Inovance MD380 Series Скачать руководство пользователя страница 222

Страница: 222 / 304

Description of Function Codes

MD380 User Manual

- 222 -

*URXS)(8VHU'H¿QHG)XQFWLRQ&RGHV

Function Code

Parameter Name

Setting Range

Default

FE-00

8VHUGH¿QHGIXQFWLRQFRGH

F0-00 to FP-xx, A0-00 to

$[[[8[[

F0-00

FE-01

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F0-02

FE-02

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F0-03

FE-03

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F0-07

FE-04

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F0-08

FE-05

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F0-17

FE-06

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F0-18

FE-07

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F3-00

FE-08

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F3-01

FE-09

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F4-00

FE-10

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F4-01

FE-11

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F4-02

FE-12

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F5-04

FE-13

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F5-07

FE-14

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F6-00

FE-15

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F6-10

FE-16

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F0-00

FE-17

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F0-00

FE-18

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F0-00

FE-19

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F0-00

FE-20

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F0-00

FE-21

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F0-00

FE-22

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F0-00

FE-23

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F0-00

FE-24

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F0-00

FE-25

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F0-00

FE-26

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F0-00

FE-27

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F0-00

FE-28

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F0-00

FE-29

8VHUGH¿QHGIXQFWLRQFRGH

Same as FE-00

F0-00

)(LVXVHUGH¿QHGSDUDPHWHUJURXS<RXFDQVHOHFWWKHUHTXLUHGSDUDPHWHUVIURPDOO0'
IXQFWLRQVFRGHVDQGDGGWKHPLQWRWKLVJURXSFRQYHQLHQWIRUYLHZDQGPRGL¿FDWLRQ

roup FE provides a maximum of 30 user-defined parameters. If "FE-00" is displayed,

it indicates that group FE is null. After you enter user-defined function code mode, the

GLVSOD\HGSDUDPHWHUVDUHGH¿QHGE\)(WR)(DQGWKHVHTXHQFHLVFRQVLVWHQWZLWK

that in group FE.

efesotomasyon.com

Содержание MD380 Series

Страница 1: ...his manual describes the correct use of the MD380 series AC drive including selection parameter setting commissioning maintenance inspection Before using the AC drive read this manual carefully to hav...

Страница 2: ...y loading capacity and supports torque control 6 8VHU SURJUDPPDEOH IXQFWLRQ The MD38PC1 programmable card enables you to write programs in ladder diagram WV SURJUDPPLQJ HQYLURQPHQW LV FRPSOHWHO FRPSDW...

Страница 3: ...to run PID parameters switchover Two groups of PID parameters can be switched over via terminals or can be automatically switched over according to deviation PID feedback loss detection You can set th...

Страница 4: ...functions or performance contact the technical support personnel of Inovance to ensure correct use CE Mark The CE mark on the MD380 declares that the AC drive complies with the European low voltage di...

Страница 5: ...HU 2SHUDWLRQ LVSOD DQG SSOLFDWLRQ DPSOHV 48 2SHUDWLRQ 3DQHO 48 4 2 Viewing and Modifying Function Codes 51 4 3 Structure of Function Codes 52 4 4 Quick View of Function Codes 53 H QLWLRQ DQG 2SHUDWLRQ...

Страница 6: ...O DQG LVSOD 184 Group F8 Auxiliary Functions 189 Group F9 Fault and Protection 199 Group FA Process Control PID Function 209 URXS E REEOH XQFWLRQ L HG HQJWK DQG RXQW 215 Group FC Multi Reference and S...

Страница 7: ...2 8 2 Physical Appearance and Mounting Dimensions of the MD380 266 8 3 Recommended Cable Diameter and Installation Dimensions of Power Terminals 272 8 5 Selection and Installation of External DC React...

Страница 8: ...efesotomasyon com...

Страница 9: ...1 Safety Information and Precautions efesotomasyon com...

Страница 10: ...DJH component missing or damage upon unpacking Do not install the equipment if the packing list does not conform to the product you received WARNING Handle the equipment with care during transportatio...

Страница 11: ...FRGHU DQG HQVXUH WKDW WKH VKLHOG is reliably grounded Before power on DANGER Check that the following requirements are met The voltage class of the power supply is consistent with the rated voltage cl...

Страница 12: ...to discharge to a safe value Failure to comply will result in personal injury Ensure that the AC drive is disconnected from all power supplies before starting the repair or maintenance work All the p...

Страница 13: ...lly when the AC drive s rated power is greater than that of the motor adjust the motor protection parameters on the operation panel of the AC drive or install a thermal relay for the motor for protect...

Страница 14: ...ctor ensure that the time interval between switching is at least one hour because frequent charge and discharge shortens the service life of the capacitor inside the AC drive KHQ D FRQWDFWRU LV LQVWDO...

Страница 15: ...may explode when they are burnt Poisonous gas is generated when the plastic parts are burnt Treat them as ordinary industrial waste 15 Adaptable Motor The standard adaptable motor is four pole squirre...

Страница 16: ...Safety Information and Precautions MD380 User Manual 16 efesotomasyon com...

Страница 17: ...2 Product Information efesotomasyon com...

Страница 18: ...ark 2T T Voltage Class 5T 0 75 0 75 11 11 B Yes General type 7T Three phase 220 V Three phase 380 V Three phase 480 V Three phase 690 V P Fan pump type AC drive model Rated input Rated output Manufact...

Страница 19: ...ard Power terminals Bottom cover Interface for connecting external operation panel AC drive nameplate Fan 2SHUDWLRQ panel Control terminals Figure 2 3 Components of the MD380 series AC drive sheet met...

Страница 20: ...690 V N Sheet metal housing 7HFKQLFDO 6SHFL FDWLRQV 7DEOH 7HFKQLFDO VSHFL FDWLRQV RI WKH 0 Item 6SHFL FDWLRQV Standard functions Maximum frequency Vector control 0 500 Hz V F control 0 500 Hz Carrier...

Страница 21: ...t implements the process closed loop control system Auto voltage regulation AVR It can keep constant output voltage automatically when the mains voltage changes 2YHUYROWDJH 2YHUFXUUHQW VWDOO control T...

Страница 22: ...a which the state inside the AC drive is monitored 581 Command source 2SHUDWLRQ SDQHO FRQWURO Terminal control Communication control You can perform switchover between these sources in various ways Fr...

Страница 23: ...revent malfunction Protection functions Motor short circuit detection at power on power input output phase loss protection overcurrent protection overvoltage protection undervoltage protection overhea...

Страница 24: ...ENTER RUN LOCAL REMOT FED REV TUNE TC RPM A V Hz BR MD380 Three phase AC power supply Moulded case circuit breaker MCCB or earth leakage circuit breaker ELCB Electromagnetic contactor Noise filter on...

Страница 25: ...G ZLWK reactor as standard Improve the power factor of the input side PSURYH WKH HI FLHQF DQG WKHUPDO VWDELOLW RI WKH GULYH Eliminate the impact of higher harmonics of the AC drive input side and redu...

Страница 26: ...braking unit Multiple braking units are connected in parallel for the AC drive of 75 N DQG DERYH 2 H WHQVLRQ card 1 0 2 W FDQ H WHQG YH V DQG RQH AI3 is used for separation analog input and can be con...

Страница 27: ...DB9 interface It applies to all models 2SHQ FROOHFWRU encoder interface card MD38PG5 It is the open collector encoder interface card with 1 1 frequency division output with optional multiple frequency...

Страница 28: ...Product Information MD380 User Manual 28 efesotomasyon com...

Страница 29: ...3 Mechanical and Electrical Installation efesotomasyon com...

Страница 30: ...0 series AC drive of plastic housing is a built in product DQG QHHGV WR EH LQVWDOOHG LQ WKH QDO V VWHP 2QO WKH RSHUDWLRQ SDQHO H SRVHV RQ WKH QDO FRYHU IRU WKH XVHU WR SHUIRUP RSHUDWLRQV 7KH QDO V VWH...

Страница 31: ...ow and causing faults Figure 3 2 Installation of the insulation guide plate Insulation guide plate MD380 MD380 3 1 3 Mechanical Installation Method and Process The MD380 series AC drives have two hous...

Страница 32: ...Figure 3 4 External hanging bracket for the MD380 External hanging bracket Figure 3 5 Embedded installation of the MD380 plastic housing Install the AC drive on the front of the control cabinet Back...

Страница 33: ...WKH 0 VKHHW PHWDO KRXVLQJ Install the AC drive on the front of the control cabinet Back panel of control cabinet Fix four screws Figure 3 8 Hoisting the MD380 sheet metal housing 4 Embedded installat...

Страница 34: ...Q LJXUH WR HQVXUH VXI FLHQW VSDFH for heat dissipation Take heat dissipation of other components in the cabinet into consideration 2 Install the AC drives upright to facilitate heat dissipation If mul...

Страница 35: ...1 Press inward symmetrically to disconnect the hook from the hook slot Hook slot 2 Catch the edge of the cover and lift it Figure 3 13 Removal of the front cover of the MD380 sheet metal housing 1 Lo...

Страница 36: ...e phase AC drive L1 L2 PB 8 V 32 5 02725 Table 3 2 Description of main circuit terminals of three phase AC drive Terminal Name Description R S T Three phase power input terminals Connect to the three...

Страница 37: ...esistor Braking unit V 8 MD380 MCCB Three phase 220 V 50 60 Hz T S R T S R P M Braking resistor Braking unit External DC reactor 7KUHH SKDVH 9 N DQG HORZ 7KUHH SKDVH 9 N V 8 PB MD380 MCCB T S R T S R...

Страница 38: ...XVH UH 3 Terminals PB for connecting braking resistor RU WKH GULYH RI N DQG EHORZ 9 DQG N DQG EHORZ ZLWK WKH EXLOW LQ braking unit terminals PB are effective Connect a braking resistor of the recommen...

Страница 39: ...RQVLGHU WKH FXUUHQW FDSDFLW of the power cable system overload capacity and short circuit capacity of the equipment upstream power distribution Generally make selection according to the recommended va...

