004USA0000...

Страница 133: ...r intake hose and throttle body due to negative pressure in the air cleaner POSITIVE CRANKCASE VENTILATION PCV VALVE ZK600307AA00 Spring From rocker cover To inlet manifold plenum Plunger PCV valve lifts the plunger according to negative pressure at the intake manifold plenum to create appropriate ventilation for the crankcase EVAPORATIVE EMISSION CONTROL SYSTEM M21701000002USA0000010000 ZK602753 ...

Страница 134: ... installed in the intake manifold The evaporative emission purge solenoid controls the intake volume of fuel vapor gas from the canister The evaporative emission purge solenoid is a duty control type solenoid valve When current is not passing through the coil nipple A is kept airtight and fuel vapor gas cannot be sucked in When current passes through the coil air can pass between nipple A and B an...

Страница 135: ...ncreases rapidly EGR system is used to decrease the volume of NOx generated EGR system re circulates exhaust gas inside the intake manifold It increases specific heat of the combustion gases and reduces combustion speed to lower the combustion temperature and reduce the volume of NOx generated ECM calculates the EGR introduction volume according to engine operating conditions and controls the EGR ...

Страница 136: ...is controlled minutely The stepper motor turns 15 per step The stepper motor turns forward or back only up to the angle dictated by the number of pulse signals number of steps from the ECM In other words increase and decrease of the EGR flow volume depends on the number of signals number of steps from ECM ECM changes current flow to the 4 coils A B C D in the stepper motor in sequence according to...

Страница 137: ...3A Fuel Injection Control P 13A 31 2 CATALYTIC CONVERTER ZK602526AA00 Catalytic converter Catalytic converter is installed in the exhaust manifold junction of each bank and in the center of exhaust pipe below the floor Based on appropriate air fuel ratio feedback from oxygen sensor CO and HC are oxidized and NOx is reduced Catalytic converter is a monolith with beehive design with catalysts on the...

Страница 138: ... exhaust HC from releasing outside the vehicle After that the HC trap catalyst temperature rises and releases the absorbed HC The released HC is burnt out in the downstream three way catalyst CENTER EXHAUST PIPE HEATED OXYGEN SENSOR ZK603449AA00 Center exhaust pipe heated oxygen sensor HC trap catalytic converter The center exhaust pipe heated oxygen sensor is installed to the HC trap catalytic co...

Страница 139: ...tects the deterioration of the HC trap catalytic converter When reaching the certain operating range the ECM begins monitoring the difference in the feedback time between the heated oxygen sensor rear on the upstream of the HC trap catalyst and the center exhaust pipe heated oxygen sensor on the downstream of the HC trap catalyst This monitoring allows the ECM to detect the deterioration of the HC...

Страница 140: ...MEMO E 55 10 10641 ...

Страница 141: ...SWG EQPXGTVGT 1KN RWOR 76 0 4 8 8 1 55 2 4 0 0 5 5 6 0 5 6410 10641 5 56 QPVTQN U UVGO 10641 5 6 4 12 4 6 10 4 4 0 6 14 5 6 4 0 0156 70 6 10 64 05 55 10 7 11 4 64 05 4 0 4 5 4 26 10 64 05 10641 0 4 5 4 26 10 5 614 8 4 55 6 4410 175 12 4 6 10 24 8 06 10 0 5 5 5 6 1 0 5 1 0 5 2 5 6 ...

Страница 142: ...e slip amount inside the torque converter 2 Control which selects the optimum gear that matches the driving style or driving environment SPECIFICATIONS Transaxle model F6AJA W6AJA Drive type FWD AWD Torque converter Model 3 element 1 stage 2 phase Stall torque ratio 1 96 Lock up Present Shift position P R N D sport mode Transaxle type Forward 6 speed reverse 1 stage Front and rear switching Single...

Страница 143: ...tronic control section TCM ECM Engine Throttle position sensor Crank angle sensor Oil pump Control device Combination meter ECU Position light Mechanical system Hydraulic system Electrical system Low clutch 3 5 reverse clutch High clutch Low reverse brake 2 6 brake Input shaft front rear reduction planetary gear CAN CAN Transaxle assembly Parts name Function Torque converter Composed of the cover ...

Страница 144: ...ly hole for the each sliding area inside the unit and the hydraulic pressure distribution hole for the lock up ON OFF Front planetary gear Composed of the carrier sun gear and internal gear It increases or decreases the output rotation in relation to the input by fixing or releasing the carrier sun gear and internal gear Rear planetary gear The components are the same as for the front planetary ge...

Страница 145: ... 5 reverse clutch 4 Front planetary gear 5 Low clutch 6 Output gear 7 Low and reverse brake 8 One way clutch 9 2 6 brake 10 High clutch 11 Reduction planetary gear 12 Rear planetary gear 13 Side cover 14 Reduction pinion gear 15 Idler gear 16 Final gear 17 Differential case 18 Input shaft 761 6 64 05 105647 6 10 0 12 4 6 10 ...

Страница 146: ... Based on lepelletier system 1 Converter housing 2 Oil pump 3 3 5 reverse clutch 4 Front planetary gear 5 Low clutch 6 Output gear 7 Low and reverse brake 8 One way clutch 9 2 6 brake 10 High clutch 11 Reduction planetary gear 12 Rear planetary gear 761 6 64 05 105647 6 10 0 12 4 6 10 ...

Страница 147: ...nlet port 4 Inner gear CLUTCH AND BRAKE M22301000207USA0000010000 Dish plate and high load wave plate In order to reduce the shock at the engagement the dish plate with elastic effect has been adopted to the high clutch and low clutch Also the high load wave plate with the similar effect has been adopted to the 2 6 brake and 3 5 reverse clutch Centrifugal cancel chamber With this A T a centrifugal...

Страница 148: ...is engaged At this time the centrifugal force that works on the clutch pressure of cylinder chamber is cancelled out by the centrifugal force that works on the centrifugal cancel chamber Therefore the effects from centrifugal force generated by the clutch drum rotation will be eliminated For this reason the constant clutch piston pushing force is obtained with all rotations and smooth shifting has...

Страница 149: ...n opposite to the torque transmission the rollers move toward the wide side of the roller chamber which is composed of the inner race and the outer race Since the wide side of the roller chamber is larger than the roller diameter a clearance is created between the roller chamber and the rollers Therefore the inner race and the outer race are released ZC6007810000 3 4 1 2 1 Spring 2 Outer race 3 In...

Страница 150: ...Linear solenoid valve There are two types to this solenoid valve the normal low type with which the control hydraulic pressure is not generated when the voltage is not applied to the coil and the normal high type which has an opposite characteristics The principle of solenoid valve is the phenomenon that the pushing force against the valve spool installed inside the coil increases approximately in...

Страница 151: ... manual shaft The detent feel of each range is determined by the detent spring and the overstriding force over the protrusion and depression of manual plate When the rod plate reaches the P position the parking rod is pressed down and the rod slides in the support actuator inner hole At the parking rod cam a force acts to turn the parking pawl Then the pawl section of the parking pawl is engaged w...

Страница 152: ... gears and transfers the reduction internal gear input to the front sun gear High clutch Works with 4th 5th and 6th gears and transfers the input shaft input to the rear carrier Low and reverse brake Works with engine brake 1st and reverse gears and fixes the rear carrier 2 6 brake Works with 2nd and 6th and fixes the rear sun gear rotation One way clutch Works when in 1st gear under acceleration ...

Страница 153: ...netary gear One way clutch High clutch Torque transfer state Free state Fixed state Front internal gear Input shaft Rear internal gear Reduction carrier Reduction internal gear Low clutch Front carrier Output gear Front sun gear Rear sun gear Rear carrier fixed by one way clutch Based on lepelletier system 761 6 64 05 105647 6 10 0 12 4 6 10 ...

Страница 154: ...tion planetary gear One way clutch High clutch Torque transfer state Free state Fixed state Front internal gear Input shaft Rear internal gear Reduction carrier Reduction internal gear Low clutch Front carrier Output gear Front sun gear Rear sun gear Rear carrier fixed by low reverse brake Based on lepelletier system 761 6 64 05 105647 6 10 0 12 4 6 10 ...

Страница 155: ...eduction planetary gear One way clutch High clutch Torque transfer state Free state Fixed state Front internal gear Input shaft Rear internal gear Reduction carrier Reduction internal gear Low clutch Front carrier Output gear Front sun gear Rear sun gear Rear carrier Based on lepelletier system 761 6 64 05 105647 6 10 0 12 4 6 10 ...

Страница 156: ...e Reduction planetary gear One way clutch High clutch Torque transfer state Free state Fixed state Front internal gear Input shaft Rear internal gear Reduction carrier Low clutch Front carrier Output gear Front sun gear Rear sun gear Rear carrier 3 5 reverse clutch Based on lepelletier system 761 6 64 05 105647 6 10 0 12 4 6 10 ...

Страница 157: ...6 brake Reduction planetary gear One way clutch High clutch Torque transfer state Free state Fixed state Front internal gear Input shaft Reduction carrier Reduction internal gear Low clutch Front carrier Rear carrier High clutch Output gear Rear internal gear Based on lepelletier system 761 6 64 05 105647 6 10 0 12 4 6 10 ...

Страница 158: ...brake Reduction planetary gear One way clutch High clutch Torque transfer state Free state Fixed state Input shaft Rear internal gear Reduction carrier Reduction internal gear Output gear Front sun gear Rear sun gear Rear carrier High clutch 3 5 reverse clutch Based on lepelletier system 761 6 64 05 105647 6 10 0 12 4 6 10 ...

Страница 159: ...lanetary gear Low reverse brake 2 6 brake Reduction planetary gear One way clutch High clutch Torque transfer state Free state Fixed state Input shaft Rear internal gear Reduction carrier Output gear Rear carrier High clutch Based on lepelletier system 761 6 64 05 105647 6 10 0 12 4 6 10 ...

Страница 160: ...ier Output gear Front sun gear 3 5 reverse clutch Rear sun gear Rear internal gear Rear carrier fixed by low reverse brake Reduction internal gear 6410 10641 5 56 Control system M22301000211USA0000010000 List of control items and input output signals Part name Gear Change Pressure Control Lock up Torque manage ment Display INVECS II Manu al shift contr ol OBD II Input system Transmission range swi...

Страница 161: ...lution signal 㬍 㬍 㬍 㬍 㬍 㬍 Engine torque signal 㬍 㬍 㬍 㬍 Gear change forbid 㬍 㬍 Engine coolant temperature signal 㬍 Stoplight signal 㬍 㬍 㬍 㬍 Output system Low clutch Linear solenoid 㬍 㬍 㬍 2 6 brake Linear solenoid 㬍 㬍 㬍 3 5 reverse clutch Linear solenoid 㬍 㬍 㬍 High clutch Linear solenoid 㬍 㬍 㬍 Lock up low reverse brake Linear solenoid 㬍 㬍 㬍 㬍 Low clutch Shift solenoid 㬍 㬍 㬍 Low reverse brake Shift s...

Страница 162: ...bly Shift switch Up Shift switch Down Paddle shift switch Up Paddle shift switch Down In manual shift TCM 㨯Manual shift 㨯INVECS II CAN Throttle signal 㨯Engine speed signal 㨯Shift prohibition signal 㨯Stoplight switch signal Low clutch linear solenoid valve 2 6 Brake linear solenoid valve 3 5 Reverse clutch linear solenoid valve High clutch liner solenoid valve Lock up Low reverse brake linear solen...

Страница 163: ...ed sensor QEM WR UJKHVKPI ZC602396 Low reverse brake shift solenoid valve CAN 㨯Throttle signal 㨯Engine speed signal 㨯Engine torque 㨯Stoplight switch signal Lock up Low reverse brake linear solenoid valve 0000 Transmission range switch Output shaft speed sensor Input shaft speed sensor Transmission fluid temperature sensor TCM 㨯Under normal condition 㨯At low oil temperature 㨯At high oil temperature...

Страница 164: ...㨯Throttle signal 㨯Engine speed signal 㨯Shift prohibition signal CAN Torque down interdependent signal 0000 QPKVQT ZC602398 A T position indicator Failure lamp MIL lamp TCM CAN 㨯Transmission range signal 㨯Failure lamp signal 㨯MIL lamp signal 0000 Transmission fluid temperature check light 761 6 64 05 6410 10641 5 56 ...

Страница 165: ...vers e clutch High clutch Low revers e brake Low clutch 2 6 brake 3 5 revers e clutch High clutch Lock up Low revers e brake Low clutch Low revers e brake D1 㬍 㬍 㬍 D2 㬍 㬍 㬍 㬍 D2 Lock up 㬍 㬍 㬍 㬍 㬍 D3 㬍 㬍 㬍 㬍 D3 Lock up 㬍 㬍 㬍 㬍 㬍 D4 㬍 㬍 㬍 㬍 D4 Lock up 㬍 㬍 㬍 㬍 㬍 D5 㬍 㬍 㬍 㬍 㬍 D5 Lock up 㬍 㬍 㬍 㬍 㬍 㬍 D6 㬍 㬍 㬍 㬍 㬍 D6 Lock up 㬍 㬍 㬍 㬍 㬍 㬍 P 㬍 R 㬍 㬍 㬍 㬍 㬍 N 㬍 1st gear engine brake 㬍 㬍 㬍 㬍 㬍 Function element...

Страница 166: ...riving gear position during driving and to 3rd gear after a vehicle stop Manual mode is prohibited P0720 Output shaft speed sensor system P0729 6th gear incorrect ratio The current shift position is continued and gear is fixed to 3rd gear after a vehicle stop P0731 1st gear incorrect ratio At engine runup detection Fixed to 5th gear after a vehicle stop At gear ratio abnormality detection Fixed to...

Страница 167: ...ving cycle 1in question is prohibited P0816 Paddle shift switch down system The paddle shift operation during the driving cycle 1in question is prohibited P0826 Shift switch assembly system The manual mode during the driving cycle 1in question is prohibited P0841 Low clutch pressure switch system Control is continued with switch always on P0846 2 6 brake pressure switch system Control is continued...

Страница 168: ...tem Fixed to 5th gear during driving and to 3rd gear after a vehicle stop P1773 ABS Information ASC The lock up during the deceleration and when vehicle speed is 40 km h 25 mph or less is prohibited P1794 Ground return Fixed to 5th gear U0001 CAN bus off No action U0100 ECM time out No action U0121 ASC ECU time out No action U0141 ETACS ECU time out No action 1 Indicates the series of driving cycl...

Страница 169: ...d cooler has been adopted The transmission fluid warmer makes the best use of the characteristics that engine coolant gets warm more quickly than transmission fluid after the engine starts The warmer warms the transmission fluid up to an optimum temperature 70 80 C 158 176 F quickly to avoid loss of the automatic transaxle performance Once the transmission fluid has reached the optimum temperature...

Страница 170: ... design with the simpler internal structure compared to that of the center differential type full time AWD by installing the driving force distribution mechanism of the electronically controlled AWD onto rear differential side The optimized gear ratio by reducing gear offset amount Higher output shaft take out position corresponding to the flattened front suspension crossmember 761 6 64 05 64 05 1...

