background image

164

E

XTERIOR

NOTE:

7KHFRQYHQLHQWOXEULFDWLRQSURYLVLRQVRIWKH(=OXEHPXVW

QRWUHSODFHSHULRGLFLQVSHFWLRQDQGPDLQWHQDQFHRIWKHEHDULQJV8VH

a hand-operated grease gun; improper use of a commercial grease 
gun may damage the seals.

Failure to properly maintain or reseal your recreation vehicle may result in 
serious water damage to the roof and other parts of the recreation vehicle. This 
damage is not covered by the Towable Limited Warranty..

%#76+10

W

INDOWS

Any ventilating window may permit water inside, especially during heavy rainstorms. 
Condensation will also cause water to accumulate on windows and in the tracks. 

The window “glass” can normally be cleaned with a sponge and water. Use glass cleaner to 
remove wax, oil, grease, dead insects, etc. After washing the glass, wipe it dry with a clean, 
soft cloth.

E

XTERIOR

 R

OOF

 & S

IDEWALL

 V

ENTS

While you are cleaning the exterior roof assembly, also inspect the roof vents (including 
sealants) for cracks and keep them clean.  Inspect the refrigerator and holding tank vents 
for blockages from bird nests, spider webs, leaves, etc.  All exterior access doors and vents 
need to be kept clean and free of obstructions (i.e., insect nests, mud daubers, etc.) while the 
appliances are in use.

S

EALANTS

Sealants perform a very important function and should be inspected closely and regularly 
maintained.  We incorporate many different types of sealants, including butyl/putty, black 
butyl-encapsulated foam, silicone (clear and colored), roof sealant and foam.  In general, 
sealants do not have “set” lifetimes.  Varying environmental factors affect the pliability and 
adhesiveness of sealants.  

E

XTERIOR

 

LADDER

 (I

F

 S

O

 E

QUIPPED

)

Your recreation vehicle may be equipped with an optional roof ladder. The recreation vehicle 
roof has decking under the rubber roof membrane to allow you to walk on the roof (with 
caution) to do maintenance.

If your recreation vehicle is equipped with a roof ladder, do not leave items 
attached to it while traveling. The ladder weight capacity should not be 
exceeded (see ladder capacity label). DO NOT exceed this weight limit.  There 
should never be more than one person on the ladder at the same time.

9#40+0)

Summary of Contents for PINNACLE

Page 1: ...2016 CAMPING TRAILERS PRINTED ON RECYCLED PAPER 0210677 2016 2016 PINNACLE TOWABLES...

Page 2: ...B...

Page 3: ...show that a little initiative can go a long way The Jayco EcoAdvantage is our way of making sure endless generations can enjoy the Great Outdoors 7 192 tons of wood 2 354 tons of scrap metal 1 428 ton...

Page 4: ......

Page 5: ...Window 19 Exit Window Label 19 Fire Safety 20 Fire Extinguisher 21 Smoke Alarm 21 Smoke detector warning label 22 Combination Carbon Monoxide Propane Alarm 23 Formaldehyde 27 Extended Or Full Time Us...

Page 6: ...System If So Equipped 61 Slideout Systems 62 Slideout overlap outside 62 Fig 1 Through Frame Crank Extension w pin 68 Fig 3 Hex Head Crank Extension 68 Fig 2 Crank Handle 68 Fig 4 Ratchet 68 ELECTRICA...

Page 7: ...98 Ensure a supply of fresh air Canada units only 98 Cooking comfort heating label 98 Traveling with Propane 99 Re fueling Warning Label 99 PLUMBING SYSTEM Plumbing System Maintenance 101 Monitor Pane...

Page 8: ...If So Equipped 137 APPLIANCES Microwave 139 Cooktops If So Equipped 139 Kitchen Range Oven If So Equipped 141 Gas BBQ Grill If So Equipped 142 Bumper mounting bracket 143 Gas Grill Mounting Bracket 14...

Page 9: ...or Safe If So Equipped 160 EXTERIOR Cleaning The Exterior 161 Frame 163 E Z Lube or Super Lube Axle If So Equipped 163 Exterior Roof Sidewall Vents 164 Windows 164 Exterior ladder If So Equipped 164 S...

Page 10: ......

Page 11: ...rvice and or maintenance could result in the loss of warranty The owner should review the Jayco limited warranty and the limited warranties WKDW DSSO WR VSHFL F FRPSRQHQWV WKDW DUH RIIHUHG ZLWK WKLV Y...

Page 12: ...2...

Page 13: ...is information for questions regarding operating maintenance servicing instructions and warranty coverage It is important you complete and mail warranty cards and registrations within the prescribed t...

Page 14: ...is used to alert you to potential personal injury hazards Obey all safety messages that follow this symbol to avoid possible injury or death REPORTING SAFETY DEFECTS In the United States If you believ...

Page 15: ...posted mail RU HPDLO DV LW HQDEOHV WKHLU LQYHVWLJDWRUV WR FRQ UP WKDW RXU LQIRUPDWLRQ LV FRUUHFW DQG WR answer your questions accurately For additional information please refer to the Transport Canad...