Страница 40: ...H P Digital output 2 0 Digital output 1 2SWLFDO FRXSOLQJ LVRODWLRQ GXDO SRODULW RSHQ collector output 2XWSXW YROWDJH UDQJH 9 2XWSXW FXUUHQW UDQJH P 1RWH WKDW 0 DQG 20 DUH LQWHUQDOO LQVXODWHG but they...

Страница 41: ...J13 20 Single phase 220 V 50 60 Hz Braking resistor Digital input 1 Digital input 2 Digital input 3 Digital input 4 High speed pulse input MD380 Fault contact output Power for setting frequency Analo...

Страница 42: ...less than 20 m as shown in IROORZLQJ JXUH LJXUH LULQJ RI WHUPLQDOV 10 V AI1 GND Potentiometer PE 20 m MD380 In applications where the analog signal suffers severe interference install filter capacito...

Страница 43: ...ode To apply external power supply remove WKH MXPSHU EHWZHHQ 9 DQG 23 DQG WKH MXPSHU EHWZHHQ 20 DQG 0 DQG FRQQHFW WKH SRVLWLYH SROH RI H WHUQDO SRZHU VXSSO WR 23 DQG QHJDWLYH SROH WR 0 In such wiring...

Страница 44: ...JLWDO RXWSXW WHUPLQDO QHHGV WR GULYH WKH UHOD DQ DEVRUSWLRQ GLRGH VKDOO be installed on both sides of the relay coil The driving capacity is not more than 50 P 2WKHUZLVH LW PD FDXVH GDPDJH WR WKH 9 SR...

Страница 45: ...21 GND 20 23 24V T A1 T B1 T C1 Fault output NC 12 Three phase AC power L2 L3 L1 PE MCCB MC Contactor 0 81 Braking unit Braking resistor Shielded cable Main circuit Control circuit Jumper bar DI1 DI2...

Страница 46: ...Mechanical and Electrical Installation MD380 User Manual 46 efesotomasyon com...

Страница 47: ...4 Operation Display and Application Examples efesotomasyon com...

Страница 48: ...of the operation panel MF K RUN STOP RES QUICK PRG ENTER RUN LOCAL REMOT FED REV TUNE TC RPM A V Hz Command source indicator 21 local control Local 2 2SHUDWLRQ SDQHO FRQWURO Forward Reverse rotation...

Страница 49: ...V UHYHUVH URWDWLRQ DQG 2 LQGLFDWHV IRUZDUG URWDWLRQ 781 7 KHQ WKH LQGLFDWRU LV 21 LW LQGLFDWHV WRUTXH FRQWURO PRGH KHQ WKH LQGLFDWRU LV EOLQNLQJ VORZO LW LQGLFDWHV WKH DXWR WXQLQJ VWDWH KHQ WKH LQGLFD...

Страница 50: ...ed parameters in turn in the stop or running VWDWH DQG VHOHFW WKH GLJLW WR EH PRGL HG ZKHQ PRGLI LQJ parameters RUN R8N Start the AC drive in the operation panel control mode STOP RES Stop Reset Stop...

Страница 51: ...el II menu from Level III menu by pressing PRG or ENTER The difference is as follows After you press ENTER the system saves the parameter setting first and then goes back to Level II menu and shifts t...

Страница 52: ...code display state select the required function code by pressing the key or DV VKRZQ LQ WKH IROORZLQJ JXUH Figure 4 4 Selecting the required function code F0 Level I menu 50 00 PRG Shift A0 AC 80 FP 8...

Страница 53: ...operating the operation panel described above Figure 4 5 Switchover amongst three function code display modes 50 00 Status parameters Default display bASE Base mode All function codes 86 U 8VHU define...

Страница 54: ...H QHG PHQX LV QXOO WRWDO RI SDUDPHWHUV DUH SUH VWRUHG LQ WKH XVHU GH QHG PHQX DV OLVWHG LQ WKH IROORZLQJ table Function Code Parameter Name Function Code Parameter Name F0 01 Motor 1 control mode F0 0...

Страница 55: ...tatus SDUDPHWHUV KHWKHU SDUDPHWHUV DUH GLVSOD HG LV GHWHUPLQHG E WKH ELQDU ELWV RI YDOXHV converted from the values of F7 03 F7 04 and F7 05 in the hexadecimal format In stop state a total of 13 statu...

Страница 56: ...ce Hz Bus voltage 2XWSXW YROWDJH 2XWSXW FXUUHQW A 2XWSXW SRZHU N 2XWSXW WRUTXH DI state 15 14 12 11 10 9 8 2 VWDWH AI1 voltage V Count value Length value Load speed display PID reference 13 AI2 voltag...

Страница 57: ...43 and F7 04 H 2001 4 7 Starting or Stopping the AC Drive 4 7 1 Selecting the Start Stop Command Source There are three start stop command sources namely operation panel control terminal control and c...

Страница 58: ...llocate the forward rotation switch signal to DI2 and the reverse rotation switch signal to DI4 perform the setting as shown LQ WKH IROORZLQJ JXUH Figure 4 6 Setting of using the DIP switch for start...

Страница 59: ...DWLRQ VXFK DV WKH 56 352 86 3 1OLQN DQG 1RSHQ 7KH MD380 interacts with the user programmable card also by means of communication Insert a proper communication card into the extension card interface of...

Страница 60: ...C injection 1 active time F6 04 Startup frequency active time 0 1 2 F0 12 Frequency upper limit F0 17 Acceleration time Frequency f Time t Running command Default F6 06 0 0s F6 03 0 00 Hz F6 04 0 0s F...

Страница 61: ...artup frequency F6 06 Pre excited active time F0 12 Frequency upper limit F0 17 Acceleration time Frequency f Time t Running command Default F6 03 0 00 Hz F6 04 0 0s F6 07 0 F6 00 2 Pre excited startu...

Страница 62: ...1 to enable the timing function F8 44 Timing duration You can also set the timing duration by means of analog input such as potentiometer signal For details see the description of F8 43 4 7 5 Jog Run...

Страница 63: ...5 F0 02 1 Jog control button Terminal Function code Setting value DI1 DI2 DI3 DI4 DI5 20 Forward jog Terminal control Parameter setting Forward jog Reverse jog 2 5 2 Reverse jog F8 00 Jog running freq...

Страница 64: ...input multi speed terminal external feedback signal internal PID regulator or the host computer Set the related function codes of each frequency setting mode as shown in the preceding JXUH 4 8 2 Sett...

Страница 65: ...Y XY 0 1 2 3 4 5 6 7 8 9 0 1 2 3 4 5 6 7 8 9 0 1 2 3 4 5 6 7 8 9 2 1 0 F0 02 Command source selection 9 frequency setting channels Frequency source selection Frequency source superposition Frequency s...

Страница 66: ...uency source selection F0 07 0 Frequency feature setting F4 18 to F4 22 relationship between AI1 setting and corresponding value Default 0 10 V corresponding to 0 50 Hz F4 33 AI curve selection F4 18...

Страница 67: ...and tension control Figure 4 23 Automatic adjustment by PID regulator F0 07 0 F0 27 0 F0 03 8 Frequency source selection FA 00 PID reference source Setting target Built in PID regulator FA 01 PID digi...

Страница 68: ...DV WKH PXOWL IUHTXHQF LQSXW terminals The multiple frequencies are set based on the multi frequency table in group FC In addition you need to set F0 03 Main frequency source X selection to 6 Multi UH...

Страница 69: ...ion panel control Forward rotation command terminal communication Reverse rotation command Fs 0 Fs 0 Fs 0 Fs 0 F0 09 0 0 1 1 0 1 F8 13 terminal communication Frequency reference Rotating direction set...

Страница 70: ...t Fb 06 Actual length Fb 05 Set length F5 00 to F5 05 10 Length reached Reset Clear to 0 After the length is reached WKH 2 EHFRPHV 1 Length reset input Length reached output Length pulses input 1 2 3...

Страница 71: ...F5 00 to F5 05 9 Designated count value reached Reset Count reset input 2XWSXW RI GHVLJQDWHG count value reached 2XWSXW RI VHW FRXQW value reached Count pulse input 80 12 Count value Fb 09 11 80 12 11...

Страница 72: ...motor F1 01 to F1 05 Rated motor power Rated motor voltage Rated motor current Rated motor frequency Rated motor speed Model parameters manual input F1 06 to F1 20 Motor internal equivalent stator re...

Страница 73: ...er Manual input It is applied to applications where the motor cannot be disconnected from the load Input the motor parameters of the same model with successful auto tuning into function codes F1 00 to...

Страница 74: ...d set F1 37 Auto tuning selection to 3 Static tuning 2 and then press RUN on the operation panel The motor auto tuning starts 4 9 3 Setting and Switchover of Multiple Motor Parameter Groups The AC dri...

Страница 75: ...20 Q WKLV FDVH it is necessary to change the corresponding bit in F4 38 and F4 39 these two parameters respectively specifying the active mode setting of DI1 to DI5 and DI16 to DI10 to 1 The AC drive...

Страница 76: ...etails see the descriptions of group F5 Terminal Corresponding Function Code 2XWSXW HDWXUH HVFULSWLRQ FM CME ZKHQ Transistor able to output high speed pulses 10 Hz to 100 KHz drive capacity 24 VDC 50...

Страница 77: ...age reference at V F separation and PID reference or feedback The corresponding relationship between the voltage current and the actual reference or feedback LV GH QHG E WR Figure 4 32 Corresponding r...

Страница 78: ...WKH 3 7HUPLQDO 7KH FORVHG ORRS YHFWRU FRQWURO ZLWK VHQVRU KHOSV WR LPSURYH WKH VSHHG VWDELOLW accuracy of the AC drive In this case it is necessary to install an encoder for the motor Signals from th...

Страница 79: ...host computer you can view or modify the AC drive function codes view running state parameters and send running command and frequency reference to the AC drive through the serial port Figure 4 34 Com...