Страница 171: ...ting power at each shift position have been properly tuned ensuring firm and smooth operation The sport mode 6 speed allows the driver to shift manually The shift knob is painted in metallic silver with a high grade appearance A genuine leather shift knob is available on some models The main components have been made of plastic to reduce weight and number of components Electrical control type shif...

Страница 172: ... button Releases forcibly mechanically the shift lock Shift indicator bulb Illuminates the shift indicator Shift switch assembly Detects the selector lever activation in the sport mode Shift lock solenoid Switches the shift lock mechanism ON OFF Shift lock control relay Switches the shift lock solenoid power supply circuit ON OFF P position detection switch Detects the P position 6 4410 175 12 4 6...

Страница 173: ...tion detection switch ON the selector lever is in the P position Stop light switch ON brake pedal is depressed OPERATIONAL DESCRIPTION ZC6023610000 Lock lever inhibits selecting operation of the lever sub assembly Lever sub assembly Shift lock solenoid Lock lever SHIFT LOCK STATUS With the shift lock status the shift lock solenoid is not energized so when the select operation of the selector lever...

Страница 174: ...hown in the figure and no longer blocks the lever sub assembly path when the select operation is performed enabling the operation RELEASE USING THE SHIFT LOCK RELEASE BUTTON ZC6017720000 If the shift lock no longer operates properly due to a dead battery or the like pressing the shift lock release button enables shift operation from the P position The shift lock release button can be operated by r...

Страница 175: ...SA0000010000 When the ignition key is in any position the LOCK OFF position the selector lever cannot be shifted from the P position to another position Also when the selector lever is not in the P position the ignition key cannot be turned to the LOCK OFF position and pulled out 761 6 64 05 64 05 10641 ...

Страница 176: ...tarting switch assembly the slider is engaged with the notch of the key interlock cable and the slider is locked by the projection of the rotor so that the key interlock cable does not move and the lock cam does not move either As a result of this any attempt to shift the selector lever which is interlocked with the lock cam from the P position to another position is prevented because the lock cam...

Страница 177: ...s possible and the selector lever which is interlocked with lock cam can be shifted from the P position to another position 016 9JGP VJG KIPKVKQP MG KU KP CP RQUKVKQP 10 RQUKVKQPU YKVJQWV FGRTGUUKPI VJG DTCMG RGFCN VJG UGNGEVQT NGXGT ECPPQV DG UJKHVGF HTQO VJG 2 RQUKVKQP VQ CPQVJGT RQUKVKQP DGECWUG VJG UJKHV NQEM HWPEVKQP KU KP QRGTCVKQP 9JGP VJG KIPKVKQP MG KU KP VJG RQUKVKQP QT 56 46 RQUKVKQP VJ...

Страница 178: ...t pulled in direction A as illustrated in the figure In this state the slider in the engine starting switch assembly is locked with the slider moved in direction B as illustrated in the figure The rotor in the engine starting switch assembly is synchronized with the movement of the ignition key When the ignition key is turned toward the LOCK OFF position the slider prevents the rotor from turning ...

Страница 179: ...e selector lever is shifted to the P position the lock cam turns Then the key interlock cable is moved by the lock cam in direction A as illustrated in the figure As a result of this the slider in the engine starting switch assembly is unlocked Because the rotor can rotate with this status the ignition key can be pulled out after the key is turned to the LOCK OFF position 761 6 64 05 64 05 10641 ...

Страница 180: ...intain the certain position regardless of the steering wheel angle the proper operation can be performed without possibility of improper up down position even when the steering wheel is fully turned The paddle shift can perform the upshift downshift operation whether the selector lever is in the sport mode or automatic shifting to provide a rapid shift operation 016 9JGP VJG OQFG KU EJCPIGF VQ VJG...

Страница 181: ... 4172 2412 4 5 6 106 065 0 4 0 14 6 10 ...

Страница 182: ...ion welding method the installation structure is streamlined to reduce weight Lead free grease is used for the universal joint SPECIFICATIONS Item Specification Propeller shaft Type 2 piece 3 joint type propeller shaft Length x Outer diameter mm in Front 708 6 65 27 9 2 56 Rear 1178 9 75 46 4 2 95 Universal joint Type No 1 Cross type caulking method No 2 Constant velocity type DOJ No 3 Cross type ...

Страница 183: ... 4172 4106 106 065 0 4 0 14 6 10 ...

Страница 184: ...ructure AWD RH Lead free grease for the constant velocity joint is adopted Hexavalent chromium is eliminated from the dust cover material The number of parts is reduced by integrating the magnetic encoder for ABS wheel speed detection into the wheel bearing 016 EBJ High Efficiency Compact Birfield Joint the lighter and smaller constant velocity joint compared with the conventional BJ has been achi...

Страница 185: ...AM ZC501780000 Knuckle Strut assembly Driveshaft LH PTJ LH PTJ RH Front hub EBJ Bracket assembly Driveshaft RH PTJ RH Driveshaft RH Wheel bearing Oil seal Magnetic encoder Inner shaft 4WD RH 2WD RH LH 4106 0 4 0 14 6 10 ...

Страница 186: ...MEMO 4106 ...

Страница 187: ... 4172 4 4 106 065 4 4 9 4 4 9 4 06 6410 10641 9 0 4 0 14 6 10 9 7 4 8 1 5 614 6410 10641 172 0 ...

Страница 188: ...000030USA0000010000 For the rear axle the unit bearing double row angular contact ball bearing in which the hub and ball bearing are incorporated has been adopted for the wheel bearing and the EUJ ETJ type constant velocity joint for the driveshaft The following features are also available The lightweight and compact EUJ type constant velocity joint has been installed on the wheel side of the driv...

Страница 189: ...hter and smaller constant velocity joint compared with the conventional TJ has been installed SPECIFICATIONS Item Specification Wheel bearing Bearing type Unit bearing double row angular contact ball bearing Driveshaft Joint type Outer EUJ Inner ETJ Shaft length x Shaft diameter mm in LH 505 5 23 19 90 0 91 RH 586 23 23 07 0 91 016 PFKECVGU VJG FKUVCPEG DGVYGGP VJG EGPVGT QH GCEJ LQKPV CONSTRUCTIO...

Страница 190: ... are also available Aluminum differential carrier reduces weight Optimization of the hypoid gear ratio reduces the torque loss Adoption of the hypoid gear with the same teeth height increases the strength of the coupling SPECIFICATIONS Item Specification Reduction gear type Hypoid gear Reduction ratio 2 352 Differential gear type Type Quantity Side gear Straight bevel gear x 2 Pinion gear Straight...

Страница 191: ...ZC5017850000 Hypoid gear Differential carrier Electronic control coupling Equal altitude toothed gear Bevel gear ZC5017860000 Electronic control coupling Differential Electromagnet Clutch 4 4 4 06 ...

Страница 192: ... optimization of the layout reduces vibration and noise 6410 10641 9 GENERAL INFORMATION M22700000001USA0000010000 Electronic control AWD ensures performance lighter and smaller body and better fuel economy The electronic control AWD controls the torque of the electronic control coupling located between the propeller shaft and rear differential This strategy is enabled by varying the torque distri...

Страница 193: ...ing conditions the system is protected by minimizing the limitation force of the differential During high speed driving the fuel efficiency is improved by reducing the limitation force of the differential The following drive modes are available according to the drivers preference to provide the enjoyment of selecting functions Drive mode Control content Appeal points FWD Minimizes the limitation f...

Страница 194: ...Drive mode selector Drive mode indicator Engine ECU Diagnosis connector Combination meter Drive mode indicator Vehicles for Canada Vehicles for USA System component and function Parts name Functional description Engine ECU Sends the following signals required by AWD ECU via CAN communication 4 4 6410 10641 9 ...

Страница 195: ... to the electronic control coupling Controls the indicators AWD operation indicator and LOCK indicator in the combination meter Controls the self diagnostic function and fail safe function Controls diagnostic function Compatible with scan tool Electronic control coupling Transmits the torque corresponding to the current value controlled by AWD ECU to the rear wheels Drive mode indicator AWD operat...

Страница 196: ...D ECU ETACS ECU CAN_C CAN_B CAN_D CAN_C Engine ECU Engine Transmission Drive mode selector Electronic control coupling Combination meter Diagnosis connector Note The dashed line indicates CAN communication lines CAN_B CAN_C CAN_D 4 4 6410 10641 9 ...

Страница 197: ...mation Key position Battery voltage Feed forward control Throttle opening Vehicle speed Drive mode working out Coupling torque working out Feed back control Front rear wheel revolution difference Vehicle speed Coupling torque Current 1 3A Combination meter Drive mode indicator Fail information Diagnosis output ASC ECU Drive mode Coupling torque Note The dashed line indicates CAN communication line...

Страница 198: ...selector Note The dashed line indicates CAN communication lines AWD FWD LOCK Diagnosis connector AWD ECU ETACS ECU LCD FWD AWD AUTO AWD LOCK Fusible link No 34 Ignition switch IG1 ETACS ECU Fuse Electronic control coupling solenoid ETACS ECU Fuse Fusible link No 34 No 17 10A No 12 7 5A NO 5 10A IG1 relay 4 4 6410 10641 9 ...

Страница 199: ... following checks at a timing shown in the chart below ECU determines the malfunction occurred when the failure detection conditions are met and it sets the diagnostic trouble code and executes the countermeasures for trouble When the failure resume conditions are met ECU determines the status is normal and resumes the system 5VCTV WR PKVKCN EJGEM LWUV CHVGT VJG KIPKVKQP UYKVEJ KU VWTPGF 10 CPU ch...

Страница 200: ...CK indicators flash alternately OFF Ignition switch OFF C145A Harness coupling coil short circuit abnormality Always Immediatel y to FWD AWD and LOCK indicators flash alternately OFF Ignition switch OFF C145D Harness coupling coil break abnormality Always Immediatel y to FWD AWD and LOCK indicators flash alternately OFF Ignition switch OFF C145F Coupling overload Always Gradually to FWD Drive syst...

Страница 201: ...17 V Gradually to FWD AWD and LOCK indicators flash alternately ON Ignition switch OFF C211C IG1 power supply low voltage abnormality IG1 voltage is less than 8 V Gradually to FWD AWD and LOCK indicators flash alternately ON Ignition switch OFF C211D IG1 power supply high voltage abnormality IG1 voltage is more than 17 V Gradually to FWD AWD and LOCK indicators flash alternately ON Ignition switch...

Страница 202: ...tection AWD and LOCK indicators flash alternately Turns ON OFF depending on the data value just before the bus off detection Ignition switch OFF U0100 Engine CAN time out Always Gradually to AWD AUTO mode AWD and LOCK indicators flash alternately ON Ignition switch OFF U0121 ABS CAN time out ABS signal cannot be received Gradually to FWD AWD and LOCK indicators flash alternately ON Ignition switch...

Страница 203: ... failures generated in the electronic control AWD system can be read When a failure occurs AWD ECU sets the diagnostic trouble code for that failure in the nonvolatile memory EEPROM so the recorded information will not be erased even if the battery is disconnected 016 EEPROM Electrical Erasable Programmable ROM Special type of memory that can be programmed or erased electrically For the diagnostic...

Страница 204: ... COUPLING M22700000007USA0000010000 FEATURES The electronic control coupling realizes the highly reliable AWD system with lighter weight and simpler construction CONSTRUCTION ZC5018090000 Main clutch Pilot clutch Armature Ball Main cam Magnet coil Front housing Rear housing Rear differential Shaft Drive pinion Pilot cam The electronic control coupling is comprised of the front housing main clutch ...

Страница 205: ...IC COIL DE ENERGIZED ZC5018100000 Main clutch Shaft Front housing Propeller shaft Pilot clutch Drive pinion rear differential Magnet coil The drive force from the transfer is transmitted to the front housing connected to the propeller shaft The drive force is also transferred to the pilot clutch and the outer side of the main clutch assembled to the front housing Because the pilot clutch and the m...

Страница 206: ...ilot clutch is engaged the drive force is transferred to the pilot cam When there is a difference in wheel angle between the front and rear wheels i e rotation speed of the propeller shaft is different from that of the drive pinion the rotation speed of the pilot cam applied with the drive force and that of the main cam not applied with the drive force become different The ball slides along the cu...

Страница 207: ... 4172 9 0 6 4 106 065 0 4 0 14 6 10 6 4 24 5574 10 614 0 5 56 62 5 ...

Страница 208: ... Steel type Aluminum type Aluminum type Size 16 6 1 2JJ 18 7JJ Amount of wheel offset mm in 38 1 5 38 1 5 Pitch circle diameter PCD mm in 114 3 4 50 114 3 4 50 Tire Size P215 70 R16 99H P225 55 R18 97H Spare wheel Type Steel type Size 16 4T Amount of wheel offset mm in 40 1 6 Pitch circle diameter PCD mm in 114 3 4 50 Spare tire Size T155 90 D16 016 2 2KVEJ KTENG KCOGVGT KPFKECVGU VJG RKVEJ EKTENG...

Страница 209: ... 4172 219 4 2 06 1706 106 065 0 4 0 14 6 10 ...

Страница 210: ...ght and high rigidity aluminum is used to reduce acceleration noise For the transaxle mounting bracket light weight and high rigidity sheet metal is used to reduce gear noise For the front and rear roll stoppers insulators are used for 6A T This reduces idling vibration and acceleration deceleration shock A flat crossmember improves steering ability CONSTRUCTION DIAGRAM ZC6005360001 Engine mountin...

Страница 211: ...35 1 GROUP 35 SERVICE BRAKES CONTENTS BASIC BRAKE SYSTEM 35A ANTI LOCK BRAKING SYSTEM ABS 35B ACTIVE STABILITY CONTROL SYSTEM ASC 35C ...

Страница 212: ... 4172 4106 5752 05 10 106 065 0 4 0 14 6 10 ...

Страница 213: ...r improves the left right direction rigidity of installation points of the lower arms for high steering ability Tuning of the lower arm bushes improves the steering ability and riding comfort The stabilizer bar is joined to the strut for high efficiency to secure the optimum rolling rigidity and improves the steering ability Total tuning of struts springs and bump rubbers improves the steering abi...

Страница 214: ...CATION Camber 0 21 Caster 2 57 Kingpin inclination 12 44 Toe in mm in 1 0 04 COIL SPRING ITEM SPECIFICATION Wire diameter mm in 14 0 6 Average outside diameter mm in 159 6 2 Free length mm in 345 13 5 4106 5752 05 10 0 4 0 14 6 10 ...

Страница 215: ...MEMO 4106 5752 05 10 ...

Страница 216: ... 4172 4 4 5752 05 10 106 065 0 4 0 14 6 10 ...

Страница 217: ...minates the camber adjustment to improve maintenance performance The trailing arm bushings are installed in the upper position to improve the movement of the suspension when the vehicle negotiates bumps and increase the riding comfort Twin tube type shock absorber is adopted to secure the optimum rolling rigidity and improve the steering ability The high efficiency ball joint type stabilizer link ...

Страница 218: ...sorber Rear crossmember Trailing arm Stabilizer bar Coil spring 4WD ZC6002950000 Outer shell Piston Rebound spring Cylinder SPECIFICATIONS SUSPENSION SYSTEM Item Specification Suspension type Trailing arm type multi link 4 4 5752 05 10 0 4 0 14 6 10 ...