Page 16: ...ons we would like to make Contact your dealer at once Do not wait until you are ready to use your RV Your dealer may not be able to service it immediately and or the repair may require parts be ordere...

Page 17: ...lity you are contacting Jayco to discuss Keep a maintenance log of your vehicle s service history This can often provide a clue to the current issue Be reasonable with your requests If you leave a lis...

Page 18: ...J WR WKH D FR 7UDYHO OXE RX ZLOO QG QHZ ZD V WR HQMR RXU 59 DQG PDNH friends all across the country For more information please visit www Jaycorvclub com or call 1 800 262 5178 JAYPLUS EXTENDED SERVIC...

Page 19: ...0DNH VXUH RX DUH VDWLV HG with the repair before you pay or leave the premises f For reimbursement either you or the RV repair facility must send a copy of your itemized repair bill and all requested...

Page 20: ...vide an appropriate substitute TOWABLE LIMITED WARRANTY WHAT AND WHO IS COVERED The Jayco warranty covers this recreational vehicle RV when used only for its intended purpose of recreational travel an...

Page 21: ...d or modify this limited warranty Any selling or servicing dealer is not Jayco s agent but an independent entity JAYCO SHALL NOT BE LIABLE FOR ANY INCIDENTAL OR CONSEQUENTIAL DAMAGES THAT MAY RESULT F...

Page 22: ...R the RV or if the RV is purchased registered or titled in a business name any RV sold or used outside the United States U S Territories or Canada any RV not used solely for recreational travel and ca...

Page 23: ...Owner s Manual unauthorized alteration off road use collision or accident whether or not foreseeable including any acts of weather or damage or corrosion due to the environment WKHIW YDQGDOLVP UH H SO...

Page 24: ...ain Street P O Box 460 Middlebury IN 46540 Telephone 574 825 5861 or 800 283 8267 NOTICE TO JAYCO DEALERS This Owner s Manual contains the Towable Limited Warranty that applies to this RV However if t...

Page 25: ...s obligation to notify Jayco of a claimed defect does not modify any obligation placed on the Dealer to contact Jayco directly when attempting to pursue remedies under state or federal law LIMITATION...

Page 26: ...not cover any of the following defects in materials components or parts of the RV not attributable to Jayco items that are added or changed after the RV leaves the possession of Jayco additional equi...

Page 27: ...portion of this limited warranty or any implied warranty shall be commenced within six 6 months after expiration of the warranty coverage period designated above Any performance of repairs shall not...

Page 28: ...lure to maintain the RV as noted in those manuals voids this limited warranty and any damage to the RV as a result of your failure to perform such care is not covered by this limited warranty THIS WAR...

Page 29: ...sure the ground below the window is solid and can be used as an escape path Practice opening the window before an emergency occurs and make sure all occupants know how to operate it The egress window...

Page 30: ...OHFWURFXWLRQ LV SRVVLEOH ZLWK DQ HOHFWULFDO UH 5HIHU WR WKH IROORZLQJ VHFWLRQV IRU DGGLWLRQDO UH VDIHW LQIRUPDWLRQ Electrical Systems Q FDVH RI DQ HOHFWULFDO UH Appliances Q FDVH RI D JUHDVH UH Slider...

Page 31: ...lso be done before beginning a vacation or during an extended trip Do not turn the electrical power back on or plug in any appliances after the use RI D UH H WLQJXLVKHU 3OHDVH UHIHU WR WKH UH H WLQJXL...

Page 32: ...ds it may not be heard for many reasons These include but not limited to a closed or partially closed door the alarm may EH GURZQHG RXW E RWKHU QRLVH OLNH WKH 79 VWHUHR WUDI F ZHDWKHU DLU FRQGLWLRQHU...

Page 33: ...detector user s guide Battery The smoke alarm will not function if the battery is missing disconnected dead the wrong type of battery is used or the battery is not installed correctly The smoke detec...

Page 34: ...de fumes rests solely on you Installing a carbon monoxide propane alarm is just WKH UVW VWHS LQ SURWHFWLQJ RXU IDPLO IURP WR LF FDUERQ PRQR LGH SRLVRQLQJ 9 40 0 The alarm is wired directly to the 12 v...

Page 35: ...hemicals used in its construction may be detected for months after the vehicle was constructed for more information refer to Section 2 Formaldehyde What you should do if the alarm sounds 1 Operate the...

Page 36: ...ED light will remain steady and the alarm will sound 4 BEEPS then silent for 5 seconds These signals indicate immediate action is required 3URSDQH JDV DODUP 7KH UHG OLJKW ZLOO DVK DQG WKH DODUP ZLOO V...

Page 37: ...unknown period of time Individuals who are allergic to formaldehyde gas fumes may experience irritation to eyes ears nose and throat Indoor air quality may also be affected by leaving your vehicle clo...

Page 38: ...ocks slide outs windows vents etc for frozen moisture before operating to avoid damage to parts CONDENSATION Condensation is a natural phenomenon The amount of condensation will vary with climate cond...

Page 39: ...on plate painted over damaged or removed should be replaced HHS D UHFRUG RI WKH GLJLW YHKLFOH LGHQWL FDWLRQ QXPEHU 9 1 WKH GLJLW VHULDO number and your license number in the event theft or vandalism r...