Страница 80: ...solation Applied to all models CANlink communication extension card MD38CAN1 CANlink communication adapter Applied to all models CANopen communication extension card MD38CAN2 CANopen communication ada...

Страница 81: ...e supports backup and restoration of parameter setting which is convenient for commissioning The AC drive also provides the retentive function on alarm information and accumulative running time You ca...

Страница 82: ...Operation Display and Application Examples MD380 User Manual 82 efesotomasyon com...

Страница 83: ...5 Function Code Table efesotomasyon com...

Страница 84: ...to 0 URXS DQG URXS DUH VWDQGDUG IXQFWLRQ SDUDPHWHUV URXS 8 LQFOXGHV WKH PRQLWRULQJ function parameters The symbols in the function code table are described as follows 7KH SDUDPHWHU FDQ EH PRGL HG ZKHQ...

Страница 85: ...DWRU 2 7HUPLQDO FRQWURO LQGLFDWRU 21 2 Communication control indicator blinking 0 F0 03 Main frequency source X selection 0 Digital setting non retentive at power down 1 Digital setting retentive at p...

Страница 86: ...uperposition 4 Switchover between Y and X and Y superposition Ten s digit X and Y superposition relationship 0 X Y 1 X Y 2 MAX X Y 3 MIN X Y F0 08 Preset frequency 0 00 to maximum frequency 50 00 Hz F...

Страница 87: ...perature 0 No 1 Yes 1 F0 17 Acceleration time 1 V V V Model dependent F0 18 Deceleration time 1 V V V Model dependent F0 19 Acceleration Deceleration time unit 0 1s 1 0 1s 2 0 01s 1 F0 21 Frequency of...

Страница 88: ...ce to frequency source 8QLW V GLJLW LQGLQJ RSHUDWLRQ panel command to frequency source 000 0 No binding 1 Digital setting frequency 2 AI1 3 AI2 4 AI3 5 Pulse reference DI5 6 Multi reference 7 Simple P...

Страница 89: ...pendent F1 04 Rated motor frequency 0 01 Hz to maximum frequency Model dependent F1 05 Rated motor speed 1 65535 RPM Model dependent F1 06 Stator resistance GULYH SRZHU N GULYH SRZHU N Model dependent...

Страница 90: ...FRGHU LUH VDYLQJ 89 HQFRGHU 0 F1 30 A B phase sequence of ABZ incremental encoder 0 Forward 1 Reserve 0 F1 31 Encoder installation angle 0 0 359 9 0 0 F1 32 8 9 SKDVH VHTXHQFH RI 89 HQFRGHU 0 Forward...

Страница 91: ...slip gain 50 200 100 F2 07 69 WRUTXH OWHU WLPH constant 1 31 28 F2 09 Torque upper limit source in speed control mode 0 F2 10 1 AI1 2 AI2 3 AI3 4 Pulse reference DI5 5 Communication reference 6 MIN AI...

Страница 92: ...02 Cut off frequency of torque boost 0 00 Hz to maximum frequency 50 00 Hz F3 03 Multi point V F frequency 1 F1 0 00 Hz to F3 05 0 00 Hz F3 04 Multi point V F voltage 1 V1 0 0 100 0 0 0 F3 05 Multi po...

Страница 93: ...14 Voltage digital setting for V F separation 0 V to rated motor voltage 0 V F3 15 Voltage rise time of V F separation 0 0 1000 0s It indicates the time for the voltage to rise from 0 V to rated moto...

Страница 94: ...ti reference terminal 1 13 Multi reference terminal 2 4 F4 02 DI3 function selection 14 Multi reference terminal 3 15 Multi reference terminal 4 16 Terminal 1 for acceleration deceleration time select...

Страница 95: ...ncy source Y and preset frequency 41 Motor selection terminal 42 Reserved 43 PID parameter switchover 0 F4 08 DI9 function selection 8VHU GH QHG IDXOW 8VHU GH QHG IDXOW 46 Speed control Torque control...

Страница 96: ...00 V F4 21 Corresponding setting of AI curve 2 maximum input 100 0 to 100 0 100 0 F4 22 OWHU WLPH 0 00 10 00s 0 10s F4 23 AI curve 3 minimum input 0 00 V to F4 25 0 00 V F4 24 Corresponding setting o...

Страница 97: ...07 Curve 5 4 points see A6 08 to A6 15 Ten s digit AI2 curve selection Same as AI1 Hundred s digit AI3 curve selection Same as AI1 F4 34 Setting for AI less than minimum input 8QLW V GLJLW 6HWWLQJ IRU...

Страница 98: ...s digit DI3 valid mode Same as DI1 Ten s digit DI4 valid mode Same as DI1 Hundred s digit DI5 valid mode Same as DI1 F4 39 DI valid mode selection 2 8QLW V GLJLW YDOLG PRGH 00000 Same as DI1 Ten s dig...

Страница 99: ...et count value reached 9 Designated count value reached 10 Length reached 11 PLC cycle completed 12 Accumulative running time reached 13 Frequency limited 14 Torque limited 5HDG IRU 581 16 AI1 larger...

Страница 100: ...pending 40 Current running time reached 41 Fault output no output at undervoltage 0 F5 04 2 IXQFWLRQ VHOHFWLRQ F5 04 WHQVLRQ FDUG 2 IXQFWLRQ selection 1 F5 05 WHQVLRQ FDUG 2 IXQFWLRQ 4 F5 06 FMP funct...

Страница 101: ...0 3600 0s 0 0s F5 18 Relay 1 output delay 0 0 3600 0s 0 0s F5 19 Relay 2 output delay 0 0 3600 0s 0 0s F5 20 2 RXWSXW GHOD 0 0 3600 0s 0 0s F5 21 2 RXWSXW GHOD 0 0 3600 0s 0 0s F5 22 2 YDOLG PRGH VHOH...

Страница 102: ...1 level Pre excitation level 0 100 0 F6 06 DC injection braking 1 active time Pre excitation active time 0 0 100 0s 0 0s F6 07 Acceleration Deceleration mode 0 Linear acceleration deceleration 1 S cu...

Страница 103: ...ard jog 4 Reverse jog 0 F7 02 6723 5 6 7 NH IXQFWLRQ 0 Stop function enabled only in operation panel control 1 Stop function enabled in any operation mode 1 F7 03 LED display running parameters 1 0000...

Страница 104: ...t09 Current power on time Hour Bit10 Current running time Min Bit11 Pulse reference Hz Bit12 Communication reference Bit13 Encoder feedback speed Hz Bit14 Main frequency X display Hz Bit15 Auxiliary f...

Страница 105: ...on software version F7 12 Number of decimal places for load speed display 8QLW V GLJLW 1XPEHU RI GHFLPDO SODFHV RI 8 1 0 0 decimal place 1 1 decimal place 2 2 decimal places 3 3 decimal places Ten s d...

Страница 106: ...maximum frequency 0 00 Hz F8 10 Frequency jump 2 0 00 Hz to maximum frequency 0 00 Hz F8 11 Frequency jump band 0 00 Hz to maximum frequency 0 00 Hz F8 12 Forward Reverse rotation dead zone time 0 0...

Страница 107: ...Hz F8 31 Detection amplitude of any frequency reached 0 0 100 0 maximum frequency 0 0 F8 32 Detection value 2 of any frequency reached 0 00 Hz to maximum frequency 50 00 Hz F8 33 Detection amplitude...

Страница 108: ...oltage upper limit F8 45 to 10 00 V 6 80 V F8 47 Module temperature threshold 0 C 100 C 75 C F8 48 Cooling fan working mode RUNLQJ GXULQJ UXQQLQJ RUNLQJ FRQWLQXRXVO 0 F8 49 DNHXS IUHTXHQF Hibernating...

Страница 109: ...voltage 120 150 130 F9 05 2YHUFXUUHQW VWDOO JDLQ 0 100 20 F9 06 2YHUFXUUHQW VWDOO SURWHFWLYH current 100 200 150 F9 07 Short circuit to ground upon power on 0 Disabled 1 Enabled 1 F9 09 Auto reset tim...

Страница 110: ...tor overload 12 Power input phase loss 13 Power output phase loss 14 Module overheat 15 External device fault 16 Communication fault 17 Contactor fault 18 Current detection fault 19 Motor auto tuning...

Страница 111: ...3rd fault F9 23 Power on time upon 3rd fault F9 24 Running time upon 3rd fault F9 27 Frequency upon 2nd fault F9 28 Current upon 2nd fault F9 29 Bus voltage upon 2nd fault F9 30 Input terminal state...

Страница 112: ...e as unit s digit Ten thousand s digit Communication fault Err16 Same as unit s digit F9 48 Fault protection action selection 2 8QLW V GLJLW QFRGHU 3 FDUG fault Err20 00000 0 Coast to stop 1 Switch ov...

Страница 113: ...Stop according to the stop mode 2 Continue to run at 7 of rated motor frequency and restore to the frequency reference if the load recovers Ten thousand s digit PID feedback lost during running Err31...

Страница 114: ...nstantaneous power failure 0 No action 1 Decelerate 2 Decelerate to stop 0 F9 60 Judging voltage of action disabled at instantaneous power failure 80 0 100 0 90 0 F9 61 Voltage recovery judging time a...

Страница 115: ...1 Reverse action 0 FA 04 PID reference feedback range 0 65535 1000 FA 05 Proportional gain Kp1 0 0 100 0 20 0 FA 06 Integral time Ti1 0 01 10 00s 2 00s FA 07 Differential time Td1 0 00 10 000 0 000s F...

Страница 116: ...2 PID initial value active time 0 00 650 00s 0 00s FA 23 Maximum deviation between two PID outputs in forward direction 0 00 100 00 1 00 FA 24 Maximum deviation between two PID outputs in reverse dire...

Страница 117: ...ount value 1 65535 1000 Group FC Multi Reference and Simple PLC Function FC 00 Reference 0 100 0 100 0 0 0 FC 01 Reference 1 100 0 100 0 0 0 FC 02 Reference 2 100 0 100 0 0 0 FC 03 Reference 3 100 0 1...