Страница 219: ...tem FWD AWD M Line H Line M Line H Line Wire diameter mm in 14 0 6 14 0 6 14 0 6 14 0 6 Average outside diameter mm in 112 4 4 112 4 4 112 4 4 112 4 4 Free length mm in 5 person 358 14 1 358 14 1 363 14 3 363 14 3 7 person 363 14 3 363 14 3 368 14 5 4 4 5752 05 10 0 4 0 14 6 10 ...

Страница 220: ... 4172 5 4 5 56 106 065 0 4 105647 6 10 5 4 26 10 56 4 0 4 4 1156 4 4 2 5 4 ...

Страница 221: ...rce and direct braking feeling IMPROVEMENT IN SAFETY The 4 wheel anti skid brake system 4ABS has been installed to prevent slippage resulting from the wheel lock and assure stable vehicle posture and driveability Electronic control braking force distribution system EBD assures maximum braking force independent of the passenger s position in the vehicle X type piping of brake lines have been adopte...

Страница 222: ...ness mm in 294 26 11 6 1 02 Wheel cylinder I D mm in 57 2 2 25 Pad thickness mm in 10 0 0 39 Clearance adjustment Automatic adjustment Rear brake Type Floating caliper 1 piston solid disc S6 S38 Disc effective dia thickness mm in 302 10 11 9 0 39 Wheel cylinder I D mm in 38 1 1 50 Pad thickness mm in 10 0 0 39 Clearance adjustment Automatic adjustment 105647 6 10 5 4 26 10 MASTER CYLINDER M2350000...

Страница 223: ...le boost ratio mechanism changes the input output characteristics of the brake booster in two phases by changing the reaction force applied to the valve plunger during the assist phase AT INITIAL BRAKE ASSIST ZC6009910000 Disc Reaction washer Ring piston When the brake pedal is not depressed no input load applied the reaction washer is not deformed When the brake pedal is depressed the reaction wa...

Страница 224: ...eat and disc as the reaction force ZC6009930000 Reaction washer Ring piston Control housing Lock washer The reaction washer is then further deformed and when the lock washer makes contact with the control housing the input characteristics change All the force applied from the reaction washer to the ring piston is now transferred to the control housing via the lock washer so no force is applied to ...

Страница 225: ...pedal retreat suppression mechanism restrains the retraction of the brake pedal surface during a frontal collision to reduce the shock to the driver s feet When the brake booster is crushed rearward by the engine retreat during a frontal collision the installation surface of the brake pedal is retreated In this case the end of the pedal support is forcibly slid down and back by the interference wi...

Страница 226: ... has been adopted to the front brake LH pads and rear brake LH RH pads to warn the driver of the wear limit The outer disc type brake disc which can be tightened together with the wheel has been introduced for better serviceability DISC BRAKE DESIGNATION V 6 S 57 1 2 3 4 ZC6009970000 N o Item Contents 1 Brake disc type V Ventilated S Solid 2 Brake size Minimum applicable disc wheel 6 16 inch 3 Num...

Страница 227: ...N o Item Contents Rounded integral value 5 4 5 56 105647 6 10 5 4 26 10 ...

Страница 228: ... 4172 174 9 06 1 4 5 56 5 106 065 0 4 0 14 6 10 105647 6 10 5 4 26 10 5 0514 EVWCVQT 5 7 ...

Страница 229: ...ion CAN 2bus has been adopted as a tool of communication with another ECU Fail safe function which ensures that safety is maintained Diagnostic function which provides improved serviceability 016 1 EBD Electronic Brake force Distribution 2 For further details on CAN communication refer to GROUP 54D CAN P 54D 2 On vehicles with ASC the ABS system is controlled by the ASC ECU For the system construc...

Страница 230: ...n to the rotation speed of each wheel to ABS ECU Magnetic encoder for wheel speed detection 2 When the magnetic encoder for wheel speed detection a plate on which north and south pole sides of the magnets are arranged alternately rotates the wheel speed sensor outputs frequency pulse signal in proportion to each wheel speed Stoplight switch 3 Outputs the signal indicating whether the brake pedal i...

Страница 231: ...g to the signal from ABS ECU Brake warning light 7 Used as the warning light for the parking brake brake fluid level and EBD control Informs the driver of the system status by illuminating or turning off the warning light according to the signal from ABS ECU Data link connector 8 Outputs the diagnostic trouble code and establishes the communication with the scan tool ABS ECU 9 Controls actuators d...

Страница 232: ...peed sensor RL Wheel speed sensor RR Wheel speed sensor FR Stop light switch ABS ECU power supply Data link connector Stoplight switch Hydraulic unit Rear right wheel RR Rear left wheel RL Wheel speed sensor RL Wheel speed sensor RR Wheel speed sensor FL Wheel speed sensor FR Front right wheel FR Front left wheel FL Combination meter and multi information display ABS warning light Brake warning li...

Страница 233: ...ensor consists of the rear wheel speed sensor mounted on the trailing arm assembly and the magnetic encoder for wheel speed detection which is press fitted together with the oil seal to the rear wheel bearing G SENSOR AWD The G sensor is incorporated in ABS ECU and detects longitudinal acceleration of a vehicle Actuator M23501000020USA0000010000 ABS warning light Brake warning light The ABS system...

Страница 234: ...malfunction is detected by the self diagnostic function ABS ECU activates a fail safe function and illuminates the ABS warning light and brake warning light 016 6JG DTCMG YCTPKPI NKIJV KU WUGF CU VJG EQPVTQN YCTPKPI NKIJV ABS ECU detects vehicle speed from the signals of the wheel speed sensor and its incorporated G sensor AWD recognizes the wheel rotation status estimates the wheel slip condition...

Страница 235: ... below the threshold again ABS ECU controls the brake fluid pressure by repeating the cycle Step 2 to 5 Four wheel control ABS fluid pressure is controlled independently for four wheels EBD hydraulic pressure control ZC500798 Ideal distribution curve for fixed passengers boarding Brake force distribution curve by conventional proportioning valve EBD operation conceptual diagram Rear braking force ...

Страница 236: ...ore AWD ECU power supply Checks if ECU power supply voltage stays within the operational range Wheel speed sensor Monitors the output voltage of the sensor signal wiring harness and checks for abnormal output voltage open short circuit Checks for any wheels that do not send pulse signal while the vehicle is in motion Checks if wheel speed which is abnormally higher or lower than the vehicle speed ...

Страница 237: ... signal for FL wheel speed sensor Executed Prohibited when two or more wheels are faulty Prohibited Extinguished 2 Illuminated 3 C1042 Abnormality in periodical signal for FR wheel speed sensor C1043 Abnormality in periodical signal for RL wheel speed sensor C1044 Abnormality in periodical signal for RR wheel speed sensor C1046 FL wheel speed sensor control phase time exceeded Executed Prohibited ...

Страница 238: ...Prohibited Extinguished Illuminates 8 0 0 5 V or less 1 Prohibited Prohibited Illuminates Illuminates C2101 Battery voltage problem high voltage 18 0 1 0 V or more Prohibited Prohibited Illuminates Illuminates C1395 Brake fluid charging incompletion Executed Executed Extinguished Flashes 1 Hz C2203 VIN not written Executed Executed Extinguished Illuminates C1210 4 Defective G sensor Abnormality in...

Страница 239: ...C TROUBLE CODE SET There are 43 diagnostic items FWD or 48 diagnostic items AWD Since all the diagnostic results are recorded in volatile memory EEPROM they are stored in the memory even though the battery terminals are disconnected 016 EEPROM Electrical Erasable Programmable ROM Special type of memory that can be programmed or erased electrically For each diagnostic item refer to Workshop Manual ...

Страница 240: ... 4172 6 8 56 6 10641 5 56 5 106 065 0 4 0 14 6 10 105647 6 10 5 4 26 10 5 0514 67 614 5 7 5 4 26 10 1 105647 6 10 0 12 4 6 10 ...

Страница 241: ...ion reduces the engine output and prevents the wheel spin Skid control function responds to driving conditions and reduces the engine output and applies brake force to four wheels independently to control the vehicle behavior Fail safe function assures the safety Serviceability improvement For reduced wiring harnesses and secure data communication the CAN communication has been adopted as a tool o...

Страница 242: ...r Wheel speed sensor 1 Outputs the frequency signal in proportion to the rotation speed of each wheel to ASC ECU Magnetic encoder for wheel speed detection 2 The wheel speed sensor is a pulse generator When the magnetic encoder for wheel speed detection a plate on which north and south pole sides of the magnets are arranged alternately rotates it outputs frequency pulse signal in proportion to eac...

Страница 243: ...ding to the signal from ASC ECU Brake warning light 11 Used as the warning light for the parking brake brake fluid level and EBD control Informs the driver of the system status by illuminating flashing or turning off the warning light according to the signal from ASC ECU ASC operation indicator light 12 Traction control function and skid control function use the same display Depending on the signa...

Страница 244: ...ront left solenoid valve IN Rear right solenoid valve OUT Rear right solenoid valve IN Rear left solenoid valve OUT Rear left solenoid valve IN Data link connector 0000 AWD ECU AWD ETACS ECU Steering wheel sensor Wheel speed sensor FL Wheel speed sensor FR Front right wheel Front left wheel Hydraulic unit Wheel speed sensor RL Wheel speed sensor RR Rear left wheel Rear right wheel Stoplight switch...

Страница 245: ...tional angle of the steering wheel ASC OFF SWITCH ZC5019530000 ASC off switch The ASC OFF switch is attached on the instrument panel to the left side of the driver s seat Traction control and skid control functions can be deactivated by pressing this switch for 3 seconds or longer Pressing this switch again resumes the active state Pressing the ASC OFF switch for 15 seconds resumes the system to t...

Страница 246: ...the skid control Flashes in 2 Hz during the traction control Turns ON when the system malfunction occurs 5 1 KPFKECVQT NKIJV ASC ECU detects the overheat of the brake pads When the brake traction control is prohibited the ASC OFF indicator light flashes in approximately 2 Hz Turns ON when the system malfunction occurs Turns ON when the ASC OFF switch is pressed for 3 seconds or more and the tracti...

Страница 247: ... the brake of the specific wheel so that the actual vehicle movement gets close to the ideal vehicle mode It also controls the plowing out or spinning out condition by creating the yaw moment in the vehicle Example of Active Skid Control operation ZC600705 Generation of rotating force Generation of counter rotating force 0000 Large braking force Large braking force The Skid Control manages the veh...

Страница 248: ...oint control Control system Control content ABS Even during skid control operation ABS performance is improved from the joint operation of the skid control Traction control function During acceleration engine output is governed through joint operation with skid control function Example of traction control function Traction control function applies the brake automatically sends the signal requestin...

Страница 249: ...els have fault Prohibite d Prohibite d Prohibite d Prohibite d Prohibite d C1015 Abnormality in FR wheel speed sensor circuit C1020 Abnormality in RL wheel speed sensor circuit C102B Abnormality in RR wheel speed sensor circuit C1011 Abnormality in FL wheel speed sensor signal Enabled Prohibite d when two or more wheels have fault Prohibite d Prohibite d Prohibite d Prohibite d Prohibite d C101C A...

Страница 250: ...l phase time exceeded C1048 RL wheel speed sensor control phase time exceeded C1049 RR wheel speed sensor control phase time exceeded C104B Abnormality in FL wheel inlet valve system Prohibited Prohibite d Prohibite d Prohibite d Prohibite d Prohibite d C104F Abnormality in FR wheel inlet valve system C1053 Abnormality in RL wheel inlet valve system C1057 Abnormality in RR wheel inlet valve system...

Страница 251: ...ed Enabled Prohibite d Prohibite d Prohibite d Prohibite d C123B Prolonged operation of ASC Enabled Enabled Prohibite d Prohibite d Prohibite d Prohibite d C2200 Abnormality in ASC ECU Prohibited Prohibite d Prohibite d Prohibite d Prohibite d Prohibite d C2100 Abnormality in battery voltage low voltage 9 7 0 3 V or less 1 Enabled Prohibite d Prohibite d Prohibite d Prohibite d Prohibite d 8 0 0 5...

Страница 252: ...d Prohibite d Prohibite d Prohibite d Prohibite d C2204 Internal abnormality in G and yaw rate sensor Abnormality in internal circuit Enabled Enable d FWD Prohibit ed AWD Prohibite d Prohibite d Prohibite d Prohibite d Abnormality in lateral G sensor output voltage Enabled Enabled Prohibite d Prohibite d Prohibite d Prohibite d Abnormality in yaw rate sensor output voltage Enabled Enabled Prohibit...

Страница 253: ... Prohibite d Prohibite d Prohibite d C1608 Implausible diagnosis data Enabled Enabled Enabled Enabled Enabled Enabled U0001 Bus off Enabled Enabled Enabled Enabled Enabled Enabled U0100 Engine time out error Enabled Enabled Enabled Enabled Enabled Enabled U0101 A T time out error Enabled Enabled Enabled Enabled Enabled Enabled U0114 2 AWD ECU time out error Enabled Enabled Enabled Enabled Enabled ...

Страница 254: ...t C100A Abnormality in FL wheel speed sensor circuit OFF 1 ON 2 ON ON C1015 Abnormality in FR wheel speed sensor circuit C1020 Abnormality in RL wheel speed sensor circuit C102B Abnormality in RR wheel speed sensor circuit C1011 Abnormality in FL wheel speed sensor signal OFF 1 ON 2 ON ON C101C Abnormality in FR wheel speed sensor signal C1027 Abnormality in RL wheel speed sensor signal C1032 Abno...

Страница 255: ...C104F Abnormality in FR wheel inlet valve system C1053 Abnormality in RL wheel inlet valve system C1057 Abnormality in RR wheel inlet valve system C105F Abnormality in FL wheel outlet valve system ON ON ON ON C1063 Abnormality in FR wheel outlet valve system C1067 Abnormality in RL wheel outlet valve system C105B Abnormality in RR wheel outlet valve system C1200 Abnormality in FL RR wheel cut valv...

Страница 256: ...0 1 0 V or more ON ON ON ON C1395 Brake fluid filling not completed OFF Flash 1 Hz OFF OFF C121C Torque request signal rejection OFF OFF ON ON C1290 CAN time out error OFF OFF ON ON C2203 VIN not recorded OFF ON OFF OFF C2206 Change of variant coding value OFF ON ON ON C1210 4 Abnormality in G and yaw rate sensor Abnormality in longitudinal G sensor output voltage OFF ON ON ON C1242 4 Abnormality ...

Страница 257: ...n voltage High voltage 18 0 1 0 V or more OFF OFF FWD ON AWD ON ON C123A Abnormality in sensor calibration OFF ON ON ON C1219 Abnormality in steering wheel sensor signal OFF OFF ON ON C121A Steering wheel sensor neutral point not learned OFF Flashing 2 Hz OFF OFF C2205 Internal abnormality in steering wheel sensor OFF OFF ON ON C1608 Implausible diagnosis data OFF OFF OFF OFF U0001 Bus off OFF OFF...

Страница 258: ...an also bleed the active stability control system When ASC ECU is disabled the actuator test cannot be performed 016 Scan tool uses the ABS data list For the actuator test specification refer to Workshop Manual CALIBRATION After the G and yaw rate sensor and steering wheel sensor have been replaced with new ones calibration must be performed using the M U T III scan tool 016 The M U T III scan too...