Page 40: ...ailer as it was manufactured and weighed at the factory It includes full propane tanks and full generator fuel if so equipped You may question the total weight capacity of the tires on your RV being l...

Page 41: ...hicle Do not exceed your GVWR and ensure you are loading the vehicle as evenly as you can for the best possible handling Ensure heavy items are secured so they do not shift during travel 9 40 0 Receiv...

Page 42: ...ned to carry cargo Items that extend beyond the bumper OR weigh over 100 lbs 45kg will place undo strain on the bumper The 100 lb bumper capacity includes the weight of the spare tire that may have be...

Page 43: ...ZKHHOV XVXDOO WKH IWK ZKHHO SLQ ER LV adjustable for variance in trucks and truck suspension systems GMXVW WKH KLWFK DVVHPEO VR WKH WRZ YHKLFOH DQG WKH IWK ZKHHO DUH HVVHQWLDOO OHYHO KLJK KLWFK ZLOO...

Page 44: ...how much cargo capacity is important for you personally 9 40 0 9 3OXJ WKH ZLUH KDUQHVV FRQQHFWRU SOXJ IURP WKH WRZ YHKLFOH WR WKH IWK ZKHHO 10 Remove the wheel chocks from the trailer wheels WIRE HARN...

Page 45: ...uding the tongue weight while detached from the tow vehicle This actual overall weight must be less than or equal to the GVWR for safe operation If the overall weight is greater than the GVWR some con...

Page 46: ...mponents tires wheels brakes springs etc on the heavier side could be overloaded even though the total axle load is within the GAWR It is important to redistribute the load to avoid component failure...

Page 47: ...e parking lot where it is permissible Easing to a stop and starting smoothly saves wear and tear on your tow vehicle RV combination Be aware of road surface conditions Slow down well in advance of dip...

Page 48: ...vehicles along the curb When making a turn check the road clearance and be aware of others Have someone KHOS JXLGH RX RXW RI D GLI FXOW SDUNLQJ VSDFH RU WUDI F SDWWHUQ 6ZHUYHV DQG VKDUS WXUQV especial...

Page 49: ...Wire harness connector plug Trailer battery Breakaway switch Hydraulic brakes if so equipped Your recreation vehicle may be equipped with hydraulic surge brakes These brakes operate automatically as...

Page 50: ...combination ENTRANCE DOOR STEP S Make sure your entrance step is fully extended before exiting the vehicle and retracted prior to towing Lubricating the step mechanism Carefully clean the area around...

Page 51: ...the right of the buttons The buttons will illuminate once the Touch Pad is wakened This indicates that the touch pad is ready for the code to be entered Refer to the diagram on next page Preset Facto...

Page 52: ...ry life is highly dependent upon battery quality usage and environment temperature Make sure there are no obstructions in the door frame to prevent Dead Bolt extension Do not wash with power washer or...

Page 53: ...t found on this list please refer to the manufacturer s operators manual Battery Installation The entry system uses 4 AA batteries for operation We do not recommend zinc carbon batteries for this appl...

Page 54: ...n refer to the manufacturers user guide The rear vision camera aids in the use of but does not replace vehicle side rear view mirrors 9 40 0 Objects in the camera view are closer than they appear When...

Page 55: ...ecreation vehicle you need to ensure it is level Leveling is very important A level vehicle is more comfortable for sleeping and walking The refrigerator is designed to operate when level for best per...

Page 56: ...F THE GROUND LIFTING THE RV SO THE WHEELS ARE NOT TOUCHING THE GROUND WILL CREATE AN UNSTABLE AND UNSAFE CONDITIONAND MAYRESULT IN SERIOUS PERSONAL INJURY OR DEATH THE LEVELING SYSTEM IS DESIGNED ONLY...

Page 57: ...RACT button the front jacks can be retracted together by pushing the FRONT button or individually by pressing LEFT or RIGHT buttons while simultaneously pressing the FRONT button The rear jacks con on...

Page 58: ...ck press the control switch until the jack is returned to the retracted position DO NOT USE THE STABILIZER JACKS TO LEVEL THE RV It is important to remember that the stabilizer jacks are to be used on...

Page 59: ...WHU RXU UVW WULS FKHFN WKH ZKHHO OXJ WRUTXH SHULRGLFDOO IRU VDIHW KHFN WKH ZKHHO lugs after winter storage after a wheel removal before starting a trip or following extensive braking Use the correct s...

Page 60: ...ration of the wheel s from your recreation vehicle The lug nuts on the wheels of your recreation vehicle must be maintained according to listed torque values see Wheel Lug Torque Chart Over torqued an...

Page 61: ...inspection of your tires and checking tire pressures is absolutely mandatory Examine your tires frequently for unusual wear Alignment balance and bearing wear will affect tire wear Make sure to look...

Page 62: ...ZHDU VKRXOG EH FKHFNHG IUHTXHQWO 2QFH D ZHDU SDWWHUQ EHFRPHV UPO HVWDEOLVKHG LQ D WLUH LW LV GLI FXOW WR VWRS HYHQ LI WKH XQGHUO LQJ FDXVH LV corrected 76 10 This recreational vehicle is equipped with...