Страница 118: ...tion time of simple PLC reference 2 0 3 0 FC 24 Running time of simple PLC reference 3 0 0 6553 5s h 0 0s h FC 25 Acceleration deceleration time of simple PLC reference 3 0 3 0 FC 26 Running time of s...

Страница 119: ...0 3 0 FC 42 Running time of simple PLC reference 12 0 0 6553 5s h 0 0s h FC 43 Acceleration deceleration time of simple PLC reference 12 0 3 0 FC 44 Running time of simple PLC reference 13 0 0 6553 5...

Страница 120: ...200 bps 3 2400 bps 4 4800 bps 5 9600 bps 6 19200 bps 7 38400 bps 8 57600 bps 9 115200 bps 7HQ V GLJLW 352 86 3 0 115200 bps 1 208300 bps 2 256000 bps 3 512000 bps Hundred s digit reserved Thousand s d...

Страница 121: ...port communication timeout 0 0s invalid 0 1 60 0s 9DOLG IRU 0RGEXV 352 86 3 and CANopen 0 0s Fd 05 Modbus protocol selection DQG 352 86 3 GDWD frame 8QLW V GLJLW 0RGEXV SURWRFRO 30 0 Non standard Modb...

Страница 122: ...01 FE 11 8VHU GH QHG IXQFWLRQ FRGH F4 02 FE 12 8VHU GH QHG IXQFWLRQ FRGH F5 04 FE 13 8VHU GH QHG IXQFWLRQ FRGH F5 07 FE 14 8VHU GH QHG IXQFWLRQ FRGH F6 00 FE 15 8VHU GH QHG IXQFWLRQ FRGH F0 00 to FP...

Страница 123: ...s 02 Clear records 04 Back up current user parameters 501 Restore user backup parameters 0 FP 02 AC drive parameter display property 8QLW V GLJLW URXS 8 11 0 Not display 1 Display Ten s digit Group A...

Страница 124: ...eference DI5 5 Communication reference 6 MIN AI1 AI2 7 MAX AI1 AI2 The value 100 of 1 to 7 corresponds to the setting of A0 03 0 A0 03 Torque digital setting in torque control 200 0 to 200 0 150 0 A0...

Страница 125: ...ded by A1 06 00000 8QLW V GLJLW 9 Ten s digit VDI2 Hundred s digit VDI3 Thousand s digit VDI4 Ten thousand s digit VDI5 A1 06 VDI state selection 0 Invalid 1 Valid 00000 8QLW V GLJLW 9 Ten s digit VDI...

Страница 126: ...VLFDO 2 LQ JURXS 0 A1 14 9 2 IXQFWLRQ VHOHFWLRQ 0 Short with physical Dix internally 1 40 Refer to function selection RI SK VLFDO 2 LQ JURXS 0 A1 15 9 2 IXQFWLRQ VHOHFWLRQ 0 Short with physical Dix in...

Страница 127: ...cy 0 01 Hz to maximum frequency Model dependent A2 05 Rated motor speed 1 65535 RPM Model dependent A2 06 Stator resistance GULYH SRZHU N GULYH SRZHU N Model dependent A2 07 Rotor resistance GULYH SRZ...

Страница 128: ...RGHU DQJOH RIIVHW 0 0 359 9 0 0 A2 34 Number of pole pairs of resolver 1 65535 1 A2 36 Encoder wire break fault detection time 0 0s No detection 0 1 10 0s 0 0s A2 37 Auto tuning selection 0 No auto tu...

Страница 129: ...2 Excitation adjustment integral gain 0 20000 1300 A2 53 Torque adjustment proportional gain 0 20000 2000 A2 54 Torque adjustment integral gain 0 20000 1300 A2 55 Speed loop integral property 8QLW V G...

Страница 130: ...ion 0 A5 02 Dead zone compensation mode selection 0 No compensation 1 Compensation mode 1 1 A5 03 5DQGRP 3 0 GHSWK 5DQGRP 3 0 LQYDOLG 1 10 0 A5 04 Fast current limit 0 Disabled 1 Enabled 1 A5 05 Curre...

Страница 131: ...6 09 Corresponding setting of AI curve 5 minimum input 100 0 to 100 0 0 0 A6 10 FXUYH LQ H LRQ LQSXW A6 08 to A6 12 3 00 V A6 11 Corresponding setting of AI FXUYH LQ H LRQ LQSXW 100 0 to 100 0 30 0 A6...

Страница 132: ...housand s digit FMP FM used as pulse output Same as unit s digit 7HQ WKRXVDQG V GLJLW 2 Same as unit s digit A7 02 XQFWLRQ VHOHFWLRQ RI 2 on user programmable card YROWDJH LQSXW 2 YROWDJH output YROWD...

Страница 133: ...salve interaction 0 No 1 Yes 8QLW V GLJLW KHWKHU WKH VODYH follows the master command 7HQ V GLJLW KHWKHU VHQGLQJ IDXOW information XQGUHG V GLJLW KHWKHU DODUPLQJ LI WKH VODYH JHWV RI LQH 0 A8 03 Mess...

Страница 134: ...ayed voltage 2 9 999 10 000 V Factory corrected AC 08 AI3 measured voltage 1 9 999 10 000 V Factory corrected AC 09 AI3 displayed voltage 1 9 999 10 000 V Factory corrected AC 10 AI3 measured voltage...

Страница 135: ...0 000 mA Factory corrected AC 22 AI2 measured current 2 0 000 20 000 mA Factory corrected AC 23 AI2 sampling current 2 0 000 20 000 mA Factory corrected AC 24 2 LGHDO FXUUHQW 0 000 20 000 mA Factory c...

Страница 136: ...N 7005H 8 2XWSXW WRUTXH 0 1 7006H 8 DI state 1 7007H 8 2 VWDWH 1 7008H 8 AI1 voltage V 0 01 V 7009H 8 AI2 voltage V current mA 0 01 V 0 01 mA 700AH 8 AI3 voltage V 0 01 V 7007BH 8 Count value 1 700CH...

Страница 137: ...temperature 1 C 7022H 8 Target torque 0 1 7023H 8 Resolver position 1 7024H 8 Power factor angle 0 1 7025H 8 ABZ position 1 7026H 8 Target voltage upon V F separation 1 V 7027H 8 2XWSXW YROWDJH XSRQ 9...

Страница 138: ...Function Code Table MD380 User Manual 138 efesotomasyon com...

Страница 139: ...6 Description of Function Codes efesotomasyon com...

Страница 140: ...h as machine tool centrifuge wire drawing machine and injection PRXOGLQJ PDFKLQH 2QH GULYH FDQ RSHUDWH RQO RQH PRWRU 1 CLVC It indicates closed loop vector control and is applicable to high accuracy s...

Страница 141: ...2 5 027 LQGLFDWRU EOLQNLQJ Commands are given from host computer If this parameter is set to 2 a communication FDUG 0RGEXV 578 352 86 3 FDUG 1OLQN FDUG XVHU SURJUDPPDEOH FDUG RU CANopen card must be...

Страница 142: ...ference is set by analog input The MD380 control board provides two WHUPLQDOV QRWKHU WHUPLQDO LV SURYLGHG E WKH 2 H WHQVLRQ FDUG AI1 is 0 10 V voltage input AI2 is 0 10 V voltage input or 0 20 mA curr...

Страница 143: ...DSSO LQJ 3 DV WKH IUHTXHQF VRXUFH RX QHHG WR VHW SDUDPHWHUV RI 3 function in group FA 9 Communication reference The frequency reference is input by means of communication If the AC drive is a slave in...

Страница 144: ...and RQ WKH RSHUDWLRQ SDQHO RU XVLQJ WKH 83 2 1 IXQFWLRQ RI LQSXW terminals 2 If the auxiliary frequency source is analog input AI1 AI2 and AI3 or pulse reference 100 of the input corresponds to the ra...

Страница 145: ...equency setting channel The frequency reference is implemented based on main frequency source X and auxiliary frequency source Y superposition Figure 6 1 Frequency setting based on main frequency sour...

Страница 146: ...Range Default F0 10 Maximum frequency 50 00 500 00 Hz 50 00 Hz KHQ WKH IUHTXHQF VRXUFH LV SXOVH UHIHUHQFH RU PXOWL UHIHUHQFH RI WKH input corresponds to the value of this parameter Function Code Param...

Страница 147: ...reducing the leakage current to the earth and interference generated by the AC drive KHQ WKH FDUULHU IUHTXHQF EHFRPHV ORZHU KLJK KDUPRQLFV RI WKH RXWSXW FXUUHQW WKH SRZHU loss and temperature rise of...

Страница 148: ...ation time 1 V V V Model dependent Acceleration time indicates the time required by the AC drive to accelerate from 0 Hz to Acceleration Deceleration base frequency F0 25 that is t1 in Figure 6 2 Dece...

Страница 149: ...reference is obtained by adding the frequency offset set in this parameter to the X and Y superposition result Function Code Parameter Name Setting Range Default F0 22 Frequency reference resolution 2...

Страница 150: ...erred Function Code Parameter Name Setting Range Default F0 25 Acceleration Deceleration time base frequency 0 Maximum frequency F0 10 1 Frequency reference 2 100 Hz 0 The acceleration deceleration ti...

Страница 151: ...nd to frequency source Same as unit s digit It is used to bind the three running command sources with the nine frequency sources facilitating to implement synchronous switchover For details on the fre...

Страница 152: ...001 6 5535 GULYH SRZHU N Model dependent F1 07 Rotor resistance 0 001 65 535 GULYH SRZHU N 0 0001 6 5535 GULYH SRZHU N Model dependent F1 08 Leakage inductive reactance P GULYH SRZHU N P GULYH SRZHU N...

Страница 153: ...on of the PG card is complete set this parameter properly based on the actual FRQGLWLRQ 2WKHUZLVH WKH GULYH FDQQRW UXQ SURSHUO Function Code Parameter Name Setting Range Default F1 30 A B phase sequen...