Страница 259: ...e accumulator Pump Hydraulic unit Motor Wheel cylinder Suction damper Outlet valve Inlet valve Outlet valve Inlet valve with switched orifice Suction valve Cut valve Pressure sensor Brake fluid flow Brake fluid flow Brake fluid flow Damping chamber Pressure relief valve The brake fluid supplied from the wheel cylinder is stored in the low pressure accumulator Then the stored brake fluid is returne...

Страница 260: ...ake fluid flow Brake fluid flow Pressure relief valve Damping chamber The system closes the inlet valve and outlet valve to hold the brake fluid pressure in the wheel cylinder If the brake fluid is stored in the low pressure accumulator the brake fluid is returned to the master cylinder by driving the pump using the motor VALVE CONDITION Item Power status Open Close Cut valve OFF Open Suction valv...

Страница 261: ... switched orifice Suction valve Cut valve Pressure sensor Brake fluid flow Pressure relief valve Damping chamber The system opens the inlet valve while closing the outlet valve to increase the brake fluid pressure in the wheel cylinder VALVE CONDITION Item Power status Open Close Cut valve OFF Open Suction valve OFF Closed Inlet valve OFF Open Outlet valve OFF Closed 6 8 56 6 10641 5 56 5 5 4 26 1...

Страница 262: ...Brake fluid flow Brake fluid flow Pressure relief valve Damping chamber The system closes the cut valve to block the passage from the pump outlet to the master cylinder and opens the suction valve connecting the passage from the master cylinder to the pump inlet The brake fluid from the master cylinder is supplied to the wheel cylinder VALVE CONDITION Item Power status Open Close Cut valve ON Clos...

Страница 263: ...r Brake fluid flow Brake fluid flow Brake fluid flow Brake fluid flow Pressure relief valve Damping chamber The system closes the inlet valve and outlet valve to hold the brake fluid pressure in the wheel cylinder The brake fluid pressurized by the pump returns to the pump through the pressure relief valve in the cut valve VALVE CONDITION Item Power status Open Close Cut valve ON Closed Suction va...

Страница 264: ...g the inlet valve to store the brake fluid filled in the wheel cylinder in the low pressure accumulator The brake fluid stored in the low pressure accumulator returns to the master cylinder through the pressure relief valve in the cut valve by driving the pump using the motor VALVE CONDITION Item Power status Open Close Cut valve ON Closed Suction valve ON Open Inlet valve ON Closed Outlet valve O...

Страница 265: ...l Basically the operations of ABS solenoid valve and ASC valve are the same ASC ECU the engine ECU and A T ECU communicate with each other via the CAN bus line When the accelerator pedal is depressed too far the signal requesting the engine speed reduction is sent to the engine ECU The ASC ECU performs joint control with A T and secures the TCL controllability 6 8 56 6 10641 5 56 5 5 4 26 10 1 105...

Страница 266: ... 4172 2 4 0 4 5 106 065 0 4 0 14 6 10 ...

Страница 267: ...1USA0000010000 The mechanical rear wheel acting type parking brake is adopted and a parking brake lever is used for that operation CONSTRUCTION DIAGRAM ZC6017510000 Parking brake lever Parking brake rear cable 2 4 0 4 5 0 4 0 14 6 10 ...

Страница 268: ... 4172 219 4 56 4 0 106 065 0 4 0 14 6 10 56 4 0 9 56 4 0 5 6 0 1 7 0 1 27 2 56 4 0 4 1 4 5 481 4 ...

Страница 269: ...sure sensor for increasing the engine idling speed during power steering operation the sensor which can precisely detect the pressure in the power steering system Optimization of the flexible tube in the high pressure hose reduces the pump noise SPECIFICATIONS Items Specifications Steering wheel Type Three spoke type Outside diameter mm in 380 14 9 Maximum number of turns 3 1 Steering column Colum...

Страница 270: ... designed three spoke type has been adopted For LS models the steering wheel is made of urethane For XLS models the steering wheel is made of genuine leather Remote steering wheel audio control switches are available on same models Sporty and thick type grip shape has been adopted Rigid core metal reduces the steering wheel vibration It incorporates an SRS airbag to protect the driver in the event...

Страница 271: ...using the tilting function Tilt steering mechanism has been employed on all models Tilt up amount 20mm Tilt down amount 25mm Collapsible steering column has been employed During a collision the steering wheel moves forward To reduce the separation load during a collision the sliding resistance reduction member has been installed to the column bracket ZC501771 A A B B 0000 Column bracket Column pip...

Страница 272: ...hus the steering column will not be projected into the passenger compartment Secondary collision ZC5017730000 A A B B One way capsule Section B B Section A A BEFORE COLLISION AFTER COLLISION Column bracket Rivet pin Column pipe When the driver s body falls against the steering wheel via the deployed air bag the column bracket moves forward by deforming the rivet pin of the one way capsule and simu...

Страница 273: ...SA0000010000 The oil pump is a vane type with a fluid flow control system in which the steering wheel turning effort will be reduced at low engine speeds and is increased at higher speeds The oil pump is essentially the same as the conventional one in construction 219 4 56 4 0 1 27 2 ...

Страница 274: ...sure sensor allows the system to perform idle up control linearly and without delay as the power steering fluid pressure deviates The hydraulic sensor detects the power steering fluid pressure and sends the signal to the engine control module The engine control module uses this signal to perform idle up control according to the power steering load The method offers the following features Improveme...

Страница 275: ...444 ZC5017750000 Scale Cap O ring Filter Oil reservoir Return Suction The resin oil reservoir is adopted to reduce weight The oil reservoir is translucent and has fluid level marks MAX and MIN lines for ease of inspection 219 4 56 4 0 1 4 5 481 4 ...

Страница 276: ...13 1 GROUP 13 FUEL CONTENTS MULTIPORT FUEL INJECTION MFI 13A FUEL SUPPLY 13B ...

Страница 277: ... 4172 1 106 065 0 4 0 14 6 10 0 1 1 2 0 0 1 5 37 60 55 1 1 14 465 11 7 4 114 56476 619 4 4 114 0 6 6 114 0 6 6 1 219 4 9 0 19 9 6 4564 2 9 0 19 55 570411 7561 6 10 70 6 10 ...

Страница 278: ...ure has been adopted IMPROVEMENTS IN OPERATION PERFORMANCE The central door locking system which can lock unlock all the doors and liftgate has been adopted The override function which allows to open the driver s door by pulling the driver s inside handle when all the doors are locked has been adopted Electric liftgate lock release handle that requires only the slightest operating force has been a...

Страница 279: ... M24200000020USA0000010000 ZB500371 AB501519 ZB500405 ZB500404 0001 High tensile steel panels Indicates 590MPa high tensile steel panels Anti corrosion steel panels Indicates 980MPa ultra high tensile steel panels 1 0 1 ...

Страница 280: ...hood and liftgate and the panel joints at the bottom of the front floor and the rear floor in order to improve rust resistance BODY SHELL M24200000030USA0000010000 IMPACT SAFETY BODY RISE REINFORCED IMPACT SAFETY EVOLUTION ZB6003970000 View A A B 1 2 3 1 B C C D D When hood is removed When hood is removed 4 5 6 7 Cowl top inner panel Section D D Section B B Section C C Cowl top lower panel Cowl to...

Страница 281: ...ure reinforcement to improve collision safety and vehicle body ridigity The front frame structure is supported in three directions by the dash crossmember center dash crossmember lower and front sidemember rear in order to improve the frontal collision characteristics and increase the vehicle body rigidity The front sidemember structure has been changed to a straight frame structure with a hexagon...

Страница 282: ...icle from this line Thickness is thicker on the forward part of the vehicle from this line The uneven thickness steel panels in uneven thickness integrated structure have been adopted for the parts shown in the figure to improve safety upon impact and reduce weight 016 UVGGN UJGGV QH XCT KPI VJKEMPGUU VJCV KU YGNFGF KPVQ QPG UVGGN UJGGV 1 0 1 ...

Страница 283: ... pillar brace The aluminum roof panel has been adopted to reduce weight and improve the steering ability The front upper frame outer and front pillar have been joined with the upper frame to front pillar brace in order to improve the steering ability 1 0 1 ...

Страница 284: ...R CHARTS M24200000050USA0000010000 Two types of color variation have been introduced the color suggesting the great nature or the color providing the sporty and tough impression Color names have been modified for easy recognition The color recipe is the same as the conventional one BODY COLOR TABLE Color Color code Color number Color name Previous name Composition of film SILVER A31 CMA10031 Cool ...

Страница 285: ...Metallic Interferenced Pearl BLACK X42 AC11342 Black Mica Amethyst Black Interferenced Pearl WHITE W13 CMW10013 White Pearl Pearl RED P23 CMP10023 Red Solid Solid 016 QT RCKPVKPI KPPGT RCPGN EQNQTU UJQWNF DG UKOKNCT VQ VJG QWVGT RCPGN EQNQTU HOOD M24200000230USA0000010000 HOOD LATCH ZC6001300000 Hood latch Headlight support upper panel cover A headlight support upper panel cover has been installed...

Страница 286: ...cap holder Fuel filler door Fuel filler door Fuel filler cap Fuel filler cap When using fuel filler cap holder The fuel filler cap holder has been installed to the fuel lid holding the removed cap in refueling to prevent the fuel cap from being left open 1 56476 619 4 4 ...

Страница 287: ...STRUT TOWER BAR M24200000013USA0000010000 ZC600132 Strut tower bar 0000 The strut tower bar has been adopted to the strut attachment point to improve steering ability 1 114 0 6 6 ...

Страница 288: ...k actuator Inside handle cable Inside lock cable Inside handle Inside handle cable Key cylinder Driver s side only Inside lock knob Inside lock knob Door check Door check ZC6001340000 Liftgate upper Liftgate lock actuator Liftgate lock release handle Liftgate upper latch assembly Liftgate lower Liftgate lock release handle knob Liftgate lower latch assembly Liftgate lower cable assembly Striker St...

Страница 289: ... s door to be opened by pulling the driver s door inside handle even when the driver s door inside lock knob is in the lock position is called override function ZC6001350000 t t ON OFF ON OFF ON OFF ON OFF t 0 25 second Lock switch Lock relay output Unlock relay output Unlock switch When the driver s door is locked by turning the door lock key cylinder to the lock side when the lock switch turns O...

Страница 290: ... unlocked KEY IN PREVENTION FUNCTION When the driver s door inside lock knob is operated to the lock position with the driver s door opened the driver s door cannot be locked preventing it from being locked with the key inside the vehicle SELECTOR P POSITION LINKED DOOR UNLOCKING FUNCTION When the selector lever is shifted to the P parking position with the ignition switch turned ON all the doors ...

Страница 291: ...k Unlock Door lock switch Driver s side door Lock Lock Lock Lock Lock Unlock Unlock Unlock Unlock Unlock Passenger s side door Lock Lock Lock Lock Lock Unlock Unlock Unlock Unlock Unlock LIFTGATE OPENING CLOSING OF LIFTGATE ZC6001380000 Upper liftgate Lower liftgate Liftgate lock release handle knob Liftgate full close Liftgate full open The upper lower split liftgate has been adopted 1 114 0 6 6 ...

Страница 292: ...ate lock release handle requires low operating force and has no temperature dependency improves the opening operation When the liftgate lock release handle is operated the switch is turned ON or OFF If the liftgate cannot be opened from the outside of the vehicle due to any malfunction such as discharged battery it can be opened from the inside of the vehicle using the following procedure ZC600140...

Страница 293: ...the liftgate lock release handle POWER WINDOW M24200000220USA0000010001 ZC6001430000 Power window main switch Driver s side Door window glass Door window glass Power window regulator assembly Power window motor Power window motor Front door Rear door Power window lock switch Power window switch Power window regulator assembly The power window has the following features Safety mechanism Driver s do...

Страница 294: ...losing operation of the power window switch or by continuing the one touch closing operation keep pulling up the switch knob the door window glass can be forcibly closed without safety mechanism activation even when the obstacle is detected to be pinched When the power window switch manual closing or one touch closing operation is performed accidentally and an obstacle is detected the power window...

Страница 295: ...0000 A A A A B B B B Section A A Section B B Door opening weatherstrip Door opening weatherstrip The double weather strips have been installed along the perimeter of the door window to improve the sound proof and water proof performances 1 9 0 19 55 ...

Страница 296: ...dow glass 3 1 Green 82 3 Dark gray privacy glass 25 5 Liftgate window glass 3 1 Green 82 3 Dark gray privacy glass 25 6 Sunroof lid glass 3 5 Dark gray 18 016 6JG XKUKDNG TC VTCPUOKUUKXKV TCVG KU C TGHGTGPEG XCNWG The laminated glass has been adopted for the windshield and the reinforced glass has been adopted for other windows The window glass has the following features The privacy glasses for th...

Страница 297: ...anism has been adopted as an option This sunroof has the following characteristics A lightweight sunroof has been adopted The sunroof tilts up for approximately 30 mm to improve ventilation The integrated switch allows for all slide opening closing tilt up down and stop operations All operations are available at one touch If external force is applied during slide closing or tilt down operations th...

Страница 298: ...stacle is detected to be pinched SUNROOF TIMER FUNCTION ZC6002580002 t Driver s door switch or passenger s door switch OFF ON OFF Close ON Open Ignition switch IG1 Sunroof operation Disabled OFF Enabled ON t 30 Seconds Sunroof timer operation time The sunroof ECU integrated into the sunroof motor assembly receives the ignition switch IG1 signal transmitted by ETACS ECU If the ignition switch IG1 s...

Страница 299: ...nctions can be programmed The programmed information is kept in memory even when the battery is disconnected Adjustment item scan tool MB991958 display Adjustment item Adjusting contents scan tool MB991958 display Adjusting contents Door unlock mode Door lock system All doors unlock All the doors are unlocked when the driver s side door is unlocked Dr door unlock Only the driver s side door is unl...

Страница 300: ...MEMO 1 ...

Страница 301: ... 4172 55 12 4 6 10 5 56 15 106 065 0 4 0 14 6 10 5 56 12 4 6 10 114 064 70 6 10 55 064 70 6 10 0 0 56 46 0 70 6 10 6 4 24 5574 10 614 0 5 56 62 5 70 6 10 9 40 0 5 4 5 10 74 6 10 70 6 10 ...

Страница 302: ...ol operation can be performed by using these switches The keyless operation key also incorporates an indicator light that enables the driver to check if the signal is transmitted correctly or if the battery in the key is discharged Refer to P 42B 15 The keyless operation key incorporates the immobilizer function that inhibits starting the engine by using an unauthorized key The incorporated TPMS f...

Страница 303: ...ock sensor Lock switch Liftgate lock release handle Lock switch Lock switch and Unlock sensor Driver s side door IG knob Receiver antenna module A A Section A A Unlock sensor Front door outside handle Door assembly Lock switch and Unlock sensor Passenger s side door Outside transmission antenna assembly Driver s side Inside transmission antenna assembly Rear Driver s side Inside transmission anten...

Страница 304: ...cations with ETACS ECU ECM ABS or ASC ECU and combination meter via CAN Wire communication with the steering lock unit Wireless communication with the keyless operation key via the receiver antenna module and interior exterior transmitter antennas Wireless communication with the TPMS transmitter Output to the outer tone alarm Steering lock incorporates push switch and steering lock unit The steeri...