Page 63: ...the brand installed on your RV They are not to be returned to your dealer or Jayco Do not use the stabilizer jacks to support the RV while under the vehicle or changing tires The stabilizer jacks are...

Page 64: ...ally it is fastened to the sidewall of the compartment Insert the crank handle into the crank access port located either in the center of the rear bumper or in the sidewall of the RV Turn the crank ha...

Page 65: ...emove the tire from the tire carrier 1 Remove the lug nuts holding the tire in place 2 Remove the support bracket from the bottom lug 3 Pull the tire from the tire carrier To install the tire on the t...

Page 66: ...Packet for operating and safety information Awning care It is a good idea to keep the awnings in the closed position if you will be away from the recreation vehicle for an extended period of time Keep...

Page 67: ...ng and safety information Adjusting the Awning Pitch The longitude arms have 6 pitch adjustment settings from minimum pitch to maximum pitch The awning can be extended and retracted in any of these po...

Page 68: ...r The cover snaps onto the rear cover To remove press on both sides of the rear cover until the front cover releases then lift the cover off 2 Detach the RED and BLACK wires from the cable to the moto...

Page 69: ...over a short time period may cause the circuit to sense an overheat condition and shut off the motor If this occurs wait approximately 15 minutes to allow the motor to cool then operate the awning in...

Page 70: ...60 VEHICLE OPERATION Notes...

Page 71: ...URRP V VWHP LV GHVLJQHG IRU DGGLWLRQDO RRU VSDFH DQG FRPIRUW 7KH PHFKDQLFDO components are gear driven Electric powered slideout room systems have a manual override to allow you to extend or retract t...

Page 72: ...teps Check the auxiliary battery customer supplied for a full charge and good wire connections Check the 12 volt fuse or circuit breaker Check for loose connections at the slideout motor If the slideo...

Page 73: ...H WR SRZHU RII the remote DO NOT try and time the end of the stroke by releasing the button early ALWAYS allow the controller to stop both motors before releasing the switch button Retracting slideout...

Page 74: ...d or retract the room Consult Customer Service before attempting to jump the auxiliary battery Only 1 Side Moving The inwall room slide has a separate motor to operate each side of the room Does only...

Page 75: ...elease the mode button 5 Use either a wall switch or one of the slide room switches located on the command center panel depending on the slideout Press the switch toward the word IN or RETRACT printed...

Page 76: ...When an error code occurs during operation the board will use the LEDs lights to indicate ZKHUH WKH SUREOHP LV RU PRWRU VSHFL F IDXOWV WKH JUHHQ ZLOO EOLQN WLPH IRU PRWRU 1 and 2 times for motor 2 The...

Page 77: ...f the slideout is retracted leave it in that position Contact your dealer or customer service for repair assistance If the slideout extends crooked or only one side moves follow these steps ROORZ VWHS...

Page 78: ...f 4 major components Inner rail assemblies to support the room weight A 12 Volt DC gear motor to operate the room using power from the onboard battery A manual override that allows you to extend or re...

Page 79: ...he room into position If the slideout switch is held after the room is fully extended the control will sense that the room has stopped and will shut the motor off after a few seconds 4 Install the tra...

Page 80: ...er clockwise looking from Always disconnect battery from system prior to manually operating system Failure to disconnect battery can cause electricity to backfeed through the motor and cause serious d...

Page 81: ...gearbox override optional use the crank handle to move the room 7 When the room is fully in or out have one person apply pressure to the wrench ratchet and return the brake lever to its engaged positi...

Page 82: ...72 ELECTRICAL SYSTEM Notes...

Page 83: ...condition 6HUYLFH DQG RU PRGL FDWLRQ RI WKH HOHFWULFDO V VWHP VKRXOG RQO EH SHUIRUPHG E TXDOL HG electrical technicians using approved materials components and methods meeting current safety and code...

Page 84: ...MA 14 50 RV receptacle and not 240 volt AC 9 40 0 GFCI RECEPTACLE Grounding is your personal protection from electrical shock Each recreation vehicle has a ground fault current interrupter GFCI engine...

Page 85: ...le is properly wired and grounded Reverse polarity and or improper grounding of your RV can cause personal injury or death 9 40 0 50 AMP POWER CORD IF SO EQUIPPED The 50 amp external utility power cor...

Page 86: ...eaker 5 To help prevent power surges from damaging the connected loads please follow these instructions when hooking up to the external power source The shore line power cord should be unplugged when...

Page 87: ...0 calculated by dividing appliance wattage consumed normally listed on the appliance by nominal design voltage 120 for a 120 volt appliance For example 1200 watts divided by 120 volts equals 10 amps...

Page 88: ...onverts 120 volt AC power to useable 12 volt DC power when the shore power cord is connected to an external power source The converter has a built in protective thermal breaker that will shut it down...

Page 89: ...HHQ DVKHV HYHU VHFRQGV 2XWSXW YROWDJH KDV EHHQ reduced to 13 2VDC the RV battery is fully charged and converter is maintaining the charge Also included is a Wizard Mode Button used to override the Cha...

Page 90: ...power outlets in your recreation vehicle When the 12 volt DC outlet is used as a power source for an electric appliance make sure the appliance operates on 12 volt DC power and that it consumes less t...