Страница 154: ...ng is prohibited 1 Static auto tuning 1 It is applicable to scenarios where dynamic auto tuning cannot be performed because the asynchronous motor cannot be disconnected from the large inertia load 2...

Страница 155: ...ng frequency is between F2 02 and F2 05 the speed loop PI parameters are obtained from the linear switchover between the two groups of PI parameters as shown in Figure 6 3 Figure 6 3 Relationship betw...

Страница 156: ...AI1 AI2 and AI3 setting see the description of the AI curves in group F4 For details on the pulse setting see the description of F4 28 to F4 32 KHQ WKH GULYH LV LQ FRPPXQLFDWLRQ ZLWK WKH PDVWHU LI LV...

Страница 157: ...rifuge Any such V F curve can be obtained by setting parameters of F3 03 to F3 08 2 Square V F It is applicable to centrifugal loads such as fan and pump 3 to 8 V F curve between linear V F and square...

Страница 158: ...e based on motor parameters including the stator resistance F3 02 specifies the frequency under which torque boost is valid Torque boost becomes LQYDOLG ZKHQ WKLV IUHTXHQF LV H FHHGHG DV VKRZQ LQ WKH...

Страница 159: ...hange If this parameter is set to 100 it indicates that the compensation when the motor bears rated load is the rated motor slip The rated motor slip is automatically obtained by the AC drive through...

Страница 160: ...F3 14 1 AI1 2 AI2 3 AI3 4 Pulse reference DI5 5 Multi reference 6 Simple PLC 7 PID 8 Communication reference 100 0 corresponds to the rated motor voltage F1 02 A2 02 0 F3 14 Voltage digital setting fo...

Страница 161: ...eparation is set in the same way as the frequency source For details see F0 03 100 0 of the setting in each mode corresponds to the rated motor voltage If the corresponding value is negative its absol...

Страница 162: ...ion Allocate reserved terminals with function 0 to avoid malfunction 1 RUZDUG 581 The terminal is used to control forward or reverse running of the AC drive 2 5HYHUVH 581 5 9 3 Three wire control mode...

Страница 163: ...tal setting the terminal LV XVHG WR FOHDU WKH PRGL FDWLRQ E XVLQJ WKH 83 2 1 IXQFWLRQ RU WKH LQFUHPHQW GHFUHPHQW NH RQ WKH operation panel restoring the frequency reference to the value of F0 08 20 Co...

Страница 164: ...tegral disabled IWHU WKLV WHUPLQDO EHFRPHV 21 WKH LQWHJUDO DGMXVWPHQW function becomes disabled However the proportional and differentiation adjustment functions are still valid 39 Switchover between...

Страница 165: ...EHFRPHV 21 WKH GULYH decelerates to DC injection braking 2 frequency threshold and then switches over to DC injection braking state 50 Clear the current running time KHQ WKLV WHUPLQDO EHFRPHV 21 WKH...

Страница 166: ...frequency source is multi reference the value 100 of FC 00 to FC 15 corresponds to the value of F0 10 Maximum frequency Besides the multi speed function the multi reference can be also used as the PID...

Страница 167: ...is parameter is used to set the control mode in which the AC drive is controlled by external terminals The following uses DI1 DI2 and DI3 among DI1 to DI10 as an example with allocating functions of D...

Страница 168: ...d or reverse direction V VKRZQ LQ WKH SUHFHGLQJ JXUH LI LV 21 WKH GULYH LQVWUXFWV IRUZDUG URWDWLRQ ZKHQ LV 2 DQG LQVWUXFWV UHYHUVH URWDWLRQ ZKHQ LV 21 I LV 2 WKH drive stops 2 Three wire control mode...

Страница 169: ...F4 01 DI2 function selection 2 Forward or reverse direction F4 02 DI3 function selection 3 Three wire control Figure 6 10 Setting of three wire control mode 2 MD380 DI1 20 Digital common DI2 581 FRPP...

Страница 170: ...F4 34 Setting for AI less than minimum input is used KHQ WKH DQDORJ LQSXW LV FXUUHQW LQSXW P FXUUHQW FRUUHVSRQGV WR 9 YROWDJH OWHU WLPH LV XVHG WR VHW WKH VRIWZDUH OWHU WLPH RI I WKH DQDORJ LQSXW LV...

Страница 171: ...similar to that of setting AI1 function Function Code Parameter Name Setting Range Default F4 28 Pulse minimum input 0 00 kHz to F4 30 0 00 kHz F4 29 Corresponding setting of pulse minimum input 100 0...

Страница 172: ...than minimum input Same as AI1 This parameter is used to determine the corresponding setting when the analog input voltage is less than the minimum value The unit s digit ten s digit and hundred s di...

Страница 173: ...dred s digit DI8 state Same as DI1 Thousand s digit DI9 valid mode Same as DI1 Ten thousand s digit DI10 valid mode 0 1 same as DI1 These parameters are used to set the valid mode of DI terminals 0 Hi...

Страница 174: ...5 WHQVLRQ FDUG 2 IXQFWLRQ VHOHFWLRQ 4 7KHVH YH SDUDPHWHUV DUH XVHG WR VHOHFW WKH IXQFWLRQV RI WKH YH GLJLWDO RXWSXW WHUPLQDOV T A T B T C and P A P B P C are respectively the relays on the control boa...

Страница 175: ...main circuit and control circuit become stable and the AC drive detects no fault and is ready for 581 WKH WHUPLQDO EHFRPHV 21 16 AI1 larger than AI2 KHQ WKH LQSXW RI LV ODUJHU WKDQ WKH LQSXW RI WKH WH...

Страница 176: ...d F8 37 37 Frequency lower limit reached having output at stop If the running frequency reaches the lower limit the terminal EHFRPHV 21 Q WKH VWRS VWDWH WKH VLJQDO LV VWLOO 21 38 Alarm output If a fau...

Страница 177: ...munication reference 0 0 100 0 13 Motor speed 0 to rotational speed corresponding to maximum output frequency 14 2XWSXW FXUUHQW 0 0 1000 0 A 15 2XWSXW YROWDJH 0 0 000 0 V 16 2XWSXW WRUTXH DFWXDO YDOXH...

Страница 178: ...t delay 0 0 3600 0s 0 0s F5 19 Relay 2 output delay 0 0 3600 0s 0 0s F5 20 2 RXWSXW GHOD 0 0 3600 0s 0 0s F5 21 2 RXWSXW GHOD 0 0 3600 0s 0 0s These parameters are used to set the delay time of output...

Страница 179: ...antaneous power down of large inertia load To ensure the performance of rotational speed tracking restart set the motor parameters in group F1 correctly 2 Pre excited startup AC asynchronous motor W L...

Страница 180: ...reverse rotation the startup frequency holding time is disabled The holding time is not included in the acceleration time but in the running time of simple PLC Example 1 The frequency source is digita...

Страница 181: ...s greater than 80 of the rated AC drive current the base value is 80 of the rated AC drive current Function Code Parameter Name Setting Range Default F6 07 Acceleration Deceleration mode 0 Linear acce...

Страница 182: ...changed that is linear acceleration deceleration Figure 6 12 S curve acceleration deceleration A 2XWSXW frequency Hz Frequency reference f Time t t1 t2 t2 t1 Function Code Parameter Name Setting Range...

Страница 183: ...urrent If the rated motor current is greater than 80 of the rated AC drive current the base value is 80 of the rated AC drive current F6 14 DC injection braking 2 active time 7KLV SDUDPHWHU VSHFL HV W...

Страница 184: ...er between operation panel control and remote control terminal or communication You can perform switchover from the current command source to the operation panel control local operation If the current...

Страница 185: ...ference Hz Bus voltage V 2XWSXW YROWDJH V 2XWSXW FXUUHQW A 2XWSXW SRZHU N 2XWSXW WRUTXH DI state V 15 14 12 11 10 9 8 2 VWDWH AI1 voltage V Count value Length value Load speed display PID reference 13...

Страница 186: ...Current power on time Hour Current running time Minute Pulse reference Hz Communication reference Encoder feedback speed Hz Main frequency X display Hz Auxiliary frequency Y display Hz 13 If a paramet...

Страница 187: ...ust the relationship between the output frequency of the AC drive and the load speed For details see the description of F7 12 Function Code Parameter Name Setting Range Default F7 07 Heatsink temperat...

Страница 188: ...PDO SODFHV If the AC drive is in the stop state the load speed is the speed corresponding to the set frequency namely set load speed If the set frequency is 50 00 Hz the load speed in WKH VWRS VWDWH L...

Страница 189: ...three groups and the group defined by F0 17 and F0 18 Definitions of four groups are completely the same You can switch over between the four groups of acceleration deceleration time through different...

Страница 190: ...lower than frequency lower limit 0 Run at frequency lower limit 1 Stop 2 Run at zero speed 0 It is used to set the AC drive running mode when the frequency reference is lower than the frequency lower...

Страница 191: ...safety protection If it is set to 1 the AC drive does not respond to the run command valid upon AC drive power on for example an LQSXW WHUPLQDO LV 21 EHIRUH SRZHU RQ 7KH GULYH UHVSRQGV RQO DIWHU WKH...

Страница 192: ...0 0 If the AC drive running frequency is within the certain range of the set frequency the FRUUHVSRQGLQJ 2 WHUPLQDO EHFRPHV 21 This parameter is used to set the range within which the output frequency...

Страница 193: ...ency jump amplitude 2XWSXW frequency Hz Frequency jump 2 Frequency jump 1 Time t Frequency jump band Frequency jump band Frequency jump band Frequency jump band Function Code Parameter Name Setting Ra...

Страница 194: ...0 It is used to set whether terminal jog is preferred If terminal jog is preferred the AC drive switches to terminal jog running state when there is a terminal jog command during the running process...

Страница 195: ...Time Any frequency reached Frequency reached detection amplitude Frequency reached detection amplitude Function Code Parameter Name Setting Range Default F8 34 Zero current detection level 0 0 300 0 r...