Страница 305: ...the liftgate when a driver carrying the keyless operation key pulls the front door outside handle Liftgate lock release handle Locks all the doors and the liftgate when a driver carrying the keyless operation key presses the lock switch on the front door outside handle or on the liftgate lock release handle Exterior transmitter antenna assembly Driver s side Converts the data output from KOS ECU v...

Страница 306: ...lti information display ETACS ECU Communicates with KOS ECU via CAN Send ignition switch status Receives the door lock unlock request from KOS ECU outputs the lock unlock signal and flashes the turn signal light to inform the driver that the doors are locked unlocked ECM Communicates with KOS ECU via CAN Permits inhibits the engine starting and controls the engine operation Send atmospheric pressu...

Страница 307: ...porating a transponder Indicator light Radio frequency signal CAN B communi cation Front Rear Driver s side Driver s side Passenger s side Liftgate Rear Passenger s side CAN C comm unication 0001 Liftgate lock actuator Keyless operation key Exterior transmitter antenna assembly Interior transmitter antenna assembly Radio frequency signal Radio frequency signal Radio frequency signal Front tire LH ...

Страница 308: ...TION M24200100004USA0000010000 ZC600226 ZC600259 ZC600218 0000 Front door outside handle driver s side Front door outside handle passenger s side Liftgate lock release handle Keyless operation key 55 12 4 6 10 5 56 15 5 56 12 4 6 10 ...

Страница 309: ...MG NGUU QRGTCVKQP MG URGEKHKGF VQ MG NGUU QRGTCVKQP MG EQPVCKPGF KP VJG TGURQPUG FCVC HTQO VJG MG NGUU QRGTCVKQP MG EQKPEKFGU YKVJ VJG VJCV JCU DGGP UVQTGF KP 7 D TGIKUVTCVKQP QRGTCVKQP 6JG MG NGUU QRGTCVKQP MG UGPFU VJG TGURQPUG VQ 15 7 QPN YJGP VJG 15 URGEKHKE VQ 15 7 EQPVCKPGF KP VJG TGEGKXGF FCVC EQKPEKFGF YKVJ VJG UVQTGF P VJG DGIKPPKPI QH VJG EQOOWPKECVKQP HQT EGTVKHKECVKQP 15 7 ETGCVGU C GP...

Страница 310: ...lock sensor on the driver side front passenger side door outside handle or the liftgate lock release handle switch is turned ON it transmits the exterior data from the exterior transmitter antenna assembly on the operation side At the same time KOS ECU transmits the interfering radio wave reversal code from the exterior transmitter antenna assembly on the other side The interfering radio wave will...

Страница 311: ...yless operation key only on the outer side of the vehicle it requests ETACS ECU to lock all the doors including the liftgate CONTROL OF LOCKING OPERATION ZC6002520000 ON OFF b d c e f h g g a CAN The lock switch of door outside handle driver s side passenger s side or the lock switch of liftgate lock release handle Transmission Communication Un communicating Un transmitting Response Un answering T...

Страница 312: ...ceive the exterior data only KOS ECU transmits the lock request to ETACS ECU If there is no response from the keyless operation keys perform Step 6 once KOS ECU transmits the exterior data from the exterior transmitter antenna assembly on the operation side At the same time KOS ECU transmits the interfering radio wave reversal code from the exterior transmitter antenna assembly on the other side T...

Страница 313: ...ommunication to detect if all the doors are closed KOS ECU transmits the exterior data from the exterior transmitter antenna assembly driver s side passenger s side liftgate After Step 1 is completed KOS ECU transmits the interior data from the interior transmitter antenna assembly Front After the specified time period varies with the number of the keyless operation keys registered in KOS ECU has ...

Страница 314: ...om the interior transmitter assembly front After the specified time period varies with the number of the keyless operation keys registered in KOS ECU has passed KOS ECU performs the following condition judgments When KOS ECU receives the response from the keyless operation keys that received the interior data KOS ECU terminates the auto lock judgment When all the responded keyless operation keys r...

Страница 315: ...ice Flashes once Outer tone alarm Sounds once initial setting or none Sounds twice initial setting or none Sounds once KOS TIMER LOCK FUNCTION When none of the doors is opened within 30 seconds after the doors are unlocked by KOS ETACS ECU automatically outputs the door lock signal to lock the doors This function prevents the doors from being unlocked accidentally KEYLESS ENTRY FUNCTION M242001000...

Страница 316: ...keyless operation key has three knob type buttons and transmits encrypted code peculiar to each key in an electric wave signal A shiny three diamond mark on the back of the keyless operation key gives it a classy look An indicator light which illuminates when signals are received is on the keyless operation key This indicator light informs you of the signal transmission status and warns you of fla...

Страница 317: ... M U T III sub assembly to the data link connector up to four encrypted codes of keyless operation keys can be registered FUNCTION FOR CONFIRMING ETACS ECU RECEIVER OUTPUT AND OPERATION When the ETACS ECU receives an electric wave signal of the identification code stored in the receiver antenna module the ETACS ECU outputs LOCK UNLOCK signal and informs the driver of the keyless entry system opera...

Страница 318: ...0 c b b a a 0 6 second b 1 2 seconds c 15 seconds OFF ON ON OFF Illuminate Extinguish Lock relay output OFF ON Door unlock switch output OFF ON Door lock switch output Unlock relay output Dome lamp When LOCK signal from the keyless operation key is input to the ETACS ECU via receiver antenna module all doors are locked and the dome light will turn off When UNLOCK signal is input all doors are unlo...

Страница 319: ...timer lock period can be changed Refer to P 42B 29 OPERATION INHIBITION CONDITIONS The operation of the system is inhibited when The ignition key is in the ignition switch Any door or the liftgate is open door switch is ON including door ajar SECURITY ALARM The security alarm function is based on the door lock operation by the keyless entry system or KOS The function warns when the doors including...

Страница 320: ... Press the IG knob on the steering lock and the push switch inside the steering lock is turned ON When the push switch inside the steering lock is turned ON KOS ECU activates the interior transmitter antenna assembly to send the transmitter signal to the keyless operation key On receiving the transmitter signal from KOS ECU the keyless operation key performs the keyless operation key certification...

Страница 321: ... with the keyless operation key inside the vehicle and monitors if it is carried out of the vehicle When none of the registered keyless operation keys up to four respond during the communication KOS ECU determines that the key has been brought out of the car and the keyless operation key certification agreement memory does not exist and does not permit starting of the engine 016 6JG OQPKVQTKPI HWP...

Страница 322: ...herefore the transponder is maintenance free Each vehicle is provided with two keys and up to eight emergency keys can be registered in the vehicle s KOS ECU More than one trillion ID code combinations can be registered and parts of them are irregularly changed whenever the ignition key is turned ON This feature prevents code copying resulting in higher security of the system 016 9JGP 15 7 KU TGRN...

Страница 323: ...he ECM When the road tire pressure is low it sends a warning signal causing the TPMS warning light to be illuminated When the TPMS has problems it sends a warning signal causing the TPMS warning light to be flashed 016 JCPIG VQ EQPVKPWQWU KNNWOKPCVKQP CHVGT HNCUJKPI HQT CDQWV OKPWVG For 3 seconds after the ignition switch is turned to the ON position KOS ECU illuminates the TPMS warning light to c...

Страница 324: ...90 28 or more TPMS TRANSMITTER TIRE PRESSURE SENSOR The TPMS transmitter combines the valve and tire pressure sensor in a single unit The TPMS transmitters are mounted inside the tires The TPMS transmitter measures tire pressure directly with its tire pressure sensor and sends radio frequency signals to KOS ECU The TPMS transmitter includes acceleration sensor that senses tire rotation The KOS ECU...

Страница 325: ... pressed Warning indicator flashes for 30 seconds The outer tone alarm will not sound IG knob in LOCK OFF position and push switch OFF are detected 30 seconds have passed after the warning output started No keyless operation key detected inside the car No keyless operation key is detected inside the car when the IG knob is pressed The warning indicator flashes for 5 minutes The outer tone alarm wi...

Страница 326: ...b is in other than LOCK position Warning indicator flashes for 5 seconds Outer tone alarm sounds for 2 96 seconds in pattern 1 IG knob in LOCK OFF position and push switch OFF are detected 5 seconds have passed after the warning output started Push switch is pressed ON when the keyless operation key is inside the car Lock switch on the keyless operation switch is pressed again 5 seconds have passe...

Страница 327: ...lock transmitter antennas receiver antenna module etc is detected Steering lock communication error has been detected when the push switch was pressed ON The IG knob is in other than the LOCK position while some error is being detected TPMS failure warning ID not stored The TPMS transmitter ID is not registered in the WCM Flashes Symbol and SERVICE REQUIRED is displayed ID is registered normally D...

Страница 328: ...ansmitte r is low The reception problem warning is activated because of the low battery voltage of the TPMS transmitter The signal of normal battery voltage is received from the TPMS transmitter that was warned Vehicle speed input problem The vehicle speed is not input The vehicle speed is input Abnormal vehicle speed value The vehicle speed value is abnormal The normal vehicle speed value is rece...

Страница 329: ...8 display Adjusting contents Hazard answer back Adjustment of the number of keyless hazard warning light answer back flashes Lock 1 Unlock 2 LOCK Flashes once UNLOCK Flashes twice default Lock 1 Unlock 0 LOCK Flashes once UNLOCK No flash Lock 0 Unlock 2 LOCK No flash UNLOCK Flash twice Lock 2 Unlock 1 LOCK Flash twice UNLOCK Flash once Lock 2 Unlock 0 LOCK Flash twice UNLOCK No flash Lock 0 Unlock...

Страница 330: ...ds 120sec 120 seconds 180sec 180 seconds Duration pre alarm Adjustment of pre alarm continue time 10 sec 10 seconds default 6 sec 6 seconds Alarm With without theft alarm function Disable No function Enable With function default Panic alarm switch With without panic alarm function Disable No function Enable With function default KOS auto lock With without KOS auto lock function Enable No function ...

Страница 331: ... 4172 9 4 55 10641 1 7 9 106 065 0 4 0 14 6 10 5 56 12 4 6 10 55 064 70 6 10 1 4 70 6 10 6 4 24 5574 10 614 0 5 56 62 5 70 6 10 9 40 0 5 10 74 6 10 70 6 10 ...

Страница 332: ...n key incorporates the immobilizer function that inhibits starting the engine by using an unauthorized key The incorporated TPMS function monitors the air pressure of all the tires Each vehicle is provided with two ignition keys transmitter and up to eight ignition keys can be registered Settings of the keyless entry function can be adjusted using a customization function CONSTRUCTION DIAGRAM PANI...

Страница 333: ...message is additionally displayed on the Multi information display Combination meter Multi information display TPMS warning light Communicates with WCM via CAN Send ignition switch status Receives the warning request or warning information from WCM activates the TPMS warning iight ETACS ECU Communicates with WCM via CAN Receives the door lock unlock request from WCM outputs the lock unlock signal ...

Страница 334: ...uator Ignition key Radio frequency signal Radio frequency signal Front tire LH Front tire RH Rear tire LH Rear tire RH TPMS transmitter CPU Transmission circuit Antenna Pressure sensor Acc sensor Battery ABS or ASC ECU Dome light Ignition key cylinder illumination light Horn Panic switch 016 P ECUG QH TGRNCEGOGPV QH 9 CNN MG NGUU MG CPF VKTG RTGUUWTG UGPUQT UJQWNF DG TG TGIKUVGTGF WUKPI UECP VQQN ...

Страница 335: ...es A keyless entry system enables locking and unlocking of all doors the liftgate from 12m 39 4 feet away from the vehicle The following features are also available A three knob type transmitter with lock unlock and panic buttons The WCM incorporates a receiver and a receiving antenna Up to eight encrypted codes can be registered using scan tool MB991958 M U T III sub assembly Door unlock mode 016...

Страница 336: ...gnal transmission status and warns you of a flat battery in the transmitter A signal transmission circuit printed circuit and a battery are housed in one case The case is housed in the key grip thus improving resistance to water intrusion A coin type battery CR1620 is used in the transmitter The functions of the immobilizer system are integrated Refer to P 42C 9 The transmitter button operation al...

Страница 337: ...h time a signal is sent RECEIVER The receiver is incorporated into WCM together with the receiving antenna The receiver compares the signal the antenna received from the transmitter with the encrypted code registered in it and when they coincided outputs a signal from WCM By connecting scan tool MB991958 M U T III sub assembly to the data link connector encrypted codes of up to eight transmitters ...

Страница 338: ... and send LOCK can command to ETACS ECU all doors including liftgate are locked and the hazard warning light flashes once When UNLOCK signal is input driver s side door or all doors including liftgate are unlocked and the hazard warning light flashes twice KEYLESS ENTRY DOME LIGHT ANSWERBACK FUNCTION ZC6002550000 c b b a a 0 6 second b 1 2 seconds c 15 seconds OFF ON ON OFF Illuminate Extinguish L...

Страница 339: ...r lock time can be changed Refer to P 42C 13 OPERATION INHIBITION CONDITIONS The operation of the system is inhibited when The ignition key is in the ignition switch Any door or the liftgate is open door switch is ON including door ajar SECURITY ALARM The security alarm function is based on the door lock operation by the keyless entry system The function warns when the doors including the liftgate...

Страница 340: ...e of loss of the ignition key all keys except the lost one should be registered again for eliminating the registration of the lost key For addition of a key all the keys to be used afterwards including the added key should be registered again TIRE PRESSURE MONITORING SYSTEM TPMS FUNCTION M24200200007USA0000010000 When the tire pressure becomes under the specified value the TPMS function warns the ...

Страница 341: ...nates No indication TPMS problems Flashes Symbol and SERVICE REQUIRED is displayed Low tire pressure Illuminates Symbol and LOW TIRE PRESSURE is displayed 6 4 24 5574 6 4 5 1 8 7 5 Item Tire pressure kPa psi Standard pressure at cold reference 220 32 Alarm ON pressure 174 25 or less Alarm OFF pressure 190 28 or more TPMS TRANSMITTER TIRE PRESSURE SENSOR The TPMS transmitter combines the valve and ...

Страница 342: ...warning light bulb open circuit check The ignition switch is turned form LOCK OFF to ON The TPMS warning light illuminates for 3 seconds 3 seconds have passed after the TPMS warning light is lit Tire pressure alarm The received tire pressure value is under the threshold value The indicator illuminates until it receives the normal tire pressure value Symbol and LOW TIRE PRESSURE is displayed The re...

Страница 343: ... following functions can be customized The programmed information is held even when the battery is disconnected Adjustment item scan tool MB991958 display Adjustment item Adjusting contents scan tool MB991958 display Adjusting contents Hazard answer back Adjustment of the number of keyless hazard warning light answer back flashes Lock 1 Unlock 2 LOCK Flashes once UNLOCK Flashes twice default Lock ...

Страница 344: ...answer back Short 0 01 second default Long 0 02 second Horn chirp by RKE Horn chirp by RKE Not sound horn No horn answerback function Lock any time The horn sounds when the lock button of keyless entry transmitter is pressed once W lock any time The horn sounds when the lock button of keyless entry transmitter is pressed twice default Timer lock timer Timer lock period adjustment 30sec 30 seconds ...