Page 91: ...include any 12 volt lights water pump or any other 12 volt component If the furnace and refrigerator in the above example operated constantly a 75 amp hour battery would become fully discharged in 5 h...

Page 92: ...l 12VDC power to the fuse panel in the RV Battery Disconnect Switch BATTERY ISOLATOR FOR YOUR TOW VEHICLE CUSTOMER SUPPLIED You may want to consider the installation of a battery isolator on your tow...

Page 93: ...uble Lights 18 2 5 AMPS Furnace 12 0 AMPS Generator Start 95 0 AMPS Halogen Light 1 7 AMPS Illuminated Switch 125 AMP Inverter variable Leveling System 95 0 AMPS LP Detector 125 AMP Map Light 1 5 AMPS...

Page 94: ...ll other appliances 3 Check for fuel exhaust and coolant leaks STOP the generator immediately if there is a fuel exhaust or coolant leak and have it repaired CARBON MONOXIDE IS DEADLY Do not run the g...

Page 95: ...Exercising Your Generator it s also very important to run your generator regularly to keep Excessive cranking can overheat and damage the generator starter motor Do not crank for more than 20 seconds...

Page 96: ...vary by model but may be located either on the sidewall on the A frame of the vehicle or in the outside utility center There are capped off wires located in the area of the battery These wires are th...

Page 97: ...wning LED lights front cap LED accent lights Cargo bed red lighted master control switch Slideout control switches press and hold to extend retract Awning control switches press and hold to extend ret...

Page 98: ...g the recreation vehicle Inverter panel power switch with display Generator start stop control with hour meter Cargo bed red lighted master control switch Power bunk bed lift control switch Fuel gauge...

Page 99: ...xide safety If you are in a recreation vehicle with either a nearby tow vehicle engine running or the generator if so equipped running there is a potential for H KDXVW IXPHV WR OWHU EDFN LQWR WKH UHFU...

Page 100: ...N Do not check for leaks using products that contain ammonia or chlorine these products can cause FUDFNV WR IRUP RQ WKH PHWDO WXELQJ DQG EUDVV WWLQJV 0 4 PROPANE SAFETY PROCEDURE 3URSDQH LV D FRORUOHV...

Page 101: ...e on gas grills and other low pressure devices DOT cylinders equipped with DQ 23 DQG 0 W SH VHUYLFH YDOYH DUH LGHQWL HG E WKH WULDQJXODU VHUYLFH YDOYH NQRE DOT cylinders are typically marked with top...

Page 102: ...s released from the container it changes to vapor which is then used for the operation of the appliances Propane will not run through the appliances in the liquid state Propane expands 1 percent for e...

Page 103: ...HYHO DV LQGLFDWHG E WKH HG OLTXLG OHYHO JDXJH R QRW DOORZ WKH YLVLEOH JDXJH WR EH XVHG IRU OOLQJ 2YHU OOLQJ WKH propane container above the liquid capacity indicated on the container could allow liqui...

Page 104: ...ousing so the vent is pointed downward 4 WWDFK WKH LQYHUWHG DUH 7 SH SLJWDLO KRVH WR WKH UHJXODWRU LQOHW DQG WKH right hand swivel nut to the cylinder valve Main Supply Hose Low Pressure WWDFK WKH PDL...

Page 105: ...EH UH OOHG Do not attempt to repair any containers container valves regulator or appliances by yourself 8VH RQO WUDLQHG FHUWL HG SURSDQH JDV VHUYLFH WHFKQLFLDQV WR SHUIRUP UHSDLUV 3URSDQH F OLQGHU UHF...

Page 106: ...DLQHU SUHVVXUH WR OEV 7KH VHFRQG stage reduces the 10 13 lbs of pressure further to an operating pressure of 11 W C water column or 6 35 oz of outlet pressure to your appliances 7KH VHFRQG VWDJH LV DG...

Page 107: ...IUHH H XS 6KRXOG RX H SHULHQFH propane freeze up close the main valve and wait 15 minutes before trying again 3 LVWHQ FDUHIXOO DV SURSDQH EHJLQV WR RZ I D KLVVLQJ QRLVH LV KHDUG IRU PRUH WKDQ RQH or...

Page 108: ...imited due to the size of the recreation vehicle Proper ventilation when using the cooking appliance s will help you avoid the danger of asphyxiation It is especially important that cooking appliances...

Page 109: ...is properly fastened in place Some states prohibit propane appliances to be operated during travel especially in underground tunnels Make sure you know the laws for the areas where you travel 7KH ODEH...

Page 110: ...100 FUEL PROPANE SYSTEM Notes...

Page 111: ...care of all the components within the plumbing system and help discourage the growth of bacteria and other organisms that can contaminate the water supply 7 SLFDOO WKHUH DUH ODEHOV DI HG WR WKH H WHUL...

Page 112: ...the water pump will run until it reaches 45 lbs of pressure It will recycle when pressure drops The switch will light up when it is turned ON Turn the switch OFF when the water pump is not being used...

Page 113: ...use water in your recreation vehicle and it is not hooked up to city water RX ZLOO QHHG VXI FLHQW YROW SRZHU WR UXQ WKH ZDWHU SXPS Once activated the water pump also known as the demand pump will sel...