Страница 196: ...W overcurrent threshold 2XWSXW RYHUFXUUHQW detection signal F8 37 2XWSXW RYHUFXUUHQW detection delay time Function Code Parameter Name Setting Range Default F8 38 Any current reaching 1 0 0 300 0 rate...

Страница 197: ...WKH FRUUHVSRQGLQJ 2 EHFRPHV 21 The AC drive starts timing from 0 each time it starts up and the remaining timing duration FDQ EH TXHULHG E 8 The timing duration is set in F8 43 and F8 44 in unit of mi...

Страница 198: ...ating delay time F8 52 if the frequency reference is lower than or equal to the hibernating frequency F8 51 KHQ WKH GULYH LV LQ KLEHUQDWLQJ VWDWH DQG WKH FXUUHQW UXQQLQJ FRPPDQG LV HIIHFWLYH WKH AC dr...

Страница 199: ...ent and time curve Figure 6 25 Motor overload current and time curve 2YHUORDG WLPH minutes Current percentage of rated motor current 115 125 135 145 155 165 175 80 40 15 5 2 For example the motor over...

Страница 200: ...ROWDJH VXSSUHVVLRQ FDSDFLW RI WKH AC drive The larger the value is the greater the overvoltage suppression capacity will be In the prerequisite of no overvoltage occurrence set F9 03 to a small value...

Страница 201: ...Hz Frequency reference 2YHUFXUUHQW VWDOO protective current Time t Time t Acceleration process Deceleration process Constant speed process Function Code Parameter Name Setting Range Default F9 07 Shor...

Страница 202: ...ion Voltage Class Models Single phase 220 V None Three phase 220 V N PRGHO Three phase 380 V N PRGHO Three phase 690 V N PRGHO For every voltage class the MD380 AC drives of powers equal to or greater...

Страница 203: ...XSRQ 3rd fault It displays the status of all output terminals when the latest fault occurs The sequence is as follows I DQ RXWSXW WHUPLQDO LV 21 WKH VHWWLQJ LV I WKH RXWSXW WHUPLQDO LV 2 WKH VHWWLQJ...

Страница 204: ...mode 2 Continue to run Ten s digit Power input phase loss Err12 Same as unit s digit Hundred s digit Power output phase loss Err13 Same as unit s digit Thousand s digit External equipment fault Err15...

Страница 205: ...feedback lost during running Err31 Same as unit s digit in F9 47 F9 50 Fault protection action selection 4 8QLW V GLJLW 7RR ODUJH VSHHG IHHGEDFN HUURU UU 00000 Same as unit s digit in F9 47 Ten s dig...

Страница 206: ...HUDWXUH VHQVRU QHHGV WR EH FRQQHFWHG WR WKH RSWLRQDO 2 extension card AI3 on the extension card can be used for the temperature signal input The motor temperature sensor is connected to AI3 and PGND o...

Страница 207: ...he value set in F9 61 it is considered that the bus voltage resumes to normal I XSRQ LQVWDQWDQHRXV SRZHU IDLOXUH RU VXGGHQ YROWDJH GLS WKH GULYH decelerates to stop Figure 6 27 AC drive action diagram...

Страница 208: ...n the CLVC mode If the actual motor rotational speed detected by the AC drive exceeds the maximum frequency and the excessive value is greater than the value of F9 67 and the lasting time exceeds the...

Страница 209: ...edback PID output Function Code Parameter Name Setting Range Default FA 00 PID reference source 0 FA 01 1 AI1 2 AI2 3 AI3 4 Pulse reference DI5 5 Communication reference 6 Multi reference 0 FA 01 PID...

Страница 210: ...Default FA 05 Proportional gain Kp1 0 0 100 0 20 0 FA 06 Integral time Ti1 0 01 10 00s 2 00s FA 07 Differential time Td1 0 00 10 000 0 000s FA 05 Proportional gain Kp1 It decides the regulating inten...

Страница 211: ...Setting Range Default FA 10 PID differential limit 0 00 100 00 0 10 It is used to set the PID differential output range In PID control the differential operation may easily cause system oscillation T...

Страница 212: ...ters Regulator parameters FA 15 to FA 17 are set in the same way as FA 05 to FA 07 The switchover can be implemented either via a DI terminal or automatically implemented based on the deviation If you...

Страница 213: ...al value FA 22 PID initial value active time Time Function Code Parameter Name Setting Range Default FA 23 Maximum deviation between two PID outputs in forward direction 0 00 100 00 1 00 FA 24 Maximum...

Страница 214: ...DO RSHUDWLRQ ZKHQ WKH RXWSXW UHDFKHV WKH OLPLW If Stop integral operation is selected the PID integral operation stops which may help to reduce the PID overshoot Function Code Parameter Name Setting R...

Страница 215: ...XW frequency Hz REEOH IUHTXHQF lower limit 581 command REEOH cycle Triangular rising time Decelerate by deceleration time REEOH DPSOLWXGH Aw Fset x Fb 01 Aw Aw Textile wobble step Aw x Fb 02 Accelerat...

Страница 216: ...VSHFL HV WKH WLPH SHUFHQWDJH RI WULDQJXODU ZDYH ULVLQJ WLPH WR E REEOH F FOH 7ULDQJXODU ZDYH ULVLQJ WLPH E REEOH F FOH 7ULDQJXODU ZDYH ULVLQJ WLPH FRHI FLHQW XQLW V 7ULDQJXODU ZDYH IDOOLQJ WLPH E REEO...

Страница 217: ...ORFDWHG ZLWK IXQFWLRQ 6HW FRXQW YDOXH UHDFKHG EHFRPHV 21 7KHQ WKH FRXQWHU VWRSV FRXQWLQJ KHQ WKH FRXQWLQJ YDOXH UHDFKHV WKH GHVLJQDWHG FRXQWLQJ YDOXH E WKH 2 WHUPLQDO DOORFDWHG ZLWK IXQFWLRQ HVLJQDWHG...

Страница 218: ...04 Reference 4 100 0 to 100 0 0 0 FC 05 Reference 5 100 0 to 100 0 0 0 FC 06 Reference 6 100 0 to 100 0 0 0 FC 07 Reference 7 100 0 to 100 0 0 0 FC 08 Reference 8 100 0 to 100 0 0 0 FC 09 Reference 9...

Страница 219: ...QLQJ RQH F FOH 2 Repeat after running one cycle The AC drive automatically starts another cycle after running one cycle and will not stop until receiving the stop command Simple PLC can be either the...

Страница 220: ...ence 0 0 0 6553 5s h 0 0s h FC 19 Acceleration deceleration time of simple PLC reference 0 0 3 0 FC 20 Running time of simple PLC reference 1 0 0 6553 5s h 0 0s h FC 21 Acceleration deceleration time...

Страница 221: ...of simple PLC reference 13 0 0 6553 5s h 0 0s h FC 45 Acceleration deceleration time of simple PLC reference 13 0 3 0 FC 46 Running time of simple PLC reference 14 0 0 6553 5s h 0 0s h FC 47 Accelerat...

Страница 222: ...F6 10 FE 16 8VHU GH QHG IXQFWLRQ FRGH Same as FE 00 F0 00 FE 17 8VHU GH QHG IXQFWLRQ FRGH Same as FE 00 F0 00 FE 18 8VHU GH QHG IXQFWLRQ FRGH Same as FE 00 F0 00 FE 19 8VHU GH QHG IXQFWLRQ FRGH Same a...

Страница 223: ...P 01 is set to 1 most function codes are restored to the factory parameters except motor parameters frequency reference resolution F0 22 fault records accumulative running time F7 09 accumulative powe...

Страница 224: ...lowing table Table 6 10 Display codes of different parameter types Parameter Type Display Code AC drive parameter 8VHU GH QHG SDUDPHWHU 8VHU PRGL HG SDUDPHWHU The MD380 provides display of two types o...

Страница 225: ...XQFWLRQ LV 21 WKH FRQWURO PRGH LV UHYHUVH WR WKH YDOXH RI RZHYHU LI WKH WHUPLQDO ZLWK IXQFWLRQ 7RUTXH FRQWURO SURKLELWHG LV 21 WKH GULYH LV HG WR UXQ LQ WKH VSHHG FRQWURO PRGH Function Code Parameter...

Страница 226: ...is 9 30 V voltage range and 0 100 kHz frequency range The pulse can only be input via DI5 The relationship which is a two point line between DI5 input pulse frequency and the corresponding value is s...

Страница 227: ...ange Default A0 07 Acceleration time in torque control 0 00 65000s 0 00s A0 08 Deceleration time in torque control 0 00 65000s 0 00s In torque control the difference between the motor output torque an...

Страница 228: ...Thousand s digit VDI4 Ten thousand s digit VDI5 A1 06 VDI state selection 0 Invalid 1 Valid 00000 8QLW V GLJLW 9 Ten s digit VDI2 Hundred s digit VDI3 Thousand s digit VDI4 Ten thousand s digit VDI5...

Страница 229: ...ion selection for AI1 used as DI 0 59 0 A1 08 Function selection for AI2 used as DI 0 59 0 A1 09 Function selection for AI3 used as DI 0 59 0 A1 10 State selection for AI used as DI 0 High level activ...

Страница 230: ...JURXS 0 A1 16 9 2 RXWSXW GHOD 0 0 3600 0s 0 0s A1 17 9 2 RXWSXW GHOD 0 0 3600 0s 0 0s A1 18 9 2 RXWSXW GHOD 0 0 3600 0s 0 0s A1 19 9 2 RXWSXW GHOD 0 0 3600 0s 0 0s A1 20 9 2 RXWSXW GHOD 0 0 3600 0s 0...

Страница 231: ...mon asynchronous motor 1 Variable frequency asynchronous motor 0 A2 01 Rated motor power N Model dependent A2 02 Rated motor voltage 1 2000 V Model dependent A2 03 Rated motor current GULYH SRZHU N GU...