Страница 345: ... 4172 6 4 14 106 065 0 4 0 14 6 10 7 2 4 4 614 4 41 2 465 40 5 5 9 0 5 9 2 4 0 9 5 4 4 4 9 2 4 0 9 5 4 1765 4414 10 74 6 10 70 6 10 ...

Страница 346: ...ce 8 Side air dam 9 Liftgate spoiler 10 Low air resistance large size door mirrors 2418 06 1 11 0 0 11 Air guide duct to cool the radiator has been installed behind the front bumper 66 4 75 4 4 0 0 55 12 Heated door mirrors 13 Roof rails 66 4 241 7 6 2 14 Pad front bumper core has been installed in the front bumper to reduce the severity of an injury in an accident with pedestrians 15 Vehicle spee...

Страница 347: ...y in scrapping Resin front bumper side bracket has been adopted to improve the alignment with the body Air dam structure in front of tires with the overhung front bumper at the right and left corners suppress the airflow against the tires and smoothen the airflow along the bumper sides Pad front bumper core has been installed in the upper part of the bumper to reduce the severity of an injury in a...

Страница 348: ...t three diamond mark Clip Clip The structure that allows the radiator grille to be removed and installed only by clips at the top and bottom has been adopted The newly designed front three diamond mark is protruded from the installation surface of the radiator grille to improve the brand appeal 6 4 14 41 2 465 ...

Страница 349: ... optimized shape of the following parts Air dam structure in front of tires Refer to P 51 3 Overfender shape Overfender shape from the front bumper to the fender and from the quarter panel to the rear bumper keeps the off road vehicle image as an SUV at the same time the optimized shape of the related parts improves aerodynamic performance Door mirror Roof drip molding Side air dam Liftgate spoile...

Страница 350: ...M ZC6007560000 Rear roof garnish Liftgate garnish Lower liftgate garnish The following garnishes have been installed on the body to improve the appearance and marketability Rear roof garnish Liftgate garnish Lower liftgate garnish 6 4 14 9 0 5 9 2 4 0 9 5 4 ...

Страница 351: ...the mist switch is ON and when the mist switch is OFF at low speed until the stop position is reached When the mist switch is briefly turned ON the wiper operates once at low speed The windshield washer is a 2 nozzle and 4 jet type Washer nozzle with the integral check valve has been adopted to prevent the washer fluid from running down and to improve the response to switch operation The washer mo...

Страница 352: ...T1 from the position of the windshield intermittent wiper switch on the column switch and the vehicle speed signal sent from the TCM to ETACS via CAN communication 016 7UKPI VJG EQPHKIWTCVKQP HWPEVKQP VJG XGJKENG URGGF FGRGPFGPV KPVGTOKVVGPV HWPEVKQP ECP DG KPXCNKFCVGF 4GHGT VQ 2 When ETACS receives the ON signal of the windshield intermittent wiper switch it turns the windshield wiper drive signa...

Страница 353: ... ZC5012800000 ON OFF ON OFF ON OFF HI ON Windshield low speed wiper switch Windshield high speed wiper switch Windshield wiper auto stop signal ON OFF Windshield wiper drive signal Windshield wiper speed switching relay LO OFF Low speed operations High speed operations When the windshield low speed wiper switch on the column switch is turned ON while the ignition switch is in ACC or ON position th...

Страница 354: ...ch is kept ON for 0 3 seconds or longer the windshield wiper drive signal the wiper drive signal output time varies depending on the conditions For details see the table is turned ON and the windshield wiper operates at high speed The windshield wiper is turned OFF with 3 seconds delay after the windshield washer switch is turned OFF Even when the windshield washer switch is turned ON while the wi...

Страница 355: ...eld after the rear wiper switch is turned on and then proceeds with intermittent operation Reverse gear linked rear wiper function has been adopted In this function the rear wiper performs continuous low speed operation for 2 to 3 cycles approximately 1 second after the selector lever is shifted to R position while the rear wiper switch is in the intermittent position and then proceeds with interm...

Страница 356: ...second after that ETACS turns the rear wiper drive signal ON for 3 seconds for approximately 2 cycles and operates the intermittent action in 8 second intervals again By the special operation of the rear wiper switch on the column switch 2 consecutive operations the rear wiper can operate continuously regardless of the set intermittent time 016 7UKPI VJG EQPHKIWTCVKQP HWPEVKQP VJG TGCT YKRGT KPVGT...

Страница 357: ...000081USA0000010000 CONSTRUCTION DIAGRAM ZC6002290001 Door mirror assembly Mirror glass Remote control mirror switch Door mirrors have the following features Remote controlled door mirrors have been adopted Door mirrors with heater element have been adopted Large size mirror glass has been adopted for easy confirmation of safety around the vehicle Low air resistance door mirror shape has been intr...

Страница 358: ...rmittent wiper interval is calculated according to the intermittent wiper volume control and vehicle speed default Front wiper washer Disabling or enabling washer linked wiper function Washer only Without function Washer linked wiper With function default Rear wiper intermittent duration Adjustment of rear wiper interval 0 seconds No wiper interval 4 seconds 4 seconds 8 seconds 8 seconds default 1...

Страница 359: ... 4172 06 4 14 106 065 0 4 0 14 6 10 05647 06 2 0 0 114 1051 5 6 4106 5 6 5 10 5 6 6 4 5 6 UGCVGT 7 6 5 6 44 0 06 5 6 6 64 5 06 4 14 64 114 64 7 411 0 0 ...

Страница 360: ...or pocket front door trim rear door trim 5CHGV KORTQXGOGPV Front and rear collision protection seat mechanism front seat Child restraint LATCH system outer rear seats Tether anchorage rear seat ELR 3 point seat belt driver s seat ELR ALR 3 point seat belt passenger s seat rear Seat belt retractor with a driver s side double pre tensioner and variable force limiter Seat belt retractor with a passen...

Страница 361: ...r 0000 Upper glove box Upper box Tissue holder Front floor console Lower glove box Rear floor console Center lower tray Side box Built in cup holder Armrest box Console cup holder Rear floor console box Armrest The instrument panel offers the following features 06 4 14 05647 06 2 0 0 114 1051 ...

Страница 362: ...a 500 ml plastic bottle as well as a side box that can store a cigarette box lighter coins or other small items is installed on the outer side of the driver s seat A ashtray that can be moved to the driver s cup holder or to the rear armrest has been equipped to the front part of front floor console A console cup holder that can store two 20 oz plastic bottles or brick packs has been installed in ...

Страница 363: ... By expanding the height adjustment amount up to Normal height 47 mm Power height 46 mm the more optimized driving position can be adjusted The pump type seat height adjustment lever has been adopted for convenient use Some models are equipped with leather seats Option Some models have a dual height front rear adjustment function in the driver s seat A motorized power seat reclining adjustment sli...

Страница 364: ...ent mechanisms have been adopted to improve amenity Armrests with a cup holder have been installed to improve convenience Head restraints with height adjustment have been installed to the outer seats The child restraint LATCH system is installed as standard on the outer seats and the tether anchorage on all the seats improving the versatility of child seat installation Also because the seats are e...

Страница 365: ...olding into the underfloor Ԙ ԙ Ԛ Third seat Third seat offers the following features The third seat which can be folded underneath the floor has been adopted enabling the use of flat luggage space Urethane less structure has been adopted for the cushion realizing an extremely thin cushion which can be folded together with seatback and headrest MULTI SEAT ARRANGEMENT M25200000080USA0000010000 This ...

Страница 366: ...e room arrangement Two passengers ride maximum luggage space ZC600245 Three passengers ride longer luggage space ZC600246 Three passengers ride longer luggage space Rear seatback folded forward ZC600247 Five passengers ride luggage space ZC600248 06 4 14 5 6 ...

Страница 367: ...with ELR has been adopted together with a double pre tensioner driver s side three point seat belt with ELR ALR has been adopted together with a the pre tensioner front passenger s side and variable force limiter A seat belt warning light has been included on the combination meter to encourage the driver to fasten the seat belt when the belt is not connected A seat belt warning light has been incl...

Страница 368: ...25200000120USA0000010000 ZC6002370000 Cowl side trim Front pillar trim Upper center pillar trim Upper quarter trim Rear end trim Lower quarter trim Rear scuff plate Lower center pillar trim Front scuff plate The interior trim is a full trim to improve quality The collision energy absorbing structure that is integrated with a trim has been adopted to the pillar trim With the structure that reduces ...

Страница 369: ...m and rear door trim to improve convenience Also the bottle holding capability has been improved to accommodate bottles with shapes that are difficult to keep upright Door pockets have been installed to the front and rear door trim panels The front door pockets have a large capacity The rear door pockets which are also used as bottle holders can also store the headset for the rear monitor For the ...

Страница 370: ...wo upper tonneau cover fixing positions have been adopted When the fixing point at the rear is used the second seats can be reclined even when the tonneau cover is being used Also the third tonneau cover fixing position has been added to near the floor of luggage room so that when the tonneau cover is not used it can be fixed on the luggage room floor Vehicles with tonneau cover Luggage hooks have...

Страница 371: ...juries upon the secondary impact against the cabin during a collision and improves safety Headlining which absorbs and dissolves chemical substances has been adopted This headlining efficiently absorbs and dissolves a smoking smell a life smell and formaldehyde Chemical substances such as formaldehyde and organic solvent generated from the interior parts have been minimized by the refined material...

Страница 372: ...MEMO 06 4 14 ...

Страница 373: ... 05 10 4 5 0 746 0 4 5 5 56 105647 6 10 4 8 4 5 4 1 7 1 524 0 2 55 0 4 5 4106 4 1 7 5 4 1 7 746 0 4 1 7 4106 2 6 5 0514 5 2 6 5 0514 5 6 5 5 0514 1 72 06 55 6 10 7 0 9 6 5 0514 5 6 6 9 6 24 6 05 10 4 2 6 24 6 05 10 4 2 55 0 4 5 5 6 6 9 40 0 6 2 55 0 4 5 4 1 0 614 6 545 7 545 4 52 100 614 ...

Страница 374: ...driver s and front passenger s sides When a frontal impact exceeds the threshold upon a frontal collision or depending on the seat position driver s seat side the air bag inflates the cushion air bag in two stages improving the protection for the front seat passengers The side airbag is activated when an impact exceeds the threshold upon a side collision and the cushion air bag is instantaneously ...

Страница 375: ...y the sides of the vehicle The SRS warning light on the combination meter indicates the operational status of the SRS The clock spring is installed in the steering column The seat belt pre tensioner is built into the driver s and passenger s front seat belt retractor The seat slide sensor is installed at the seat adjuster section of the driver seat in order to detect the driver seat slide position...

Страница 376: ...nt Side impact sensor rear Curtain air bag module Side airbag module Seat belt pre tensioner Seat belt pre tensioner Lap pre tensioner LH AA00 Occupant classification ECU Seat slide sensor Weight sensor SRS warning lamp Vehicle identification code chart plate Passenger s seat belt warning light Passenger s air bag OFF indicator light Vehicles for USA Vehicles for CANADA 5722 06 4 564 06 5 56 545 0...

Страница 377: ...ition switch IG1 Driver s air bag module Passenger s front air bag module Side airbag module LH Side airbag module RH Seat belt pre tensioner LH Seat belt pre tensioner RH Lap pre tensioner LH Curtain air bag module LH Curtain air bag module RH ON OFF ON OFF ON OFF ON OFF ON OFF ON OFF ON OFF ON OFF ON OFF ON OFF ON OFF ON OFF Front impact sensor RH Front impact sensor LH Side impact sensor LH Sid...

Страница 378: ... AC506232 AC506239 ZC601274 ZC601275 Driver s air bag module Clock spring Sunvisor Seat belt with pre tensioner driver s and passenger s seat SRS ECU Passenger s front air bag module 0000 B D F E G A C E AC506241 AC506233 AC506710 ZC601276 Curtain air bag module right and left Lap pre tensioner LH H I J K Glove box Side airbag module driver s and passenger s seat 5722 06 4 564 06 5 56 545 0 4 0 14...

Страница 379: ...K INVOLVING MODULE READ SERVICE MANUAL FOR IMPORTANT FURTHER DATA D CAUTION DO NOT DISASSEMBLE OR DROP IF DEFECTIVE REFER TO SERVICE MANUAL E EXCEPT CANADA ZC5019150000 WARNING EVEN WITH ADVANCED AIR BAGS Children can be killed or seriously injured by the air bag The back seat is the safest place for children Never put a rear facing child seat in the front Always use seat belts and child restraint...

Страница 380: ...ot test or diagnose Do not store in more than 200 F 93 C Store the air bag cover is top For information on handing replacement and disposal methods refer to the service manual K EXCEPT CANADA This Vehicle is Equipped with Advanced Air Bags Even with Advanced Air Bags Children can be killed or seriously injured by the air bag The back seat is the safest place for children Never put a rear facing ch...

Страница 381: ... ECU simultaneously detect an impact that exceeds a certain threshold turned ON SRS ECU energizes the driver s and passenger s front air bag modules squibs driver s and passenger s seat belt pre tensioners squibs and driver s lap pre tensioner squib thus deploying the air bags and triggering the seat belt pre tensioners Also the advanced air bag has been adopted to optimize the air bag deployment ...

Страница 382: ...s data of the side impact sensor front center pillar area side impact sensor rear rear quarter panel area and G sensor in SRS ECU to calculate collision severity during side collision SRS ECU judges necessity of side airbag and curtain air bag based on the calculated collision severity 5 56 105647 6 10 DRIVER S AIR BAG MODULE M25201000020USA0000010000 ZC501972 A A 0001 Air bag module Section A A I...

Страница 383: ...tor according to how the steering wheel turns It must be in the neutral position when assembling the clock spring 016 QT VJG ENQEM URTKPI EGPVGTKPI RTQEGFWTGU TGHGT VQ VJG 5 48 07 PASSENGER S FRONT AIR BAG MODULE M25201000105USA0000010000 ZC601604 Squib connectors Inflator 0000 Air bag Air bag module The passenger s front air bag module consists of an air bag inflator module cover incorporating th...

Страница 384: ...g there are holes through which gas is partially released to alleviate shock to the occupant when the air bag is deployed An inflator that does not contain sodium azide is used CURTAIN AIR BAG MODULE M25201000005USA0000010000 ZC601617 Igniter power Burst disk Curtain air bag module Inflator 0000 The curtain air bag module consists of an air bag an inflator and the fixing gear relating to those par...

Страница 385: ...gnostics of the front impact sensor internal components If a malfunction occurs it sets the diagnostic trouble code SIDE IMPACT SENSOR M25201000060USA0000010000 ZC501991 AC506883 AC506366 Front Second seat belt Side impact sensor Quarter panel Rear Center pillar Side impact sensor 0000 The side impact sensors are installed to the lower part of the center pillars on both sides and to the quarter pa...

Страница 386: ...at slide sensor outputs the current by switching high output current and low output current from the seat slide position as shown in the figure Based on the output current SRS ECU determines the deployment stage of the front air bag and then energizes the squib Shield plate position Current value Deployment stage When the shield plate is in the detection range of the seat slide sensor Low output c...

Страница 387: ...ied to the front passenger seat The occupant classification ECU identifies the occupant class based on the signals from weight sensors and sends the signal to SRS ECU When the occupant is determined to be less than 66 lbs 30 kg the passenger s front air bag is not deployed SEAT BELT WITH PRE TENSIONER M25201000080USA0000010000 ZC501943 Pipe Gear Ball Spool Gas generator 0000 Seat belt with pre ten...

Страница 388: ...o reduce the forward travel distance of occupants Upon a collision when the front impact sensor attached to the front of the vehicle body detects an impact that exceeds the permissible limit the lap pre tensioner ignites the gas generator with the signal from SRS ECU and the generator emits the gas By the gas pressure the wire linked to the piston travels in the direction of movement then the seat...

Страница 389: ...d with the following capabilities Backup power supply in case of power failure in collisions Boosting function in case of battery voltage drop Self diagnosis function to avoid system s operation errors and improve its reliability DIAGNOSTIC FUNCTION The SRS ECU has the following functions to make system checking using the scan tool easy Diagnostic trouble code output Service data output Actuator t...

Страница 390: ...B20 Curtain air bag module RH squib system shorted to squib circuit ground B1B21 Curtain air bag module RH squib system shorted to squib circuit power supply B1B22 Curtain air bag module RH squib system squib circuit open B1B23 Curtain air bag module RH squib system short circuit between squib circuit terminals B1B50 Seat belt switch LH circuit ground side shorted B1B51 Seat belt switch LH circuit...

Страница 391: ...r squib system shorted to squib circuit ground B1C39 Driver s pre tensioner squib system shorted to squib circuit power supply B1C3A Driver s pre tensioner squib system squib circuit open B1C3B Driver s pre tensioner squib system short circuit between squib circuit terminals B1C47 Front passenger s pre tensioner squib system shorted to squib circuit ground B1C48 Front passenger s pre tensioner squ...

Страница 392: ...ool from the SRS ECU input data Item No Check items Check conditions Normal conditions 01 SRS warning light illumination request Ignition switch ON After warning lamp pre check OFF Ignition switch ON During warning lamp pre check ON The following items can be read by the scan tool from the occupant classification ECU input data Item No Check items Check conditions Normal conditions 01 Passenger we...

Страница 393: ...g 4515 Ib to 2048 Kg 4515 Ib 26 Pa seat weight sensor 3 LF volt Apply a load to the passenger seat 0 to 5000 mV 27 Pa seat weight sensor 4 LR Apply a load to the passenger seat 2048 Kg 4515 Ib to 2048 Kg 4515 Ib 28 Pa seat weight sensor 4 LR volt Apply a load to the passenger seat 0 to 5000 mV 30 VIN Information Always ACTUATOR TEST The scan tool can be used to forcibly operate the next actuator I...

Страница 394: ...ISM ZC501966 SRS ECU connector Partition panel SRS ECU side connector Partition panel Wiring harness side connector terminal to short circuit Short spring Short spring wiring harness side connector Connector connected Wiring harness side connector Terminal to short circuit 0000 This mechanism prevents the improper deployment of air bag module because of the current application to the squib due to ...

Страница 395: ...SRS ECU connector Connector between the clock spring and body side wiring harness Each air bag module connector Each pre tensioner connector 5722 06 4 564 06 5 56 545 5 56 105647 6 10 ...

Страница 396: ...MEMO 5722 06 4 564 06 5 56 545 ...

Страница 397: ... 5 7 10 74 6 10 70 6 10 1 0 6 10 6 4 0 4 0 14 6 10 7 6 0 14 6 10 52 610 4 1 7 0 59 6 0 4 0 14 6 10 5514 5514 51 6 0 4 0 14 6 10 219 4 5722 0 4 0 14 6 10 0 5 4 7 4 2 10 5 56 0 4 0 14 6 10 6 5 0 4 0 14 6 10 10 74 6 10 70 6 10 6 6 4 5 56 0 4 0 14 6 10 6 56 6 5 7 70 6 105 0 10641 5 10 74 6 10 70 6 10 ...

Страница 398: ...of the vehicle to the fender panel and the rear combination light assemblies tail light assemblies rear side marker lights license plate lights and high mounted stop lights to the rear of the vehicle Even if the headlight assembly bracket is damaged the damaged bracket can be replaced For interior lights the front dome light rear dome light luggage compartment light glove box light center console ...

Страница 399: ...g light Vehicles for discharge headlight Headlight low beam ZC501807 Tail stop light Rear turn signal light Tail light assembly back up light License plate light High mounted stop light Rear combination light assembly 0000 Rear side marker light The headlight assembly employs the large four light integrated with the front turn signal light position light and front side marker light Uncut lenses ha...

Страница 400: ...Headlight assembly vehicles without discharge headlight High beam W halogen headlight 60 HB3 Low beam W halogen headlight 51 HB4 Position light W 5 W5W Front turn signal light W 21 WY21W Front side marker light W 5 W5W Headlight assembly vehicles with discharge headlight High beam W halogen headlight 60 HB3 Low beam W discharge headlight 35 D2R Position light W 5 W5W Front turn signal light W 21 W...

Страница 401: ...m the posture during parking so that the beam direction changes To control the improper beam direction caused by such vehicle posture change the headlight automatic leveling ECU calculates the vehicle pitch angle based on the average of height sensor values obtained for 12 seconds after the vehicle speed becomes constant This beam direction control while driving at a constant speed is performed on...

Страница 402: ...e compartment headlight relay LO Height sensor rear System component and function Parts name Functional description Column switch lighting switch When the lighting switch is set to the headlight position the headlight relay LO inside the engine compartment turns ON to transmit the signal to the headlight automatic leveling ECU Height sensor Front Detects the elongation contraction of the front sus...

Страница 403: ...ture Data link connector Outputs diagnosis codes System block diagram ZC501814 Combination meter Headlight automatic leveling warning display multi information display in combination meter 0000 Ignition switch IG1 Headlight relay LO Column switch lighting switch Height sensor front Height sensor rear Vehicle speed signals Headlight automatic leveling ECU Headlight assembly LH integrating motor Hea...

Страница 404: ...repair of the headlight assembly ZC5018150000 Bracket A Bracket B Bracket C When only brackets A B or C shown in the figure are damaged a low cost repair can be performed by mounting a repair bracket For the repair procedures refer to Workshop Manual 55 5 64 6 0 ...

Страница 405: ...and off the light The rear dome light which illuminates the rear passenger s seat is installed above the second seat The luggage compartment light is installed to the upper part of the luggage compartment A glove box light has been added to the glove box The center console down light has been installed to the upper surface of the center lower box To provide safety for the foot area when getting in...

Страница 406: ...Ignition key cylinder illumination light W 1 5 FUNCTION AND CONTROL BY ETACS ECU M25400000120USA0000010003 Following functions are controlled by ETACS ECU Function Function description Headlight Headlight automatic shutdown function P 54A 10 Flasher timer function Turn signal light P 54A 12 Comfort flasher function P 54A 12 Hazard warning light P 54A 12 Daytime running light Daytime running light ...

Страница 407: ... switch is turned OFF with the lighting switch ON the light turns off automatically after 3 minutes If the driver s door is opened during the 3 minutes the light turns off after one second One seconds before turning off the light reminder tone alarm sounds However if the driver s door is opened with the ignition key inserted the key reminder alarm tone alarm operates in the first priority If the l...

Страница 408: ... ZC603243 ON OFF ON OFF ON OFF ON OFF ON OFF 0000 t 0 4 seconds or les s t t Ignition switch IG Turn signal ligh t switch R H Turn signal ligh t switch L H Turn signal ligh t output RH Turn signal ligh t output LH With the ignition switch in the ON position when the turn signal switch is turned ON momentarily 0 4 second or less ETACS ECU turns ON the turn signal light output and flashes the turn s...

Страница 409: ...hts vehicles without discharge headlight with the lighting switch OFF or in the taillight position Also ETACS ECU extinguishes the daytime running light with the lighting switch in the headlight position vehicles with discharge headlight or illuminates the low beam headlights of 100 illuminance vehicles without discharge headlight When the ignition switch is turned to the LOCK OFF position while t...

Страница 410: ... Illuminated OFF Extinguished ON TAIL When the fog light switch is turned to ON with the tail lights or the headlights lit the tail light switch or the headlight switch is ON the ETACS ECU illuminates the fog lights If the tail light or the headlight is turned off with the lighting switch OFF while the fog lights lit the fog lights turn off at the same time to prevent unattended operation 55 5 64 ...

Страница 411: ...is turned ON or the door lock is operated the lights turn off at that time When the ignition switch is ON By opening any door or liftgate the light 100 turns ON and OFF when the door or liftgate is closed When all doors and the liftgate are closed and the ignition key is removed By removing the ignition key with all doors and the liftgate closed the light turns ON 50 and turns off after 15 seconds...

Страница 412: ... OFF the interior light returns to the illumination state when the doors are opened closed keyless entry transmitter switch is operated or ignition switch is turned to ACC position After returning the light turns OFF after 30 minutes when the interior light auto turn off condition is met 016 6JG KPVGTKQT NKIJV CWVQOCVKE UJWV QHH VKOG ECP DG CFLWUVGF D VJG EWUVQOK G HWPEVKQP 4GHGT VQ 2 IGNITION KEY...

Страница 413: ...eration time to activate the comfort flasher function Normal 0 4 seconds default Long 0 8 seconds Hazard answer back Adjustment of the number of keyless hazard warning light answer back flashes Lock 1 Unlock 2 LOCK Flashes once UNLOCK Flashes twice default Lock 1 Unlock 0 LOCK Flashes once UNLOCK No flash Lock 0 Unlock 2 LOCK No flash UNLOCK Flash twice Lock 2 Unlock 1 LOCK Flash twice UNLOCK Flas...

Страница 414: ... next periodic inspection timing using the driving distance and elapsed time By operating the rheostat switch the brightness of the meter and illumination can be adjusted in eight steps The layout has been simplified by displaying what is required to meet the legislative requirements with the indicator and by displaying other things with multi information display Even with the ignition switch in t...

Страница 415: ...the meter information switch turns off the warning display and displays the caution mark Caution mark is displayed also when two or more alarms occur simultaneously 2 Information screen interrupt display screen The odometer and trip meter or service reminder information will be displayed Also appropriate contents are displayed when a warning is issued 3 Door ajar warning display screen Displays th...

Страница 416: ...KEG TGOKPFGT HWPEVKQP KU FKUCDNGF CV UJKROGPV H CP QH VJG HQNNQYKPI EQPFKVKQPU KU OGV VJG HWPEVKQP DGEQOGU CXCKNCDNG 9JGP FGNKXGTKPI VJG XGJKENG VQ VJG EWUVQOGT GPCDNG VJG UGTXKEG TGOKPFGT HWPEVKQP CPF EJGEM VJCV VJG UEJGFWNG KU 0 5 The ignition switch is turned to ON while pressing the meter information switch The driving distance of the odometer reaches 100 km or 60 miles 016 7UKPI VJG UECP VQQN...

Страница 417: ...function vehicles without KOS ETACS ECU Light reminder tone alarm function ETACS ECU Door ajar warning tone alarm function ETACS ECU Freeze warning tone alarm A C ECU Parking brake reminder tone alarm function Combination meter Multi information display interrupt display tone alarm Combination meter ETACS ECU function customization tone alarm ETACS ECU A C operation tone alarm A C ECU Audio operat...

Страница 418: ...tion is activated the tone alarm sounds KEYLESS OPERATION KEY REMINDER TONE ALARM FUNCTION VEHICLES WITH KOS IGNITION KEY REMINDER TONE ALARM FUNCTION VEHICLES WITHOUT KOS With the ignition switch in the LOCK OFF position when the driver s door is opened with the ignition key inserted into the ignition key cylinder or the keyless operation key left in the vehicle the tone alarm sounds LIGHT REMIND...

Страница 419: ...S ECU functions or when the customization is executed the tone alarm sounds in each case A C OPERATION TONE ALARM AUDIO OPERATION TONE ALARM According to the tone alarm sounding request signal which is received when the A C radio and CD player CD changer or audio visual navigation unit is operated the tone alarm sounds METER INFORMATION SWITCH OPERATION TONE ALARM When the meter information switch...

Страница 420: ...eering wheel is moved to the front of the vehicle because the right and left levers fall down ensuring the driver s safety In addition the column switch secures the rigidity that the levers do not fall down by the normal operation however it cannot be reused after the deformation 5514 5514 51 6 GENERAL INFORMATION M25400000001USA0000010003 The plug in type accessory socket has been installed for t...

Страница 421: ...gh price class Standard equipment Medium price class Option The maximum load is 120 W when a single accessory socket is used When three accessory sockets are used simultaneously the combined maximum load for three sockets is 120 W 219 4 5722 GENERAL INFORMATION M25400000001USA0000010004 The AC power supply which can be used as power supply for home electric appliances has been installed to the rea...

Страница 422: ...JG XGJKENG RCTMGF VJG QRGTCVKQP OC CWVQOCVKECNN UVQR VQ RTGXGPV VJG KPXGTVGT WPKV HTQO DGKPI QXGTJGCVGF HVGT VJG RQYGT UWRRN KU EWV QHH YJGP VJG KPXGTVGT VGORGTCVWTG FGETGCUGU VJG RQYGT CWVQOCVKECNN TGVWTPU VQ 10 When the power supply stops turn the ignition switch to LOCK OFF position once to inhibit the power supply to the AC inverter After that turn the ignition switch to ON again for return 0 ...

Страница 423: ...s information in the voice input mode press OFF hook Then the transmission starts to call the receiver In addition with the vehicle stopped the occupant can call the receiver by operating the cellular phone unit and then have a conversation using the hands free cellular phone system Also when the conversation ends the occupant can finish the call by pressing ON hook in the steering voice control s...

Страница 424: ...l switch Cellular phone 1 Vehicles without MMCS 2 Vehicles with MMCS BluetoothTM CAN bus line CAN CAN Phone voice Voice Microphone power Microphone unit built in front dome light Hands free module 6 5 GENERAL INFORMATION M25400000001USA0000010010 ETACS ECU has three main functions 016 6 5 NGEVTQPKE 6KOG CPF NCTO QPVTQN 5 UVGO 55 5 64 6 5 ...

Страница 425: ...unication line Detects and stores an open circuit and short circuit of communication line Communication error diagnosis of network ECUs Detects and stores the ECU that is not properly transmitting data CODING FUNCTION By writing the coding data such as vehicle model destination and equipment level to ECUs the functions of ECUs can be changed There are two types of coding method the local coding an...

Страница 426: ... once UNLOCK No flash Lock 0 Unlock 2 LOCK No flash UNLOCK Flash twice Lock 2 Unlock 1 LOCK Flash twice UNLOCK Flash once Lock 2 Unlock 0 LOCK Flash twice UNLOCK No flash Lock 0 Unlock 1 LOCK No flash UNLOCK Flash once Lock 0 Unlock 0 No function Front wiper operation Adjustment of the intermittent windshield wiper operation Normal INT Intermittent wiper interval is fixed to 4 seconds Variable INT...

Страница 427: ...unlocked Dr door unlock Only the driver s side door is unlocked when the driver s side door is unlocked default Auto door unlock by P position Auto door unlock by P position function Disable No function default Always enabled Always with function P W unlocked With function with power window unlocked Duration of horn chirp Horn sounding time during horn answer back Short 0 01 second default Long 0 ...