Page 114: ...VZLWFK XVHG WR WXUQ LW RQ H J LI WKH SXPS LV turned on at the utility center it cannot be turned off with the switch LQVLGH WKH 59 DW WKH FRPPDQG FHQWHU t it h h ld b i th OFF iti h th RV i l ft tt d...

Page 115: ...n winterizing to avoid damage to the water heater 7 Rinse the black tank to help control odors and prevent waste buildup 8 Rinse off items outside the unit with hot cold faucet 9 Connect up to 3 coax...

Page 116: ...s the functions of the utility center water valves as displayed on the valve operation label located on the utility center front panel POWER FILL TANK Pressurized fresh water source 1 Connect the fres...

Page 117: ...d of the hose in a container holding sanitizing solution 4 Turn the pump switch ON 5 Fresh water tank should begin drawing solution out of the container To aid siphoning place the container on a surfa...

Page 118: ...ize the water lines 2 Set the color coded valves to the WINTERIZE setting A White handle pointing down B Blue handle pointing left C Black handle pointing right D Red handle pointing left E Green hand...

Page 119: ...rn off water supply using two valves located on the water lines on each side of the canister 2 3ODFH GULS SDQ EHORZ OWHU KRXVLQJ WR FDWFK DQ VSLOODJH 3 3UHVV WKH UHG EXWWRQ RQ WRS RI WKH OWHU KRXVLQJ...

Page 120: ...microbiologically unsafe or of unknown quality Maximum operating pressure is 125 psi 8 75 bar Maximum water temperature is 125 F 52 C 76 10 WATER HEATER 7KH ZDWHU KHDWHU LV GHVLJQHG WR KHDW ZDWHU TXLF...

Page 121: ...Double check the bypass valves make sure they are set properly Always RSHQ ERWK WKH KRW DQG FROG ZDWHU IDXFHWV ZKHQ OOLQJ WKH IUHVK ZDWHU WDQN WR DOORZ air pockets to be forced out of the water heate...

Page 122: ...erating the water heater without the proper anode rod protection will decrease tank life and will void the tank manufacturer s warranty on the tank To extend the anode life drain the water from the wa...

Page 123: ...ate a defective relief valve One way to reduce the frequency of this occurrence is to maintain an air pocket at the top of the water heater tank This air pocket will form in the tank by design however...

Page 124: ...o the water heater either at the switch from the electrical element of at the breaker 2 Shut off the propane supply to the water heater 3 Turn off the pressure pump on the water system 4 Open both hot...

Page 125: ...KHDW WKH ZDWHU 2 Open the outside shower compartment door 3 If dry camping be sure the 12 volt water pump is ON 4 Remove the handheld shower from its holder 5 Turn ON the hot and cold faucet knobs an...

Page 126: ...e the recreation vehicle does not contain a water pressure balance valve If someone is using the shower it is recommended that the fresh water system NOT BE USED XQWLO WKH DUH QLVKHG Maintenance Refer...

Page 127: ...H H WHULRU VLGHZDOO JR LQVLGH WKH PRWRU KRPH WR QG WKH corresponding location of the drains 5 Drain the sink by removing the drain cap 6 Turn ON the water pump and allow it to run as needed 7 I WKH 59...

Page 128: ...water system If a 100 ppm concentration is required as discussed in step 12 use cup of household bleach with one gallon of water to prepare the chlorine solution One gallon of the solution should be u...

Page 129: ...drain the chlorine solution from the fresh water system see Draining the Fresh Water System Rinse the system with fresh water 13 Fill the fresh water tank full of clean potable water Use water from ei...

Page 130: ...U ZDWHU OWHU UHPRYH WKH FDQLVWHU WDNH RXW WKH OWHU WKHQ UH DWWDFK the empty canister After draining the system 1 Water heater power should still be OFF both switches electric LP Gas 2 Put the vinegar...

Page 131: ...PRXQW 12 5H OO WKH IUHVK ZDWHU V VWHP ZLWK FOHDQ ZDWHU 13 After the water tank set the valves to either DRY CAMPING or CITY WATER in order IRU ZDWHU WR RZ WKURXJK WKH ZDWHU KHDWHU DJDLQ WINTERIZING T...

Page 132: ...rain could potentially damage the seals and cause water leaks If you have questions consult with your RV dealer Using RV antifreeze is the preferred method of winterization 9 40 0 Pressure Method NOTE...

Page 133: ...ility center 2 Level the RV and drain the fresh water plumbing system See Draining the Fresh Water System 3 5HSODFH WKH ZDWHU OWHU FDUWULGJH ZLWK WKH SODVWLF E SDVV KRVH LI VR HTXLSSHG 2Q IXOO V VWHP...

Page 134: ...nk There are no dedicated water heater bypass valves BLACK GREY WATER SYSTEM DWHU IURP WKH VLQNV DQG VKRZHU RZV LQWR WKH JUD ZDWHU RU ZDVWH ZDWHU KROGLQJ WDQN DWHU IURP WKH WRLOHW ZLOO RZ LQWR WKH VHZ...