Страница 232: ...9 HQFRGHU DQJOH offset 0 0 359 9 0 0 A2 34 Number of pole pairs of resolver 1 65535 1 A2 36 Encoder wire break fault detection time 0 0s No action 0 1 10 0s 0 0s A2 37 Auto tuning selection 0 No auto...

Страница 233: ...ral gain 0 20000 1300 A2 53 Torque adjustment proportional gain 0 20000 2000 A2 54 Torque adjustment integral gain 0 20000 1300 A2 55 Speed loop integral property 8QLW V GLJLW QWHJUDO VHSDUDWHG 0 Disa...

Страница 234: ...rameter is valid only for V F control Synchronous modulation indicates that the carrier frequency varies linearly with the change of the output frequency ensuring that the ratio of carrier frequency t...

Страница 235: ...f control performance Do not modify it generally Function Code Parameter Name Setting Range Default A5 06 8QGHUYROWDJH WKUHVKROG 60 0 140 0 100 0 It is used to set the undervoltage threshold of Err09...

Страница 236: ...to set the overvoltage threshold of the AC drive The default values of different voltage classes are listed in the following table 7DEOH 2YHUYROWDJH WKUHVKROGV IRU GLIIHUHQW YROWDJH FODVVHV Voltage Cl...

Страница 237: ...LQSXW A6 08 to A6 12 3 00 V A6 11 Corresponding setting of AI FXUYH LQ H LRQ LQSXW 100 0 to 100 0 30 0 A6 12 FXUYH LQ H LRQ LQSXW A6 10 to A6 14 6 00 V A6 13 Corresponding setting of AI FXUYH LQ H LRQ...

Страница 238: ...5 A6 20 Jump point of AI3 input corresponding setting 100 0 100 0 0 0 A6 21 Jump amplitude of AI3 input corresponding setting 0 0 100 0 0 5 The AI terminals AI1 to AI3 of the MD380 all support the cor...

Страница 239: ...0 Master 1 Slave 0 This parameter is used to determine whether the AC drive is master or slave At point point communication you only need to set the CANlink communication baud rate The communication...

Страница 240: ...n detection time 0 0 10 0s 1 0s It is used to set the point point communication interruption time at which this fault is detected If it is set to 0 it indicates no detection Function Code Parameter Na...

Страница 241: ...arameters will be restored to the factory corrected values Generally you need not perform correction in the applications Measured voltage indicates the actual output voltage value measured by instrume...

Страница 242: ...ng current 1 0 000 20 000 mA Factory corrected AC 22 AI2 measured current 2 0 000 20 000 mA Factory corrected AC 23 AI2 sampling current 2 0 000 20 000 mA Factory corrected AC 24 2 LGHDO FXUUHQW 0 000...

Страница 243: ...ge 0 0 3000 0 V It displays the AC drive s bus voltage Function Code Parameter Name Display Range 8 2XWSXW YROWDJH 0 1140 V It displays the AC drive s output voltage in the running state Function Code...

Страница 244: ...0 Bit1 Bit2 Bit3 Bit4 Bit5 2 Relay 1 Relay 2 2 2 9 2 Bit6 Bit7 Bit8 Bit9 Bit10 Bit11 9 2 9 2 9 2 9 2 Function Code Parameter Name Display Range 8 AI2 voltage V current mA 0 00 10 57 V 0 00 20 00 mA KH...

Страница 245: ...8 AI3 voltage before correction 10 57 10 57 V They display the AI sampleding voltage current value of AI The actually used voltage current is obtained after linear correction to reduce the deviation b...

Страница 246: ...isplays the setting of auxiliary frequency Y Function Code Parameter Name Display Range 8 Motor temperature 0 200 C It displays the motor temperature obtained by means of AI3 sampling For the motor te...

Страница 247: ...SOD IRUPDW LV VKRZQ LQ WKH IROORZLQJ JXUH Figure 6 36 Display format of the DI state DI9 VDI1 DI10 VDI2 AI2 AI3 VDI3 VDI5 VDI4 AI1 DI5 DI7 DI6 DI8 DI1 DI3 DI2 DI4 DI state display 21 LQGLFDWHV KLJK OH...

Страница 248: ...ng frequency 100 00 to 100 00 It displays the current set frequency and running frequency 100 00 corresponds to the AC drive s maximum frequency F0 10 Function Code Parameter Name Display Range 8 AC d...

Страница 249: ...7 EMC efesotomasyon com...

Страница 250: ...network which supplies buildings used for domestic purposes 3 Second environment Environment that includes all establishments other than those directly connected to a low voltage power supply network...

Страница 251: ...th standard EN 61800 3 2004 Category C2 C3 or C4 The system machinery or appliance installed with the AC drive must also have the CE mark The system integrator is responsible for compliance of the sys...

Страница 252: ...XW VLGH RI WKH AC drive 7KH IROORZLQJ WDEOH OLVWV WKH UHFRPPHQGHG PDQXIDFWXUHUV DQG PRGHOV RI 0 OWHUV IRU WKH MD380 series AC drive Select a proper one based on actual requirements 7DEOH 5HFRPPHQGHG P...

Страница 253: ...265 No recommendation MD380 7T280 396 305 No recommendation MD380 7T315 445 350 No recommendation MD380 7T355 500 382 No recommendation MD380 7T400 565 435 DL 600EBK35 60 MD380 7T450 630 490 DL 600EBK...

Страница 254: ...MD380T250 468 MD ACL 490 4T 224 2 MD380T280 525 MD ACL 660 4T 304 2 MD380T315 590 MD ACL 660 4T 304 2 MD380T355 665 MD ACL 800 4T 384 2 MD380T400 785 MD ACL 800 4T 384 2 MD380T450 883 MD ACL 1000 4T 4...

Страница 255: ...reactor is installed AC Drive Power N Rated Voltage V Cable Length Threshold m 4 200 500 50 5 5 200 500 70 7 5 200 500 100 11 200 500 110 15 200 500 125 18 5 200 500 135 22 200 500 150 280 690 150 Th...

Страница 256: ...7T132G 150 0 2 7 MD380 7T160G 175 0 2 7 MD380 7T200G 215 0 2 7 MD380 7T220G 245 0 2 7 MD380 7T250G 260 0 2 7 MD380 7T280G 299 0 2 7 MD380 7T315G 330 0 2 7 MD380 7T355G 374 0 2 7 MD380 7T400G 410 0 2 7...

Страница 257: ...able The shield must be grounded The installation precautions are as follows Symmetrical shielded cable is recommended The four conductor shielded cable can also be used as an input cable The motor ca...

Страница 258: ...90e 2WKHU FDEOHV PXVW QRW UXQ DFURVV WKH GULYH 4 The power input and output cables of the AC drive and weak current signal cables such as control cable should be laid vertically if possible rather th...

Страница 259: ...rence may cause the circuit breaker to malfunction and thus the residual current FLUFXLW EUHDNHU PXVW KDYH WKH KLJK IUHTXHQF OWHULQJ IXQFWLRQ If multiple AC drives are required each AC drive must be i...

Страница 260: ...the mains voltage Add a safety capacitor to the power input cable and wind the cable with magnetic rings Add a safety capacitor to the interfered signal port or wind the signal cable with magnetic ri...

Страница 261: ...8 Selection and Dimensions efesotomasyon com...

Страница 262: ...30 MD380 2T1 5GB 4 5 8 5 1 1 5 2 0 055 MD380 2T2 2GB 5 9 10 5 9 2 2 3 0 072 MD380 2T3 7GB 8 9 14 6 13 3 7 5 0 132 MD380 2T5 5GB 17 26 25 5 5 7 5 0 214 MD380 2T7 5GB 21 35 32 7 5 10 0 288 MD380 2T11G 3...

Страница 263: ...G MD380T30P 40 62 60 30 40 1 01 MD380T37G MD380T37P 57 76 75 37 50 1 20 MD380T45G MD380T45P 69 92 91 45 60 1 51 MD380T55G MD380T55P 85 113 112 55 75 1 80 MD380T75G MD380T75P 114 157 150 75 100 1 84 MD...

Страница 264: ...8 5 1 2 2 3 0 066 MD380 5T3 7GB 5 9 10 5 9 3 7 5 0 120 MD380 5T5 5GB MD380 5T5 5PB 8 9 14 6 13 5 5 7 5 0 195 MD380 5T7 5GB MD380 5T7 5PB 11 20 5 17 7 5 10 0 262 MD380 5T11GB MD380 5T11PB 17 26 25 11 1...

Страница 265: ...0 5T280G MD380 5T280P 396 525 520 280 370 6 21 MD380 5T315G MD380 5T315G 445 590 585 315 420 7 03 MD380 5T355G MD380 5T355G 500 665 650 355 470 7 81 MD380 5T400G MD380 5T400P 565 785 725 400 530 8 51...

Страница 266: ...315G MD380 7T315P 445 350 330 315 420 6 42 MD380 7T355G MD380 7T355P 500 382 374 355 470 7 38 MD380 7T400G MD380 7T400P 565 435 410 400 530 7 83 MD380 7T450G MD380 7T450P 630 490 465 450 600 8 93 MD38...

Страница 267: ...YHUDOO LPHQVLRQV mm Mounting Hole Diameter mm HLJKW kg A B H H1 D Single phase 220 V MD380S0 4GB 113 172 186 125 164 1 1 MD380S0 7GB MD380S1 5GB MD380S2 2GB Three phase 220 V MD380 2T0 4GB 113 172 186...

Страница 268: ...03 880 930 579 380 90 MD380 2T75G Three phase 380 V MD380T0 7GB 113 172 186 125 164 1 1 MD380T1 5GB MD380T2 2GB MD380T3 7GB MD380T5 5PB 148 236 248 160 183 2 5 MD380T5 5GB MD380T7 5PB MD380T7 5GB MD38...

Страница 269: ...380 90 MD380T132G MD380T160P MD380T160G MD380T110GH MD380T132PH 320 1166 1090 1192 440 310 90 MD380T132GH MD380T160PH MD380T160GH MD380T200PH MD380T200P 420 1030 983 1060 650 377 130 MD380T200G MD380T...