Страница 428: ...fault DoorEntry enable Only door entry function is enabled ENG strt enable Only engine starting function is enabled Both disabled All KOS functions are disabled KOS unlock disable time Adjusts the door unlock inhibition period after door lock is activated 0sec 0 seconds 3sec 3 seconds default 5sec 5 seconds 6 6 4 5 56 GENERAL INFORMATION M25400000001USA0000010008 When the doors are locked using th...

Страница 429: ... indicator Horn for theft alarm ETACS ECU Headlight Panic button Horn HI Horn LO DATA LIST M25400000131USA0000010002 Using the M U T III scan tool MB991958 the input data sent from the sensors and switches can be read For service data items refer to Workshop Manual 55 5 64 6 6 4 5 56 ...

Страница 430: ...20 seconds Door s or tailgate is opened by forced entry In 10 seconds or 6 seconds Hood is opened All doors and hood remains closed for 2 seconds In 180 seconds Door s or tailgate is opened by forced entry In 175 seconds or ignition switch is turned ON position Operating the door lock with the keyless entry transmitter or keyless operation key except when locked by the key cylinder or door lock sw...

Страница 431: ...onds 016 7UKPI VJG EQPHKIWTCVKQP HWPEVKQP VJG RCPKE CNCTO HWPEVKQP ECP DG GPCDNGF FKUCDNGF 4GHGT VQ 2 CONFIGURATION FUNCTION M25400000119USA0000010002 Using scan tool MB991958 adjusts the following function The programmed information is held even when the battery is disconnected Adjustment item scan tool MB991958 display Adjustment item Adjusting contents scan tool MB991958 display Adjusting conte...

Страница 432: ...MEMO 55 5 64 ...

Страница 433: ... 4172 7 1 0 0 8 6 10 5 56 106 065 4 1 0 2 4 0 4 0 14 6 10 52 4 0 4 0 14 6 10 06 00 0 4 0 14 6 10 657 5 7 6 1 70 6 10 5 56 5 0 4 4 4 06 46 0 06 5 56 0 4 ...

Страница 434: ...put of 650 W has been combined with the Rockford Fosgate premium sound system Specification Note AM FM electronic tuning radio SIRIUS satellite radio Only the vehicles with the satellite radio tuner 6 disk CD autochanger 1 compatible with MP3 2 Six CDs can be loaded Audio integrated 4 ch power amplifier vehicles with 6 speakers General 140 W Audio amplifier integrated 8 ch power amplifier and digi...

Страница 435: ... and hold the DISC button Press and hold the RPT button Press and hold the RDM button Press and hold the CD eject button Audio adjustment With BASS MID TREBLE BALANCE or FADER selected adjust the adjustment level to zero Select NORMAL of SOUND FIELD Select NORMAL of MUSIC TYPE Others Press and hold the TUNE knob Press and hold the MODE switch of steering remote control switch 52 4 GENERAL INFORMAT...

Страница 436: ...ed in the front sash trim Also two types of tweeters the balance dome tweeter vehicles with six speakers and soft dome tweeter Rockford Fosgate premium sound system are available The soft dome tweeter can play clearer treble with less distortion compared to the balance dome tweeter 7 1 0 0 8 6 10 5 56 52 4 ...

Страница 437: ... cone 2 way coaxial speaker Rockford Fosgate premium sound system are available Compared to the paper cone speakers the PP polypropylene cone speakers can playback crisper bass The door opening of the vehicles with Rockford Fosgate premium sound system is blocked by using the sheet metal cover and the urethane integrated resin sheet resin cover and water proof film to make the door into a speaker ...

Страница 438: ...been installed to the passenger seat side quarter trim in the luggage room enabling the playback of dynamic deep bass 06 00 GENERAL INFORMATION M25403800001USA0000010004 The pole antenna has been adopted for the AM FM and satellite radio 105647 6 10 4 ZC6027720000 Pole antenna Vehicles with satellite radio 7 1 0 0 8 6 10 5 56 06 00 ...

Страница 439: ...ted Operation part ZC3050170000 AC505475 MODE AUDIO VOL PWR INFO NAVI SCALE MENU Mitsubishi Multi Communication System ENT SET OPEN Display function Contents Navigation screen Displays the navigation functions including the map display search guidance information search Vehicle position information screen Displays the position information of current location Longitude and latitude altitude GPS rec...

Страница 440: ...h Canadian French and Latin Spanish Audio and visual function There are the following functions in addition to the navigation function Music server function DVD drive unit FM AM radio MP3 WMA playback function Control by steering audio switch Integrated 4 ch power amplifier 140 W Correspond to Rockford Fosgate㫤premium sound system Output of DVD video 5 1 channel data Connect with satellite radio t...

Страница 441: ...bination meter Audio visual navigation unit A C ECU Satellite radio tuner Hands free module 4 4 06 46 0 06 5 56 GENERAL M25403800001USA0000010006 ZC3049490000 AC505256 Rear display unit A rear seat 9 inch wide LCD monitor with DVD has been adopted for rear passengers to enjoy DVD CD video games video or others The monitor has been installed to the center of the roof between the first row seats and...

Страница 442: ...3064110000 AC507976 Rear display unit Radio and CD player or CD changer or audio visual navigation unit Wireless headphone Wireless remote controller Speaker Audio and video adopter Play sound External input picture External input sound Sound Picture 7 1 0 0 8 6 10 5 56 4 4 06 46 0 06 5 56 ...

Страница 443: ... 4172 1 06 4 100 6 0 6914 0 106 065 0 4 0 14 6 10 5647 674 5 56 12 4 6 10 ...

Страница 444: ...CV CPF EQOOWPKECVKQP VKOKPI EQPVTQN OGVJQF VQ JCTFYCTG OCVVGTU UWEJ CU VJG JCTPGUU V RG CPF NGPIVJ CPF VJG TGUKUVCPEG XCNWGU STRUCTURE M25403000002USA0000010000 ZC6007390000 ETACS ECU Column switch Column ECU Power window main switch Sunroof motor assembly LIN bus line Master ECU Slave ECU Slave ECU Slave ECU Master and slave ECUs are connected to the LIN bus lines The master ECU is the ETACS ECU ...

Страница 445: ...CU performs the master tasks and slave tasks and the slave ECUs perform the slave tasks When the master ECU performs a master task the header frame which stores information to call certain slave tasks ECU is transmitted at regular intervals When the master ECU and slave ECU perform a slave task the ECU called by the header frame transmits the response frame which stores data used for control A hea...

Страница 446: ...value 1 Recessive 0 Dominant A message frame consists of regions that include a synchronization start region identifier region data region and checksum region A few bits of recessive data is used to separate the frame from each region Frame Region name Description Header Synchronization start region A region that informs each ECU of the starting of header transmission by sending dominant signals f...

Страница 447: ...s in data content The sending end ECU calculates data region value according to the specified computing equation and the result is stored in this filed The receiving end ECU detects the transmission error based on the checksum filed value 1 06 4 100 6 0 6914 0 5 56 12 4 6 10 ...

Страница 448: ...MEMO 1 06 4 100 6 0 6914 0 ...

Страница 449: ...16 1 GROUP 16 ENGINE ELECTRICAL CONTENTS CHARGING SYSTEM 16a STARTING SYSTEM 16b IGNITION SYSTEM 16c ...

Страница 450: ... 4172 10641 4 4 0 6914 0 106 065 0 4 0 14 6 10 5647 674 5 56 12 4 6 10 5 015 5 0 75 0156 5 ...

Страница 451: ...PGEGUUCT VTCPUOKUUKQP TCVG HQT EQOOWPKECVKQP VJG U UVGO FCVC HQTOCV CPF EQOOWPKECVKQP VKOKPI EQPVTQN OGVJQF VQ JCTFYCTG OCVVGTU UWEJ CU VJG JCTPGUU V RG CPF NGPIVJ CPF VJG TGUKUVCPEG XCNWGU CAN offers the following advantages Transmission rates are much faster than those in conventional communication up to 1 Mbps allowing much more data to be sent It is exceptionally immune to noise and the data o...

Страница 452: ...DER is the first Mitsubishi vehicle with a gateway function integrated to ETACS ECU as the network central ECU Refer to GROUP 54A ETACS ECU P 54A 28 The CAN system consists of the following three networks CAN B middle speed body network CAN C high speed power train network and the diagnosis CAN C diagnosis exclusive network Each ECU is connected to one of the networks depending on its functions Th...

Страница 453: ...ABS ECU vehicles without ASC or ASC ECU vehicles with ASC Transaxle control module TCM Engine control module ECM 015 5 0 Data link connector SYSTEM OPERATION M25402000003USA0000010000 ZC5017680000 ECU 1 A A A A B B B C C A B Interval a Interval b Interval c C C C B B A A A ECU 1 ECU 2 CAN bus Data frames Transmission suspended by mediation Re transmission The CAN communication system is described ...

Страница 454: ...ccording to ID codes memorized in data frames Transmission of low priority data data frames is suspended by the issuing ECUs until the bus clears when no transmission data exists on the CAN bus 016 H VJG UWURGPFGF UVCVG EQPVKPWGU HQT C URGEKHKE VKOG PGY FCVC FCVC HTCOG EQPVGPV KU ETGCVGF CPF UGPV ECU containing suspended data frames transmits the data when the bus becomes available 016 6JGTG KU GP...

Страница 455: ...ta control etc ENKE 4GFWPFCPE JGEM 4 TGIKQP Region where to check for errors in sent data The transmitting ECU calculates data regions by applying prescribed operations and stores the results The receiving ECU detects erroneous communication by comparing the CRC region with the data region EMPQYNGFIG TGIKQP Region where to conform the reception of sent data 1 PF QH TCOG Indicates the end of the fr...

Страница 456: ...d CAN BUS DIAGNOSTICS M25402000005USA0000010000 As ECUs are connected via CAN bus including scan tool always diagnose CAN bus to confirm its normality when inspecting Simply by performing scan tool screen operations the following inspections can be performed automatically and the result can be used to verify the CAN bus status Confirmation of diagnostic trouble code of ETACS ECU Confirmation of co...

Страница 457: ...MEMO 10641 4 4 0 6914 0 ...

Страница 458: ... 4172 6 4 4 10 6 10 0 0 8 06 6 10 106 065 0 4 5 4 26 10 6 4 70 6 6 4 10641 1 24 5514 7 7 6 8 06 6 10 5 56 ...

Страница 459: ...economy The idle up speed is controlled in two steps to secure the air cooling performance during summer and to improve the fuel economy in the seasons with moderate temperature Improvement of fuel economy by the cooling fan control depending on the refrigerant pressure and vehicle speed GLOBAL ENVIRONMENT PROTECTION New refrigerant system HFC134a has been adopted By the optimization of A C system...

Страница 460: ...ZC6003690000 Interior temperature sensor ZC6003700000 Ambient temperature sensor ZC6003710000 A C pressure sensor ZC6003720000 Photo sensor 6 4 4 10 6 10 0 0 8 06 6 10 0 4 5 4 26 10 ...

Страница 461: ...ction pipe Suction flexible hose Discharge flexible hose Condenser A C compressor ZC6000210000 Low pressure side valve High pressure side valve Receiver HEATER UNIT M25501000008USA0000010000 6 4 4 10 6 10 0 0 8 06 6 10 6 4 70 6 ...

Страница 462: ... outlet air temperature of the defroster has been set lower than that of foot to prevent overheating the driver s face Fin thermo sensor to directly measure evaporator temperature reduces occurrence risk of an evaporator freeze which will lead to the compressor lock Clean air filter has been introduced as standard to protect the unit from the intrusion of foreign materials fallen leaves and others...

Страница 463: ...SA0000010000 HEATER CONTROLLER ZC600015 MAX A C ZC600016 ZC600017 ZC600018 ZC6003210000 Rear window defogger switch Outside Inside air selection switch Mode selection knob Temperature adjustment knob Blower knob A C switch Rear window defogger switch Outside Inside air selection switch Mode selection knob Temperature adjustment knob Blower knob A C switch Rear window defogger switch Outside Inside...

Страница 464: ...C COMPRESSOR M25501000011USA0000010000 ZC600338 Discharge cavity capacity 0000 High efficiency scrolling compressor built into the oil separation enhance the cooling performance Compressor discharge cavity capacity has been expanded to reduce discharge pulse vibration and noise A C COMPRESSOR CLUTCH WITH THERMAL FUSE A thermal fuse is installed in the A C compressor field core If the compressor fa...

Страница 465: ...ant amount is less than specified or refrigerant pressure is abnormal by using the ambient temperature ambient temperature sensor to measure refrigerant inflation rate and refrigerant pressure measured by the A C pressure sensor When refrigerant amount or refrigerant pressure is judged abnormal the compressor is cut off to protect the A C system 016 9JGP CDPQTOCNKV QEEWTU VJG KPFKECVQT HNCUJGU REA...

Страница 466: ...ication 016 QT FGVCKNU QH 0 EQOOWPKECVKQP TGHGT VQ 4172 QPVTQNNGT TGC 0GVYQTM 2 CAN COMMUNICATION INPUT SIGNALS TABLE Signal Transmitter ECU Engine coolant temperature signal ECM Vehicle speed signal Engine speed signal Ambient temperature signal ETACS ECU Wiper signal Ignition key signal Average ambient temperature signal COMBINATION METER DIAGNOSTIC FUNCTION A C ECU has the following functions f...

Страница 467: ...at footwell To driver seat footwell Center ventilator Side ventilator Side ventilator The rear heater duct for the 2nd row seats has been introduced as standard and the air distribution ratio to front and 2nd row has been optimized in order to enhance the air heating performance for the 2nd row and to reduce the circulation of cooled air back to the front row 6 4 4 10 6 10 0 0 8 06 6 10 8 06 6 10 ...

Страница 468: ...introduced from the front deck and emitted from the air outlet behind the back of rear bumper Areas of fresh air intake hole and air outlet ventilation have been optimized in order to improve air volume ventilation performance while securing cabin quietness 6 4 4 10 6 10 0 0 8 06 6 10 8 06 6 10 5 56 ...

Страница 469: ...MEMO 6 4 4 10 6 10 0 0 8 06 6 10 ...

Страница 470: ...17 1 GROUP 17 ENGINE AND EMISSION CONTROL CONTENTS ENGINE CONTROL 17a AUTO CRUISE CONTROL SYSTEM 17b EMISSION CONTROL 17c ...

Страница 471: ...42 1 GROUP 42 BODY CONTENTS BODY 42A KEYLESS OPERATION SYSTEM KOS 42B WIRELESS CONTROL MODULE WCM 42C ...

Страница 472: ...52 1 GROUP 52 INTERIOR AND SUPPLEMENTAL RESTRAINT SYSTEM SRS CONTENTS INTERIOR 52A SUPPLEMENTAL RESTRAINT SYSTEM SRS 52B ...

Страница 473: ...ir Service The Body Repair sections immediately follow Group 55 Heater Air Conditioning and Ventilation Please read this manual carefully so that it will be of assistance for your service and sales activities Please note the following service manuals are also available and should be used in conjunction with this manual SERVICE MANUAL CD MSCD 007B 2007 BODY REPAIR MANUAL MSSP 407B 2007 PARTS CATALO...

Отзывы:

Нет отзывов