Page 135: ...pes With Dry Sealing Valve If So Equipped Your RV may be equipped with a dry sealing valve that prevents the escape of odors from your waste system and eliminates the need for P traps Should the RV dr...

Page 136: ...refrigerator water line until only air comes out of the dispenser 8 5HPRYH WKH UHIULJHUDWRU ZDWHU OWHU DQG H WUDFW ZDWHU RXW RI WKH OWHU XVLQJ D VZLIW ZULVW LFN PRWLRQ OLNH LFNLQJ ZDWHU RXW RI D SDLQ...

Page 137: ...e of the icemaker and pulling the tray out Discard any ice or water in the bin 5 Find the Test Switch on the icemaker photo at right Press and hold this button for 8 seconds to initiate a test cycle w...

Page 138: ...eeze down into the pump Stop the washer and unplug it Wipe out any excess antifreeze in the drum De winterizing the Whirlpool Clothes Washer Run a full empty wash cycle before camping season begins Wi...

Page 139: ...all s Rand McNally Camp Guide Good Sam Camp Guide KOA Kampgrounds Camp Guide and various other publications Some fuel stations also have dump stations Please contact your RV dealer for assistance in t...

Page 140: ...s and dump valves BLACK TANK FLUSH RINSING THE WASTE TANK 7KH WDQN XVK LQOHW DOVR NQRZQ DV WKH QR IXVV XVK is the black inlet located on the utility center panel 7KLV LQOHW LV SURYLGHG WR DVVLVW LQ XV...

Page 141: ...18 C All of the heaters are controlled by a single ON OFF switch Typically this red tank heater ON OFF switch is located on the command center panel or in the bathroom The switch lights up red when it...

Page 142: ...outside temperature approaches and maintains freezing conditions 35 F 2 C or colder The tank heater switch should be turned OFF When there is NO liquid present tanks are empty When dumping the black a...

Page 143: ...RZ LQWR WKH KROGLQJ tank Waste grey holding tank preparation No special preparation is required however placing a small quantity of chemicals into this tank such as baking soda or an approved RV chem...

Page 144: ...134 PLUMBING SYSTEM Notes...

Page 145: ...f So Equipped The wall mounted air conditioning system is controlled by a thermostat Cooled air enters WKH 59 WKURXJK WKH JULOO 0DNH VXUH RX KDYH VXI FLHQW SRZHU DYDLODEOH EHIRUH RSHUDWLQJ WKH DLU FRQ...

Page 146: ...ceiling fan is controlled by the pull chain switch The sequence of operation for the pull chain switch is OFF High Medium Low OFF The slide switch located on the fan controls the direction of operati...

Page 147: ...personal injury or loss of life 9 40 0 To ensure your personal safety do not obstruct or alter the furnace in any manner Do not install screens over the vent for any reason Screens will become restric...

Page 148: ...138 HEATING COOLING Notes...

Page 149: ...cleaner Turntable mild soap and water or dishwasher Rack s mild soap water and washcloth Dishwasher cleaning is not recommended Convection Microwave if so equipped For details on operation cleaning an...

Page 150: ...if so equipped Never leave cooking food unattended Turn pan handles inward but not over the tops of the other range burners Ensure that pans used are large enough to contain the food and avoid boil o...

Page 151: ...n griddle or any other large utensil that covers more than one burner at a time This will create excessive heat that may cause melting sooting or discoloration The use of undersized pans could expose...

Page 152: ...f vent or the range hood vent LI VR HTXLSSHG GAS BBQ GRILL IF SO EQUIPPED Be sure to read understand and follow all information supplied with your recreation vehicle concerning the use of propane befo...

Page 153: ...nd mounting bar The pin must be installed to insure the mounting bar is secure during use Tighten the T handle on the bracket mounted to the bumper Set the BBQ grill on the mounting bar by inserting t...

Page 154: ...quick coupler connection and support bracket for easy installation of the BBQ grill Attaching the quick coupler connection The quick coupler is directly connected to the RV propane system The quick co...

Page 155: ...ed with this appliance Use of an extension cord is not recommended If one must be used use the shortest length possible Do not connect 2 or more extension cords together Keep connections off the groun...

Page 156: ...sed from the cart by pressing two red buttons on the cart The cart includes two hooks to hang grill tools on The cart folds up as shown and the grill lid can be secured with a webbed velcro strap When...

Page 157: ...and free of debris Check for obstructions in the exterior refrigerator vent area i e spider webs bird nests etc Use a soft cloth to dust off the debris RU RSWLPXP HI FLHQF DQG SHUIRUPDQFH LW LV UHFRPP...

Page 158: ...the condenser 5HSODFH WKH EDVH JULOOH ZKHQ QLVKHG Cleaning the exterior Painted metal exteriors wash with a clean sponge or soft cloth and a mild detergent in warm water Stainless steel exteriors was...

Page 159: ...your recreation vehicle Dryer prep has been designed for electric dryer operation ONLY 9 40 0 CENTRAL VACUUM SYSTEM IF SO EQUIPPED The following is an overview of the central vacuum system operation F...

Page 160: ...ufacturer s user guide for important safeguards and operating instructions Read all instructions before operating the vacuum cleaner WATER HEATER SEE PLUMBING SECTION DO NOT PICK UP FLAMMABLE OR COMBU...