Страница 270: ...8 192 6 5 MD380 5T11GB MD380 5T15PB MD380 5T15GB MD380 5T18 5PB MD380 5T18 5G MD380 5T22P 235 447 432 463 285 228 20 MD380 5T22G MD380 5T30P MD380 5T30G MD380 5T37P MD380 5T37G MD380 5T45P 260 580 549...

Страница 271: ...80 5T315P MD380 5T315G MD380 5T315P 520 1300 1203 1358 800 400 200 MD380 5T355G MD380 5T400P MD380 5T400G MD380 5T450P Three phase 690 V MD380 7T55G MD380 7T75P 250 570 557 600 400 330 47 MD380 7T75G...

Страница 272: ...560P 8 3 Recommended Cable Diameter and Installation Dimensions of Power Terminals Note The recommended data and models are for reference only The cable diameter you select FDQQRW EH ODUJHU WKDQ WKH V...

Страница 273: ...25 4 MD380T0 7GB 3 40 0 75 TNR0 75 4 MD380T1 5GB 5 00 0 75 TNR0 75 4 MD380T2 2GB 5 80 0 75 TNR0 75 4 MD380 5T0 7GB 3 40 0 75 TNR0 75 4 MD380 5T1 5GB 5 00 0 75 TNR0 75 4 MD380 5T2 2GB 5 80 0 75 TNR0 7...

Страница 274: ...model size D AC Drive Model Rated Input Current A Recommended 2XWSXW 3RZHU Cable Diameter mm2 Torque of Torque Driver N m Recommended Cable Lug Model MD380 2T7 5GB 35 00 6 2 5 GTNR4 5 MD380 2T11G 46 5...

Страница 275: ...E AC Drive Model Rated Input Current A Recommended 2XWSXW 3RZHU Cable Diameter mm2 Torque of Torque Driver N m Recommended Cable Lug Model MD380 2T18 5G 76 00 25 4 GTNR25 6 MD380 2T22G 92 00 35 GTNR35...

Страница 276: ...C Drive Model Rated Input Current A Recommended 2XWSXW 3RZHU Cable Diameter mm2 Torque of Torque Driver N m Recommended Cable Lug Model MD380 2T37G 157 00 70 10 5 GTNR70 8 MD380 2T45G 180 00 95 GTNR95...

Страница 277: ...8 Recommended cable diameter and cable lug model size G AC Drive Model Rated Input Current A Recommended 2XWSXW 3RZHU Cable Diameter mm2 Torque of Torque Driver N m Recommended Cable Lug Model MD380...

Страница 278: ...cable diameter and cable lug model size H AC Drive Model Rated Input Current A Recommended 2XWSXW 3RZHU Cable Diameter mm2 Torque of Torque Driver N m Recommended Cable Lug Model MD380T110 214 00 120...

Страница 279: ...2XWSXW 3RZHU Cable Diameter mm2 Torque of Torque Driver N m Recommended Cable Lug Model MD380T200 385 00 185 85 GTNR185 16 MD380T220 430 00 240 GTNR240 16 MD380T250 468 00 120 x 2 GTNR120 16 MD380T280...

Страница 280: ...l size J AC Drive Model Rated Input Current A Recommended 2XWSXW 3RZHU Cable Diameter mm2 Torque of Torque Driver N m Recommended Cable Lug Model MD380T355 665 00 185 x 2 85 GTNR185 16 MD380T400 785 0...

Страница 281: ...es 7KH IROORZLQJ JXUH VKRZV WKH GLPHQVLRQV RI UHFRPPHQGHG FDEOH OXJV Figure 8 13 Dimensions of recommended TNR series cable lugs L B d2 d1 D E F Table 8 12 Models and dimensions of the TNR series cabl...

Страница 282: ...T 38 CT 100 GTNR16 8 8 4 GTNR25 6 9 5 7 5 12 0 8 0 4 5 14 0 6 4 2 0 32 0 10 GTNR25 8 9 0 15 5 8 4 1 6 34 0 GTNR25 10 10 5 17 5 10 5 1 4 37 0 GTNR35 6 11 4 8 6 15 0 9 0 5 0 15 5 6 4 2 8 38 0 GTNR35 8 8...

Страница 283: ...GB 10 9 0 75 0 75 0 5 MD380 2T2 2GB 16 12 1 5 1 5 0 5 MD380 2T3 7GB 20 18 2 5 2 5 0 75 MD380 2T5 5GB 40 32 4 0 4 0 0 75 MD380 2T7 5GB 50 38 6 0 6 0 0 75 MD380 2T11G 63 50 10 10 0 75 MD380 2T15G 100 65...

Страница 284: ...50 1 0 MD380T75G MD380T75P 225 170 70 70 1 0 MD380T90G MD380T90P 250 205 95 95 1 0 MD380T110G MD380T110P 315 245 120 120 1 0 MD380T132G MD380T132P 350 300 120 120 1 0 MD380T160G MD380T160P 400 300 150...

Страница 285: ...MD380 5T11GB MD380 5T11PB 40 32 4 0 4 0 0 75 MD380 5T15GB MD380 5T15PB 50 38 6 0 6 0 0 75 MD380 5T18 5G MD380 5T18 5PB 50 40 10 10 1 0 MD380 5T22G MD380 5T22P 63 50 10 10 1 0 MD380 5T30G MD380 5T30P 1...

Страница 286: ...0 5T400G MD380 5T400P 1250 800 240 x 2 240 x 2 1 0 MD380 5T450P 1250 1000 240 x 2 240 x 2 1 0 Three phase 690 V MD380 7T55G 100 80 16 16 1 0 MD380 7T75G MD380 7T75P 125 115 25 25 1 0 MD380 7T90G MD380...

Страница 287: ...Mode of External DC Reactor 7KH 0 VHULHV GULYHV RI RYHU N SRZHU 7 LV N DUH FRQ JXUHG ZLWK DQ external DC reactor as standard The DC reactor is packed in separate wooden box for delivery KHQ LQVWDOOLQ...

Страница 288: ...0G 250P 190 230 93 128 250 325 200 13 x 18 DCL 0600 MD380 5T 200P 200G 220P 220G 250P MD380T250G 280P 280G 315P 190 230 93 128 250 325 200 13 x 18 DCL 0700 MD380 5T250G 280P 280G 315P MD380T315G 355P...

Страница 289: ...HP VWDEOH EUDNLQJ Different systems select different braking voltages The 380 VAC system usually selects 700 V braking voltage Pb refers to the braking power 8 7 2 Selection of Power of Braking Resist...

Страница 290: ...her power and lower resistance value should be selected Table 8 16 Recommended values of braking resistor Model Recommended Power Recommended Resistance UDNLQJ 8QLW Remark Single phase 220 V MD380S0 4...

Страница 291: ...45G N External 0 81 7 MD380T55G N External 0 81 7 MD380T75G N External 0 81 7 MD380T90G N x 2 External 0 81 7 MD380T110G N x 2 External 0 81 7 MD380T132G N x 2 External 0 81 7 MD380T160G N x 2 Externa...

Страница 292: ...nal 0 81 7 MD380 5T90G N External 0 81 7 MD380 5T110G N x 2 External 0 81 7 MD380 5T132G N x 2 External 0 81 7 MD380 5T160G N x 2 External 0 81 7 MD380 5T200G N External 0 8 MD380 5T220G N External 0...

Страница 293: ...9 Maintenance and Troubleshooting efesotomasyon com...

Страница 294: ...ine cleaning involves Keep the AC drive clean all the time Remove the dust especially metal powder on the surface of the AC drive to prevent the dust from entering the AC drive Clear the oil stain on...

Страница 295: ...or storage of the AC drive pay attention to the following two aspects 1 Pack the AC drive with the original packing box provided by Inovance 2 Long term storage degrades the electrolytic capacitor Thu...

Страница 296: ...r and the AC drive is too long 3 The module overheats 4 The internal connections become loose 5 The main control board is faulty 6 The drive board is faulty 7 The inverter module is faulty 1 Eliminate...

Страница 297: ...OWDJH during acceleration Err05 1 The input voltage is too high 2 An external force drives the motor during acceleration 3 The acceleration time is too short 4 The braking unit and braking resistor ar...

Страница 298: ...arge drive Power input phase loss Err12 1 The three phase power input is abnormal 2 The drive board is faulty 3 The lightening board is faulty 4 The main control board is faulty 1 Eliminate external f...

Страница 299: ...tuning times out 1 Set the motor parameters according to the nameplate properly 2 Check the cable connecting the AC drive and the motor Encoder fault Err20 1 The encoder type is incorrect 2 The cable...

Страница 300: ...the selection of the motor via terminal during running of the AC drive Perform motor switchover after the AC drive stops Speed feedback error too large Err42 1 The encoder parameters are set incorrec...

Страница 301: ...e control board are damaged 3 The motor or the motor cable is short circuited to the ground 4 The HALL device is faulty 5 The power input to the AC drive is too low 1 Re connect the 8 core and 28 core...

Страница 302: ...The motor speed is always low in CLVC mode 1 The encoder is faulty 2 The encoder cable is connected incorrectly or in poor contact 3 The PG card is faulty 4 The drive board is faulty 1 Replace the enc...

Страница 303: ...nt d Improper operation e Trouble out of the equipment for example external device 3 If there is any failure or damage to the product please correctly fill out the Product DUUDQW DUG LQ GHWDLO 4 The m...

Страница 304: ...tion Address Company name Postcode Contact person Tel or Email Product information Product model Serial No Attach here Name of supplier who supplied you the unit Failure Description eg Fault code Main...

Результаты поиска

Содержание MD380 Series

Отзывы:

Похожие инструкции для MD380 Series

Бренды по названию

Популярные бренды

Inovance MD380 Series, Руководство пользователя

Результаты поиска

Содержание MD380 Series

Отзывы:

Похожие инструкции для MD380 Series

Бренды по названию

Популярные бренды