Page 161: ...2 Switch the power supply ON and OFF to see if there is a difference in the picture quality while watching TV If there is no difference refer to manufacturer s manual for further testing procedures Lo...

Page 162: ...ON sends 12 volt DC through the cable to the TV roof antenna The voltage energizes the WUDQVLVWRUV LQ WKH DQWHQQD KHDG DPSOL HU 7KH 79 VLJQDO WKHQ FRPHV GRZQ the cable to the outlets Turn the TV powe...

Page 163: ...not to get the power cord or the antenna cable caught in the mechanism 3 Push it all the way back into the compartment until it stops Firmly push it into place until the yellow tipped lever locks it...

Page 164: ...154 ELECTRONICS...

Page 165: ...eather if so equipped It is recommended the Ultraleather be professionally cleaned if it becomes stained or VRLOHG RU PRUH LQIRUPDWLRQ UHIHU WR WKH VSHFL F IXUQLWXUH PDQXIDFWXUHU V FDUH LQVWUXFWLRQV L...

Page 166: ...brics of the shades on a regular basis Shades should be kept in the closed or up position when not in use to maintain pleat retention and minimize dirt and soil build up Do not store shades in the dow...

Page 167: ...PED The dinette is designed to seat up to four adults Depending on your model there may be a storage area in the dinette bench To access this storage remove all the cushions and lift up on the bottom...

Page 168: ...s load capacity is designed by weight not volume so you cannot necessarily use all available space If your pantry or hutch has sliding pantry shelves they have been equipped with a locking mechanism t...

Page 169: ...unnecessary damage to the countertops Do not cut directly on the solid surface countertop Use potholders or trivets before placing hot pots and pans on the countertop Heat will damage the countertop R...

Page 170: ...RQ WKH HQWLUH RRU 2 127 62 7 225 1 8VH FDUH WR DYRLG ZHWWLQJ WKH FDUSHW HGJHV 7R DYRLG SUREOHPV RI HOORZLQJ OLQROHXP WKH RRULQJ PDQXIDFWXUHU UHFRPPHQGV avoiding cleaners that contain oil based solvent...

Page 171: ...using a mild liquid soap Dry wiping with a dry cloth is not recommended Make sure the recreation vehicle s surface temperature is cool under 90 F and out of direct sunlight A shaded area is ideal for...

Page 172: ...YHKLFOH V QLVK H VXJJHVW XVLQJ a damp natural or synthetic chamois There are other drying products such as lint free PLFUR EHU WRZHOV WKDW ZRUN MXVW DV ZHOO During cold weather Salt and other chemica...

Page 173: ...se warm water and a soft cloth or chamois to remove any white residue from dark colored plastic surfaces Do not use a scrubbing brush other hard tools or wax containing abrasives as they may damage th...

Page 174: ...ct the refrigerator and holding tank vents for blockages from bird nests spider webs leaves etc All exterior access doors and vents need to be kept clean and free of obstructions i e insect nests mud...

Page 175: ...elp you obtain the correct sealant s The sealants may become damaged due to road vibration ultraviolet exposure air pollution freezing temperatures and exposure to other elements If deteriorated repai...

Page 176: ...166 EXTERIOR Notes...

Page 177: ...ry De winterize and sanitize the fresh water system Connect your tow vehicle to the RV and test all connections and lights READY TO LEAVE MAINTENANCE CHECKLIST Before leaving or returning home it is c...

Page 178: ...ipped Water hose electric cord unhooked and stored Test brakes for proper operation Secure any loose heavy or sharp objects in the RV or exterior compartments Fasten all interior and exterior doors se...

Page 179: ...hen storing your RV it is recommended that the auxiliary battery customer supplied be disconnected to avoid battery discharge Prior to Storage If storing for the winter be sure the RV is winterized re...

Page 180: ...e Remove all perishables from the cabinets Leave the cabinets and doors ajar to allow air circulation and prevent mildew and musty odors Remove all perishables from the cabinets Leave the cabinets and...

Page 181: ...terprises www kib us Outside Shower Utility Center B B Molders www bandbmolders com Propane Tank Manchester Tank www mantank com P r o p a n e C a r b o n Monoxide Alarm See manufacturers user guide P...

Page 182: ...172 ADDITIONAL INFORMATION VEHICLE MAINTENANCE RECORD Make Model Model Year Vehicle Serial Service Date Mileage Work Performed Performed By Notes...

Page 183: ...173 ADDITIONAL INFORMATION Service Date Mileage Work Performed Performed By Notes Table of Contents Table of Contents Maintenance Record Maintenance Record...

Page 184: ...174 ADDITIONAL INFORMATION Notes...

Page 185: ...175 ADDITIONAL INFORMATION Notes Table of Contents Table of Contents Maintenance Record Maintenance Record...

Page 186: ...________________________ City ____________________ State Province ______ Zip Code_________ Phone ___________________ E Mail Address _________________________ Previous Owner Information Purchased Date...

Page 187: ...177 ADDITIONAL INFORMATION Notes Table of Contents Table of Contents Maintenance Record Maintenance Record...

Reviews: