background image

2

 

Ŷ

“Airflow for cleaning” cleans dust in the air 
during absence. (P.38)

 

Reduces dust that falls to the floor by approximately 

70%

*

2

 (It cannot clean dust that has already built up.)

*2  Product operated while placed next to the wall of an approximately 

23 m

3

 test room. Dust is generated in the center of the room, and the 

weight of dust adhered to the nanofiber HEPA filter after 1 hour is 
measured and used to calculate the weight of dust falling on the floor. 
Comparison of weight of generated dust and weight of dust falling on 
the floor. 
Operating in “Absence cleaning” mode with no people present. 
Evaluated by the test method of Panasonic own. These values are a 
guided only, the effect is different depending on the installation 
environment and the usage.

 

Ŷ

“ECONAVI” operation makes electric utility 
expense cheaper.

It saves power by stopping operation automatically 
when the air is clean. Meanwhile, the product will 
operate in advance to eliminate the dirt effectively 
before spreading, thus reducing the operation time.

 

Ŷ

A presence sensor pre-starts operation and collects dust quickly to prevent dirt from spreading 
around the room

 

Ŷ

Equipped with nanoe™ technology

“Mega catcher” and humidifying function 

bring clean and moisturizing air.

 

Ŷ

Measure against PM2.5

&DWFKHVRIWKHSDUWLFOHVKDYLQJDVL]HRIWRȝP

1

New particles coming from the outdoor by ventilation etc. are not calculated.
*1  Test method:  Japan Electrical Manufacturers' Association voluntary 

standard (HD-128)

Criteria:  The time to remove 99 % of the particles having a size of 0.1 

WRȝPLQDFORVHGVSDFHRIP

3

 is within 90 minutes. 

(It is a value converted for the test space of 32 m

3

.)

 

Ɣ

30LVDJHQHULFWHUPIRUILQHSDUWLFXODWHPDWWHUVKDYLQJDVL]HRIȝP

or less.

 

Ɣ

It has not been confirmed that this product removes fine particulate matter 

RIOHVVWKDQȝP,QDGGLWLRQLWLVQRWPHQWLRQHGWKDWWKLVSURGXFW

removes all of the harmful substances in the air.

 

Ɣ

The result is of a test in closed space of 32 m

3

, instead of in actual 

application space.

Throughout the room

Odor, smoke

Airflow for

 odor, smoke

Near the floor

House dust 

such as 

Airflow for 

house dust

(dead bodies and excreta)

mites, dust 

and 

other

 

Ŷ

About “Mega catcher”

 The sensor detects dirt in the air (P.36), which 
causes the front panel to open widely to suit the 
type and concentration of dirt in the air, and 
product will operate with appropriate airflow. 
(P.38 Type of airflow)

 

Ŷ

About “Light sensor mode”

 The product detects the indoor brightness with the 
light sensor and controls the brightness of indicators 
or the front indication of the control panel and air 
volume automatically. (P.40)

 

Ŷ

Sensors identify dirt in the air, and the front panel opens widely to suck in air intensively from 
the bottom

 

Ŷ

“Clothes refresh” operation deodorizes the 
clothes difficult to wash.*

3

The deodorizing effect differs according to the surrounding environment 
(temperature / humidity), operation time, or type of odor / textile.

*3 Testing organization:  ENVIRONMENTAL CONTROL CENTER CO., LTD.

Test method:  Conduct verification using six grades odor 

intensity measurement method. Located 40 cm 
away from the air outlet in the test chamber of 
23 m

3

.

Deodorizing method:   Emitting nanoe™ in “Clothes refresh” operation

Target:  Attached cigarette odor, barbecue odor

Test outcome: <cigarette odor> odor intensity drops 2 grades 

within 60 minutes. [H117249002000DA] 
<barbecue odor> odor intensity drops 1 grade 
within 60 minutes. [H117249002001DA]

 

Ŷ

About “Sandstorm”

“Sandstorm” mode provides powerful suction with 
an optimal airflow for removing sand dust. (P.38)

Sand dust

Airflow for 

sand dust

 

Ŷ

“Sandstorm” mode provides intensive suction of sand dust using sensors and optimal airflow

 

Ŷ

Adoption of new nanofiber HEPA filter 

VXL95M_EN-ARA.indd   2

10/15/2015   5:47:35 PM

Содержание F-VXL95M

Страница 1: ... manual for future use ƔAlso be sure to read the Safety precautions section P 6 8 before use Contents Page 5 ΏϳϛέΗϟ ΎϧΛ ΕΎρΎϳΗΣ 5 ϝϳϐηΗϟ ϑϭέυ 7 Δϣϼγϟ ΕΎρΎϳΗΣ 11 ίΟϷ ϑϳέόΗ 15 έϳοΣΗϟ 19 ϝϳϐηΗϟ ϕέρ 21 ΏϳρέΗϟ ā 23 ϭϬϟ ϖϓΩΗ ϭϬϟ Δϳϣϛā 25 ϝΎϔρϷ ϝϔϗ Εϗ ϣϟ ΔϳϠϣέϟ ΔϔλΎόϟ ā 27 ϳέϣϟ ϲϟίϧϣϟ ϝϣόϟ ā 29 ΔϧΎϳλϟ ϭ ΔϳΎϋέϟ 29 ΔϠϳϭρ ΓέΗϔϟ ϡ ΩΧΗγϻ ϡΩϋ ΔϟΎΣ ϲϓā 33 ˬ29 ηέϣϟ ϝ ΩΑΗγϻ ΓΩΩΣϣϟ Δϳϧϣίϟ ΓέΗϔϟ ā 35 ΔϳϭϬΗϟ ΔΣΗϓ ϝΎ...

Страница 2: ...ct removes fine particulate matter RI OHVV WKDQ ȝP Q DGGLWLRQ LW LV QRW PHQWLRQHG WKDW WKLV SURGXFW removes all of the harmful substances in the air ƔThe result is of a test in closed space of 32 m3 instead of in actual application space Throughout the room Odor smoke Airflow for odor smoke Near the floor House dustsuch as Airflow for house dust dead bodies and excreta mites dust and other ŶAbout ...

Страница 3: ... ΔϘϳϗΩϟ ΔϳϣϳγΟϟ Ω ϭϣϟ Δϟ ί ϰϠϋ έΩΎϗ ΞΗϧϣϟ Ϋϫ ϥ ϥϣ Ωϛ Ηϟ ϡΗϳ ϡϟ ϭϬϟ ϲϓ ΓΩϭΟϭϣϟ ΓέΎοϟ Ω ϭϣϟ ϊϳϣΟ ϥϣ ιϠΧΗϟΎΑ ϡϭϘϳ ΞΗϧϣϟ Ϋϫ ϥ έϛΫϳ ϡϟ Ϫϧ ϰϟ Ɣ ΔϳϠόϓ ϖϳΑρΗ ΔΣΎγϣ ϥϣ ϻΩΑ ˬΏόϛϣ έΗϣ 32 ϪΗΣΎγϣ ϖϠϐϣ ϥΎϛϣ ϲϓ ϡΗ έΎΑΗΧϻ ΔΟϳΗϧϟ Δϓέϐϟ ΎΟέ ϝϛ ϲϓ ϥΎΧΩϟ ˬΔΣ έϟ ΕΩϑϕ ϝϩϭ ϝϝέ ΉΡΓˬ ϝΩΥ ϥ ΔϳοέϷ έ ϭΟΑ ϝΛϣ ϲϟίϧϣϟ έΎΑϐϟ ϙϟΫ έϳϏϭ ΔΑέΗϷ ϭ αϭγϟ ϭϬϟ ϖϓΩΗ ϲϟίϧϣϟ έΎΑϐϠϟ ΕΎϏέϔϣϟ ϭ ΔΗϳϣϟ ϡΎγΟϷ Ŷ ϕϼϣόϟ ΔΑέΗϷ ρϗϻ ϥϋ ΓΫΑϧ ΏΑγΗϳ Ύϣϣ ˬ ...

Страница 4: ...etected ŶPlace it low on the floor as a countermeasure against pollen Since pollen and dusts are likely to float in the air near the floor we recommend you put the product on the flat floor in the room ŶTo circulate the air efficiently around in the room To prevent the air inlet or the air outlet from being blocked install the product with its right left and the top about 30 cm or more away from w...

Страница 5: ...ΔϔϳϟϷ ΕΎϧ ϭϳΣϟ ϝϛ ϥϋ ϑηϛϟ ϥϛϣϣϟ ϥϣ αϳϟ Ŷ έΎΑϏ Ωο ΩΎοϣ έΟΈϛ νέϷ ϰϠϋ νϔΧϧϣ ϭΗγϣ ϰϠϋ ϪόοϭΑ ϡϗ ΡΎϘϠϟ ϥϣ ΏέϘϟΎΑ ϭϬϟ ϲϓ ΓέΑϏϷ ϭ ΡΎϘϠϟ έΎΑϏ έΎηΗϧ Οέϣϟ ϥϣ ϥ ΎϣΑ Δϓέϐϟ ϲϓ ΔϳϭΗγϣ Δϳοέ ϰϠϋ ΞΗϧϣϟ ϊοϭΑ ϲλϭϧ ˬνέϷ Ŷ Δϓέϐϟ ϲϓ Γ ΎϔϛΑ ϭϬϟ έϳϭΩΗϟ ΞΗϧϣϟ ΏϳϛέΗΑ ϡϗ ˬΩ Ωγϧϻ ϥϣ ϭϬϟ ΝέΧϣ ϭ ϭϬϟ ϝΧΩϣ ϊϧϣϟ ΎϳϠόϟ ϭ ϯέγϳϟ ϭ ϰϧϣϳϟ ϪΑϧ ϭΟ ϥϳΑ έΛϛ ϭ ϡγ 30 ώϠΑΗ ΔΣΎγϣ ϙέΗΑ ΞΗϧϣϟ ϡ ΩΧΗγ ϥΎϣοϟϭ ϪϓϼΧϭ έ ΎΗγϟ ϭ ΙΎΛϷ ϭ ϥ έΩΟϟ ϥϳΑϭ έ ΩΟϟ...

Страница 6: ... long period disconnect the power plug ŶCare and maintenance ŶBe sure to disconnect the power plug before cleaning the product The product may start operating unexpectedly and electric shock or injury may occur ŶMoving the product ŶDo not pull the power cord when carrying or storing away the product It may damage the power cord short circuit may occur and cause electric shock or fire ŶDo not damag...

Страница 7: ...ϰϠϋ έΎΑϐϟ ϡϛ έΗ Ϋ Ώϭηϧ ΔϳϧΎϛϣ ϰϟ ϩέϭΩΑ ϱΩ ϳ Ωϗ ϱΫϟ ϭ ϑϳόο ϝίϋ ΏΑγϳ Ύϣϣ ϖϳέΣ Ɣ ΔϓΎΟ εΎϣϗ ΔόρϘΑ ϪΣγϣ ϭ ϲ ΎΑέϬϛϟ αΑΎϘϟ ϝλϓ Ɣ αΑΎϘϟ ϝλϔΑ ϡϗ ˬΔϠϳϭρ Δϳϧϣί ΓέΗϔϟ ΞΗϧϣϟ ϡ ΩΧΗγ ϡΩϋ ΔϟΎΣ ϲϓϭ ϲ ΎΑέϬϛϟ Ŷ ΔϧΎϳλϟ ϭ ΔϳΎϋέϟ Ŷ ϑϳυϧΗ ϝΑϗ ϲ ΎΑέϬϛϟ αΑΎϘϟ ϝλϓ ϥϣ Ωϛ Η ΞΗϧϣϟ ΔϣΩλ ΙϭΩΣ ϥϛϣϳ Ύϣϛ ϊϗϭΗϣ έϳϏ ϝϛηΑ ϝϣόϟ ϲϓ ΞΗϧϣϟ ΩΑϳ Ωϗ ΔΑΎλ ϭ ΔϳΑέϬϛ Ŷ ΞΗϧϣϟ ϙϳέΣΗ Ŷ ϪϧϳίΧΗ ϭ ΞΗϧϣϟ ϝϣΣ ΎϧΛ ΎΑέϬϛϟ ϙϠγ ΩηΑ ϡϘΗ ϻ έϳλϘΗϭ ΎΑέϬϛϟ ϙϠγ ...

Страница 8: ...use spillage and wet the furniture or short circuit may occur and cause electric shock or fire ŶDo not operate this product in places when using smoke insecticide Chemical residue may build up inside the product and be discharged from the air outlet resulting in a health hazard Ɣ Ventilate the room well after using insecticides before operating the product ŶDo not sit or lean against this product ...

Страница 9: ...ϧΗΑ ϡϘΗ ϻ Ε έηΣϟ ΕΎΧΎΧΑ ϡ ΩΧΗγΎΑ ϡϘΗ ϻϭ ˬϑϔΧϣϟ ΏΎϛγϧ ΙϭΩΣ ϙϟΫ ΏΑγϳ Ωϗ ΔΑΎλ ωϭϗϭ ΏΑγϳ Ωϗϭ Ύ ϘϘηϣ ΞΗϧϣϟ Αλϳ Ωϗ ΔϣΩλ ΙϭΩΣ ΏΑγϳ Ωϗϭ Γέ Ωϟ έϳλϘΗ ΙΩΣϳ ϭ ˬϝϠΑϠϟ ΙΎΛϷ νέόΗ ϭ ϩΎϳϣϟ ϖϳέΣ Ώϭηϧ ϭ ΔϳΑέϬϛ Ŷ Ε ΩϳΑϣϟ ϡ ΩΧΗγ Ωϧϋ ΞΗϧϣϟ Ϋϫ ϝϳϐηΗΑ ϡϘΗ ϻ ϥΎΧΩϟ ΎϬϧϣ ΙόΑϧϳ ϲΗϟ ΔϳέηΣϟ ΝέΧϣ ϥϣ ϪϠλϓ ϡΗϳϭ ΞΗϧϣϟ ϝΧ Ω Δϳ Ύϳϣϳϛ Ώγ ϭέ ϡϛ έΗΗ Ωϗ ϲΣλ έρΧ ϰϟ ϱΩ ϳ Ύϣϣ ˬ ϭϬϟ Ɣ ϝϳϐηΗ ϝΑϗϭ ΔϳέηΣϟ Ε ΩϳΑϣϟ ϡ ΩΧΗγ ΩόΑ ΩϳΟ Δϓέϐϟ ΔϳϭϬΗΑ ϡϗ...

Страница 10: ... Easy Housework button indicator Airflow button indicator Power Off On button Light sensor Air outlet nanoe emission outlet Tank Tray Floater inside Humidifying filter set Ion sterilization unit anti fungus agent containing inside Wheels bottom 4 Water level window Front louver Rear louver Front panel Front indication P 12 Power cord Power plug Handle right and left Humidity sensor Odor sensor Air...

Страница 11: ... έη ϣ έί ϭϬϟ ϖϓΩΗ έη ϣ έί ϝϳϐηΗϟ ϑΎϘϳ ϝϳϐηΗϟ έί Γ ΎοϹ αΟϣ ΕϼΟόϟ 4 ϝϔγϷ ϭϬϟ ΝέΧϣ nanoe ϕϼρ ΝέΧϣ ϥ ίΧϟ ΝέΩϟ ϝΧ ΩϟΎΑ Δϣ ϭϋ ηέϣ ΔϋϭϣΟϣ ΏϳρέΗϟ ΔϳϧϭϳϷ ϡϳϘόΗϟ ΓΩΣϭ ΓΩΎϣϟ ϰϠϋ ϱϭΗΣΗ ϲΗϟ ΕΎϳέρϔϠϟ ΓΩΎοϣϟ ϝΧ ΩϟΎΑ ϩΎϳϣϟ ϯϭΗγϣ ΓΫϓΎϧ ΔϳϣΎϣϷ ΔϳϭϬΗϟ ΔΣΗϓ ΔϳϔϠΧϟ ΔϳϭϬΗϟ ΔΣΗϓ ΔϳϣΎϣϷ ΔΣϭϠϟ ΔϳϣΎϣϷ ΓέΎηϹ 13 ι ΎΑέϬϛϟ ϙϠγ ϲ ΎΑέϬϛϟ αΑΎϘϟ νΑϘϣϟ έγϳ ϭ ϥϣϳ ΔΑϭρέϟ αΟϣ ϭέϟ αΟϣ ϭϬϟ ϝΧΩϣ ϥϳΑϧΎΟϟ ϰϠϋ ϭϬϟ ϝΧΩϣ ϲϣΎϣ ϡϛΣΗϟ ΔΣϭϟ έΎΑϐϟ...

Страница 12: ...cation is set a beeping notification sound is emitted and the Water supply indicator blinks ĺFill the tank with water P 16 Ɣ When the water supply indicator is blinking the product operates without any humidification ŶCheck indicator ƔWhen the abnormality occurs in the products the indicator is lit ĺWhen the indicator is lit P 48 ŶHumidity indicator The indicators are lit even when operation is st...

Страница 13: ...Ϸ ϡΟΣ ϥϋ έΎρΧϹΎΑ ϑϳυϧΗϟ Δϣϼϋ ϡϭϘΗ ΓέοΎΣϟ ΔΑέΗϷ ωϭϧ ϰϟ Δϣϼϋ Q8 43 ι αΟϣϟ ΔϳγΎγΣ έϳϳϐΗ ϥϛϣϳ Ŷ ϑϳυϧΗϟ Δϣϼϋ Ύ ϔϳυϧ ϭϬϟ ϥ ϰϟ έϳηϳ ϕέίϷ ΦγΗϣ ϭϬϟ ϥ ϰϟ έϳηϳ 1 āέϣΣ ϝϳϠϗ ΦγΗϣ ϭϬϟ ϥ ϰϟ έϳηϳ 3 āέϣΣ Ŷ ΔϳϠϣέϟ ΔϔλΎόϟ έη ϣ ϲϠϣέ έΎΑϏ ϥϋ ϑηϛϟ Ωϧϋ ϲοϳ Ŷ ϥΎΧΩϟ έη ϣ ϥΎΧΩ ϥϋ ϑηϛϟ Ωϧϋ ϲοϳ Ŷ ΔΣ έϟ έη ϣ ϭέ ϥϋ ϑηϛϟ Ωϧϋ ϲοϳ ϥϭϠϟΎΑ ΎϫΩΣϭ ϑϳυϧΗϟ Δϣϼϋ ϝϣόΗ Ωϗ ˬΓΩϭΟϭϣϟ ΔΑέΗϷ ωϭϧ ΏγΣ ϰϠϋ έΧ έη ϣ ϱ ϝϳϐηΗ ϥϭΩΑ έϣΣϷ ίΟϷ ϑϳέόΗ Ŷ 5 ...

Страница 14: ...all the deodorizing filter It can be installed in any direction Deodorizing filter Install the nanofiber HEPA filter Install in the correct direction nanofiber HEPA filter Product groove With the front side towards yourself setting the side with label FRONT SIDE to the right fit into the groove of the product 1 Write down the installation date in the label Replacement nano fiber HEPA filter Part N...

Страница 15: ...ηέϣϟ ΏϳϛέΗΑ ϡϗ ΔϳϣΎϣϷ ΔΣϭϠϟ ϭ ϭέϟ Δϟ ί ηέϣ ΏϳϛέΗΑ ϡϗ ϩΎΟΗ ϱ ϲϓ ϪΑϳϛέΗ ϥϛϣϳ ϭέϟ Δϟ ί ηέϣ ϡϗ ϭϧΎϧϟ ϑΎϳϟ ϥϣ HEPA ηέϣ ΏϳϛέΗΑ ϡϗ ϳΣλϟ ϩΎΟΗϻ ϲϓ ΏϳϛέΗϟΎΑ HEPA ηέϣ ϭϧΎϧϟ ϑΎϳϟ ϥϣ ϑϳϭΟΗ ΞΗϧϣϟ ϱΫϟ ΏϧΎΟϟ ρΑο ϙϭΣϧ ϲϣΎϣϷ ΏϧΎΟϟ ϝόΟ ϊϣ ϡϗ ˬ ϥϳϣϳϟ ϰϟ FRONT SIDE ϖλϠϣ ϝϣΣϳ ΞΗϧϣϟ ΩϭΩΧ ϲϓ ϪΑϳϛέΗΑ 1 ϰϠϋ ΏϳϛέΗϟ ΦϳέΎΗ ΏΗϛ ϖλϠϣϟ Replacement nano fiber HEPA filter Part No F ZXLP95Z Date installed Replacement deodorizing fi...

Страница 16: ...k Fill with water The tank can be supported using the tank stand Rotate the tank stand Guide of full capacity Firmly tighten the cap Ɣ Hold the tank firmly to prevent it from toppling over Return the tank to the product Press until the tank makes a clicking sound ŶBe sure to use the tap water This is because tap water is normally chlorine disinfected to prevent breeding of bacteria ƔDo not use the...

Страница 17: ...Χϟ ΏϠϗ ϥ ίΧϟ ΓΩΎϋ ϩΎϳϣϟΎΑ ϩϸϣ ϥ ίΧϟ ΔϟΎϣΣ ϡ ΩΧΗγΎΑ ϥ ίΧϟ Ωϧγ ϥϛϣϳ ϥ ίΧϟ ΔϟΎϣΣ Γέ ΩΈΑ ϡϗ Δόγϟ έη ϣ ΔϠϣΎϛϟ ϡΎϛΣΈΑ Ύρϐϟ ρΑέ Ɣ ϥϣ Ϫόϧϣϟ ϡΎϛΣΈΑ ϥ ίΧϟ ϙγϣ ρϭϘγϟ ΞΗϧϣϟ ϰϟ ϥ ίΧϟ ΓΩΎϋΈΑ ϡϗ ϥ ίΧϟ ϰϠϋ ρϐο Εϭλ ϊϣγΗ ϰΗΣ ΔϘρϘρ Ŷ έϭΑϧλϟ ϩΎϳϣ ϡ ΩΧΗγ ϥϣ Ωϛ Η ϊϧϣϟ έϭϠϛϟΎΑ ΓέϬρϣ ΓΩΎόϟ ϲϓ ϥϭϛΗ έϭΑϧλϟ ϩΎϳϣ ϥϷ ϙϟΫϭ ΎϳέϳΗϛΑϟ ΝΎΗϧ Ɣ ΔϳϟΎΗϟ ϩΎϳϣϟ ω ϭϧ ϡΩΧΗγΗ ϻ Ɣ ϭ Δϳϭ ϣ ΔΟέΩ 40 ΎϬΗέ έΣ ΔΟέΩ ώϠΑΗ ϲΗϟ Δ ϓ Ωϟ ϩΎϳϣϟ ϑυϧϣ ϰϠϋ ...

Страница 18: ...sly turned off ƔHumidification does not operate if there is no water Water supply indicator is blinking To enable humidification fill the tank with water If humidification is not required set Humidification to OFF Humidification indicator is turned off When there is no water in the tank or Humidification is set to OFF the product will operate in clean air mode 2 Selecting operating settings Set hu...

Страница 19: ...ϋϹ αϔϧ ϡ ΩΧΗγΎΑ ϝϣόϟ ϑϧ Ηγϳγ ϪϠϳϐηΗ ϑΎϘϳ Ɣ ϩΎϳϣ ϙΎϧϫ ϥϛϳ ϡϟ Ϋ ΏϳρέΗϟ ϝϣόϳ ϻ ϩΎϳϣϟ ϥϭίΧϣ έη ϣ νϣϭϳ ϰϟ ΏϳρέΗϟ ϥϳϳόΗΑ ϡϘϓ ˬΎ ΑϭϠρϣ ΏϳρέΗϟ ϥϛϳ ϡϟ Ϋ ϩΎϳϣϟΎΑ ϥ ίΧϟ ϸϣ ˬΏϳρέΗϟ ϥϳϛϣΗϟ ϲϓ ϭ ϥ ίΧϟ ϲϓ ϩΎϳϣ ϙΎϧϫ ϥϭϛΗ ϻ ΎϣΩϧϋ ϝϳϐηΗϟ ϑΎϘϳ Ωϳϗ ΏϳρέΗϟ έη ϣ ϑΎϘϳϹ ϑϳυϧϟ ϭϬϟ ρϣϧ ϲϓ ΞΗϧϣϟ ϝϣόϳγ ˬϑΎϘϳϹ ϰϟ ΏϳρέΗϟ ϥϳϳόΗ ΔϟΎΣ 2 ϝϳϐηΗϟ Ε Ω Ωϋ ΩϳΩΣΗ 21 ι ΏϳρέΗϟ ϥϳϳόΗΑ ϡϗ 23 ι ϭϬϟ Δϳϣϛ ϥϳϳόΗΑ ϡϗ 23 ι ϭϬϟ ϖϓΩΗ ϥϳϳόΗΑ ϡϗ ϝϳϐη...

Страница 20: ...umidification at low humidity levels Beep ŶTo cancel Press until the indicator turns off 1 If Air volume is set to Lo Med or Hi or if the product is operating with the Timer set to 8 hours sleep each press of switches between Med and OFF KHQ 6DQGVWRUP LV RSHUDWHG HDFK SUHVV RI switches between Med and OFF Note ƔWhen the Water supply indicator is blinking there is no water in the tank so fill the t...

Страница 21: ...ϲϓ ΏϳρέΗϟ ϡ ΩΧΗγ ΓέΎϔλ Ŷ ΎϐϟϺϟ ϰϠϋ ρϐο ϥϋ έη ϣϟ ϑϗϭΗϳ ϰΗΣ ϝϳϐηΗϟ ϰϟ Εϗ ϣϟ ϥϳϳόΗ ϊϣ ϝϣόϳ ΞΗϧϣϟ ϥΎϛ Ϋ ϭ ˬ Hi ϭ Med ϭ Lo ϰϟ ϭϬϟ Δϳϣϛ ϥϳϳόΗ ϡΗ Ϋ 1 ϝϳϐηΗϟ ϑΎϘϳ ϭ Med ϥϳΑ ϝϳΩΑΗϟ ϰϟ ϰϠϋ Δρϐο ϝϛ ϱΩ Ηγϓ ˬ 8 hours sleep ϑΎϘϳ ϭ Med ϥϳΑ ϝϳΩΑΗϟ ϰϟ ϰϠϋ Δρϐο ϝϛ ϱΩ Η ˬ ΔϳϠϣέϟ ΔϔλΎόϟ ϊοϭ ϝϣϋ Ωϧϋ 2 ϝϳϐηΗϟ ΔυΣϼϣ Ɣ ϩΎϳϣϟΎΑ ϥ ίΧϟ ϸϣ Ϋϟ ˬϥ ίΧϟ ϲϓ ϩΎϳϣ ΩΟϭΗ ϻ Ϫϧ ϲϧόϳ ΫϬϓ ˬ ϩΎϳϣϟ ϥϭίΧϣ έη ϣ νϣϭϳ ΎϣΩϧϋ Ɣ ϑΎϘϳ ϰϟ ΏϳρέΗϟ ϥϳ...

Страница 22: ...ration P 40 ƔIf Humidification is set to Hi or Lo setting the Air volume to Lo Med or Hi switches the Humidification setting to Med See P 20 1 of Set humidification Air volume Airflow Change the airflow Changing the airflow depending on type of dirt ƔEach level of airflow is generated by movement of the front panel and the louver P 38 Each press of the button will switch the air volume setting The...

Страница 23: ...ϳϣϛ Ω Ωϋ έϳϐΗϳ Ɣ έυϧ Med ϰϟ ΏϳρέΗϟ Ω Ωϋ έϳϳϐΗ ϰϟ Hi ϭ Med ϭ Lo ϰϠϋ ϭϬϟ Δϳϣϛ Ω Ωϋ ϱΩ ϳγϓ ˬ Lo ϭ Hi ϰϟ ΏϳρέΗϟ ϥϳϳόΗ ϡΗ Ϋ ΏϳρέΗϟ ϥϳϳόΗ ϥϣ 1 21 ι ϭϬϟ ϖϓΩΗ ϭϬϟ Δϳϣϛ ϭϬϟ ϖϓΩΗ έϳϳϐΗ ΔΑέΗϷ ωϭϧ ϰϠϋ ϭϬϟ ϖϓΩΗ έϳϳϐΗ ΩϣΗόϳ Ɣ 39 ι ΔϳϭϬΗϟ ΔΣΗϓϭ ΔϳϣΎϣϷ ΔΣϭϠϟ ΔϛέΣ Δργ ϭΑ ϭϬϟ ϖϓΩΗ ϥϣ ϯϭΗγϣ ϝϛ Ι ΩΣΗγ ϡΗϳ ϭϬϟ Δϳϣϛ Ω Ωϋ έϳϳϐΗ ϡΗϳ έίϟ ϰϠϋ Δρϐο ϝϛΑ ϲοϣ έη ϣϟ Auto Ύ ϳ ΎϘϠΗ ϭϬϟ ϖϓΩΗ έϳϳϐΗ Odor ϯέΧϷ ΔΑέΗϷ ϭ έ ΎΟγϟ ϥΎΧΩϭ ϭέ...

Страница 24: ...ator turns half on ŶTo cancel Press the until it is released The indicator is turned off Note ƔIf the 8 hour timer Sleep mode has been set the operating mode cannot be changed Operate in Sandstorm mode The indicator is lit Intensively removing sand dust This mode heightens the sensitivity of the sensor and operates automatically using a powerful air volume ŶTo cancel Press again The indicator is t...

Страница 25: ...ϭ ˬ Lo ΔΣϭϟ έη ϣ ϑλϧ ϝϳϐηΗ ϡΗϳϭ ΔϳϣΎϣϷ ϡϛΣΗϟ Ŷ ΎϐϟϺϟ ϝϳϐηΗ ϑΎϘϳ ϡΗ ϩέϳέΣΗ ϡΗϳ ϰΗΣ ϰϠϋ ρϐο έη ϣϟ ΔυΣϼϣ Ɣ ϊοϭ έϳϳϐΗ έΫόΗϳ ˬ ϡϭϧϟ ϊοϭ ΕΎϋΎγ 8 ϰϠϋ Εϗ ϣϟ ϥϳϳόΗ ϡΗ Ϋ ϝϳϐηΗϟ ΔϳϠϣέϟ ΔϔλΎόϟ ρϣϧ ϲϓ ϝϳϐηΗϟ ϲοϣ έη ϣϟ ΔϳϟΎϋ ΔϓΎΛϛΑ ϲϠϣέϟ έΎΑϐϟ Δϟ ί Δϳϭϗ ϭϫ Δϳϣϛ ϡ ΩΧΗγΎΑ Ύ ϳ ΎϘϠΗ ϝϣόϳϭ αΟϣϟ ΔϳγΎγΣ ϥϣ ϊοϭϟ Ϋϫ ϊϓέϳ Ŷ ΎϐϟϺϟ ϝϳϐηΗϟ ϑΎϘϳ ϊοϭ ϲϓ έη ϣϟ ϯέΧ Γέϣ ϰϠϋ ρϐο ΔυΣϼϣ Ɣ ϥϳϳόΗ ϥϣ 2 21 ι έυϧ Med ϰϟ ΏϳρέΗϟ Ω Ωϋ ϝϳΩΑ...

Страница 26: ...roduct operates in Cleaning mode approximately 60 minutes The air volume operates with Air volume set to Hi ƔAfter Cleaning mode is complete the product switches operation to clean air mode automatic air volume and airflow If dust is detected during clean air mode the product operates in Cleaning mode again ƔThe product returns to the operating mode before Absence cleaning mode Leave the room Ente...

Страница 27: ...οΣΗϟ ϊοϭ έϣΗγϳ Ɣ Ύ ΑϳέϘΗ ΔϘϳϗΩ 60 ϑϳυϧΗϟ ϊοϭ ϲϓ ΞΗϧϣϟ ϝϳϐηΗ ϡΗϳ ˬ έϳοΣΗϟ ϊοϭ ϝΎϣΗϛ ΩόΑ Hi ϰϟ ϭϬϟ Δϳϣϛ ϥϳϳόΗΑ ϭϬϟ Δϳϣϛ ϝϣόΗ Ɣ ϭϬϟ Δϳϣϛ ϑϳυϧϟ ϭϬϟ ϊοϭ ϰϟ ϝϳϐηΗϟ ϝϳΩΑΗΑ ΞΗϧϣϟ ϡϭϘϳ ˬ ϑϳυϧΗϟ ϊοϭ ϝΎϣΗϛ ΩόΑ ϡΗϳ ˬϑϳυϧϟ ϭϬϟ ϊοϭ ϲϓ ϝϳϐηΗϟ ΎϧΛ έΎΑϏ ϥϋ ϑηϛϟ ϡΗ Ϋ ϲ ΎϘϠΗϟ ϭϬϟ ϖϓΩΗϭ ϯέΧ Γέϣ ϑϳυϧΗϟ ϊοϭ ϲϓ ΞΗϧϣϟ ϝϳϐηΗ Ɣ ΏΎϳϏ ϲϓ ϑϳυϧΗϟ ϊοϭ ϝΑϗ ϝϳϐηΗϟ ϊοϭ ϰϟ ΞΗϧϣϟ Ωϭόϳ ιΎΧηϷ ΓέΩΎϐϣ Δϓέϐϟ ϝϭΧΩ Δϓέϐϟ Clothes ΔυΣϼϣ Ɣ na...

Страница 28: ...pletely in the shade Otherwise fungus may occur Cover the product with poly bag and keep in dry places Do not keep it laid down or upside down otherwise failure may occur 28 Before cleaning ŶBe sure to disconnect the power plug ƔDo not use the detergents or other substances on the right ƔWhen using chemically treated cloth follow its instructions Care and maintenance Dirt sensor about once every 3...

Страница 29: ... ϝϛηΑ ΏϳρέΗϟ ηέϣ ϑϳϔΟΗΑ ϡϗ ΕΎϳέρϔϟ ϑΎΟ ϥΎϛϣ ϲϓ ϪυϔΣ ϭ ˬϲϟϭΑ αϳϛΑ ΞΗϧϣϟ ΔϳρϐΗΑ ϡϗ ϝρϋ ΙΩΣϳ Ωϗ ϻ ϭ ΏϭϠϘϣ ϭ ϲϘϠΗγϣ ϊοϭ ϲϓ ϪυϔΣΗ ϻ 29 VXL95M Care and maintenance ΔϧΎϳλϟ ϭ ΔϳΎϋέϟ ϑϳυϧΗϟ ϝΑϗ Ŷ ϲ ΎΑέϬϛϟ αΑΎϘϟ ϝλϓ ϥϣ Ωϛ Η Ɣ ϥϣ ϯέΧ Ω ϭϣ ϭ ΕΎϔυϧϣϟ ϡΩΧΗγΗ ϻ ϥϳϣϳϟ ϰϠϋ ΔΣοϭϣϟ Ɣ ϊΑΗ ˬΎ ϳϭΎϣϳϛ ΔΟϟΎόϣϟ ΔηϣϗϷ ϡ ΩΧΗγ Ωϧϋ ΎϬΗΎϣϳϠόΗ ΔϧΎϳλϟ ϭ ΔϳΎϋέϟ έΎΑϐϟ αΟϣ έϭϬη 3 ϝϛ Γέϣ ϲϟ ϭΣ ΔΣγϣϣ ϡ ΩΧΗγΎΑ ΔγΩόϟ ϰϠϋ ϥϣ έΎΑϐϟ γϣ Δϓ...

Страница 30: ... ƔInstall it into the tray groove so that it is level Note ƔThe ion sterilization unit anti fungus agent containing may have powder This is normal and it performs without problem ƔThe anti fungus agent will become smaller over time This is normal and it performs without problem ƔThe anti fungus agent has a peculiar smell It is not harmful Remove the ion sterilization unit anti fungus agent contain...

Страница 31: ...ϟ ΓΩΣϭ ϙΣΑ ϡϘΗ ϻ ΎϬϛϛϔΗ ϭ ΓΎηέϔϟΎΑ ΕΎϳέρϔϠϟ Ɣ Ύ ϳϭΎγΗϣ Αλϳ ϰΗΣ ΝέΩϟ ϑϳϭΟΗΑ ϪΑϳϛέΗΑ ϡϗ ΔυΣϼϣ Ɣ ΓΩΎοϣϟ ΓΩΎϣϟ ϰϠϋ ϱϭΗΣΗ ϲΗϟ ΔϳϧϭϳϷ ϡϳϘόΗϟ ΓΩΣϭ ϱϭΗΣΗ Ωϗ ΔϠϛηϣ ϥϭΩΑ ϝϣόΗγϭ ϱΩΎϳΗϋ έϣ Ϋϫϭ ϕϭΣγϣ ϰϠϋ ΕΎϳέρϔϠϟ Ɣ Εϗϭϟ έϭέϣ ϊϣ έϐλ ΕΎϳέρϔϠϟ ΓΩΎοϣϟ ΓΩΎϣϟ ΑλΗγ ΔϠϛηϣ ϥϭΩΑ ϝϣόϳγϭ ϱΩΎϳΗϋ έϣ Ϋϫϭ Ɣ ΓέΎο έϳϏ ΎϬϧϛϟ ΔΑϳέϏ ΔΣ έΑ ΕΎϳέρϔϠϟ ΓΩΎοϣϟ ΓΩΎϣϟ ϊΗϣΗΗ ϡϳϘόΗϟ ΓΩΣϭ Δϟ ίΈΑ ϡϗ ΓΩΎϣϟ ϱϭΗΣΗ ϲΗϟ ΔϳϧϭϳϷ ΎϬϠγϏ ϭ ˬ ΕΎϳέρϔϠϟ Γ...

Страница 32: ...ter holding frame Humidifying filter set about once a month 1 When operated for 8 hours per day To remove the stubborn stains Insert the humidifying filter into the filter frame The humidifying filter does not have a front rear ƔEnsure that the humidifying filter does not protrude from the filter frame or become wrinkled Failure to do so may reduce the amount of humidification Align the filter hol...

Страница 33: ...ϰϠϋ Ɣ ΔϠΑΎϗ ΔϣΎϣϘϛ ϡΩΧΗγϣϟ ηέϣϟ ϥϣ ιϠΧΗ ϝΎόΗηϼϟ ϝϣΣ έΎρ ϭ ηέϣϟ έΎρ ϥϣ ιϠΧΗΗ ϻ ηέϣϟ 1 Ύ ϳέϬη Γέϣ ϲϟ ϭΣ ΏϳρέΗϟ ηέϣ ΔϋϭϣΟϣ ϡϭϳϟ ϲϓ ΕΎϋΎγ 8 ΓΩϣϟ ϝϳϐηΗϟ Ωϧϋ ΔϳλόΗγϣϟ ϊϘΑϟ Δϟ ίϹ ηέϣϟ έΎρ ϲϓ ΏϳρέΗϟ ηέϣ ϝΎΧΩΈΑ ϡϗ ϲϔϠΧ ίΟ ΔϣΩϘϣ ΏϳρέΗϟ ηέϣΑ ΩΟϭϳ ϻ Ɣ ΩόΟϣ Αλϳ ϭ ηέϣϟ έΎρ ϥϣ ΗϧϠϟ ΏϳρέΗϟ ηέϣ νέόΗϳ ϻ ϰϠϋ ιέΣ ΏϳρέΗϟ έ ΩϘϣ ϝϳϠϘΗ ϰϟ ϙϟΫΑ ϡΎϳϘϟ έΫόΗ ϱΩ ϳ Ωϗ ΔγϣΧϟ ΔϧγϟϷ ϝϛ ϙΑη ϭ ˬ ηέϣϟ έΎρ ϊϣ έΎρϹ ϝϣΣϳ ϱΫϟ ηέϣϟ Γ ΫΎΣ...

Страница 34: ...ake care to ensure that the front and rear louvers are installed correctly When the floater comes off Floater installation 1 Insert the lug of the floater into the hole of the tray 2 While pressing in the direction of the arrow Insert into the hole on the other side of the tray Twist the louver to align it shape lug hole Rear louver Front louver shape lug Floater Insert under this tab Tab Hole Lug...

Страница 35: ...ΔΣΗϓ ϝΎΧΩΈΑ ϡϗ ΔϘϳέρϟ ΔϳϭϬΗϟ ΔΣΗϓ ϝΎλϔϧ ΔϟΎΣ ϲϓ ϳΣλ ϝϛηΑ ΔϳϔϠΧϟ ϭ ΔϳϣΎϣϷ ΔϳϭϬΗϟ ϲΗΣΗϓ ΏϳϛέΗ ϥΎϣοϟ έΫΣϟ ΥϭΗ Δϣ ϭόϟ ϝΎλϔϧ ΔϟΎΣ ϲϓ Δϣ ϭόϟ ΏϳϛέΗ 1 ΝέΩϟ ΏϘΛΑ Δϣ ϭόϟ ϲϏέΑ ϝΧΩ 2 ˬϡϬγϟ ϩΎΟΗ ϲϓ ρϐοϟ ϊϣ ΝέΩϟ ϥϣ έΧϵ ΏϧΎΟϟ ϰϠϋ ΩϭΟϭϣϟ ΏϘΛϟ ϲϓ ΎϬϠΧΩ ΔϳϭϬΗϟ ΔΣΗϓ ϑϟ ΎϬΗ ΫΎΣϣϟ ϝϛη ΫΧ ϳ ϲϏέΑ ΏϘΛϟ ΔϳϔϠΧϟ ΔϳϭϬΗϟ ΔΣΗϓ Δϣ ϭϋ ϥΎγϠϟ Ϋϫ ϝϔγ ΎϬϠΧΩ ϥΎγϠϟ ΏϘΛϟ ϲϏέΑϟ ϲϏέΑϟ ΏϘΛϟ ΔϳϣΎϣϷ ΔϳϭϬΗϟ ΔΣΗϓ ϝϛη ΫΧ ϳ ϲϏέΑ ΏϘΛϟ VXL95M_EN ...

Страница 36: ... achieved Furthermore it creates an atmosphere for beautiful moisturized skin 1 Adhering bacteria ƔTesting trustee Japan Food Research Laboratories ƔTest method Suspend bacteria in the test chamber of 23 m3 and measure the bacteria count adhered to a cloth ƔInhibiting method Emitting nanoe ƔTarget bacteria that was ingrained in standard cloth ƔTest outcome inhibited 99 and above in 8 hours No 1304...

Страница 37: ...ϟ Δϟ ί ϭ ΔϘλΗϠϣϟ ΎϳέϳΗϛΑϟ 1 Ɣ ΔϳϧΎΑΎϳϟ ΔϳΫϏϷ ΙϭΣΑ Ε έΑΗΧϣ έΎΑΗΧϻ ϰϠϋ Δϳλϭϟ ΔϬΟϟ Ɣ ΔΣΎγϣΑ έΎΑΗΧ ΔϓέϏ ϲϓ ΎϳέϳΗϛΑϟ ϰϠϋ ϲοϘϳ έΎΑΗΧϻ ΔϘϳέρ ΎϳέϳΗϛΑϟ ΩΩϋ αΎϳϘΑ ϡϭϘϳϭ Ώόϛϣ έΗϣ 23 αΑϼϣϟΎΑ ΔϘλΗϠϣϟ Ɣ nanoe ϟ έ Ωλ ρϳΑΛΗϟ ΔϘϳέρ Ɣ ΔϳγΎϳϗ αΑϼϣ Δόρϗ ϲϓ ΔΧγ έ ΕϧΎϛ ϲΗϟ ΎϳέϳΗϛΑϟ ϑΩϬϟ Ɣ ΕΎϋΎγ 8 ϲϓ έΛϛ ϭ 99 ρϳΑΛΗΑ ΕϣΎϗ έΎΑΗΧϻ ΔΟϳΗϧ 13044083003 01 ϡϗέ ϥϣ ρϘϓ ΩΣ ϭ ωϭϧ ϰϠϋ έΎΑΗΧϻ έΟ ϡΗ ΎϳέϳΗϛΑϟ 2 Ɣ ϙϳϧϭγΎϧΎΑ Δϛέηϟ ϊΑΎΗϟ ...

Страница 38: ... and front panel Air cleanliness Clean sign Louver movement A to D in right image Front panel Clean Blue A It swings slowly Closed Odors or smoke detected Red B Opens frontward House dust detected C Bottom opens frontward Odors or smoke and house dust detected D ƔWhen the air in the room is clean the product may remain in standby mode with the louvers closed Mode Louver movement A C in right image...

Страница 39: ... ϭϬϟ ΔϓΎυϧ Δϣϼϋ ϑϳυϧΗϟ ΔϳϭϬΗϟ ΔΣΗϓ ΔϛέΣ ϲϓ D ϰϟ A ϥϣ ϥϳϣϳϟ ϰϠϋ ΓΩϭΟϭϣϟ Γέϭλϟ ΔϳϣΎϣϷ ΔΣϭϠϟ ϑϳυϧ Ύϗέί A Δ ϳρΑ ΓΩέρϣ ΔϛέΣΑ ϡϭϘΗ ΔϘϠϐϣ ϭ ϭέ ϥϋ ϑηϛϟ ϡΗ ϥΎΧΩ έϣΣ B ϡΎϣϷ ϰϟ ΗϔΗ ϲϟίϧϣ έΎΑϏ ϥϋ ϑηϛϟ ϡΗ C ίΟϟ Ηϔϳ ϭΣϧ ϲϠϔγϟ ϡΎϣϷ ϥΎΧΩ ϭ ϭέ ϥϋ ϑηϛϟ ϡΗ ϲϟίϧϣ έΎΑϏϭ D Ɣ ρϣϧ ϲϓ ΞΗϧϣϟ ϰϘΑϳ Ωϗ ˬΎ ϔϳυϧ Δϓέϐϟ ϲϓ ΩϭΟϭϣϟ ϭϬϟ ϥϭϛϳ ΎϣΩϧϋ ΔϳϭϬΗϟ ϲΗΣΗϓ ϖϠϏ ϊϣ Ω ΩόΗγϻ ϊοϭϟ ΔϳϭϬΗϟ ΔΣΗϓ ΔϛέΣ Γέϭλϟ ϲϓ C ˬ A ϥϳϣϳϟ ϰϠϋ ΓΩϭΟϭϣϟ Δϳϣ...

Страница 40: ...on Testing trustee Japan Food Research Laboratories Test method Verify with the standard agar plate culture method using standard method agar Sterilization method Contact with ion sterilization unit Target Water in tray with ion sterilization unit deployed Test outcome 99 or more suppression in 24 hours No 15059465001 0101 Test performed using two types of microorganism Anti fungus Testing trustee...

Страница 41: ...ϳϘόΗϟ ΔϳγΎϳϘϟ έΎϏ ΔϘϳέρ ϡ ΩΧΗγΎΑ ϲγΎϳϗ έΎϏ ΎϋϭΑ Δϋέίϣ ΔϘϳέρΑ ϖϘΣΗϟ έΎΑΗΧϻ ΔϘϳέρ ΔϳϧΎΑΎϳϟ ΔϳΫϏϷ ΙϭΣΑ Ε έΑΗΧϣ έΎΑΗΧϻ ϰϠϋ Δϳλϭϟ ΔϬΟϟ ΔϋΎγ 24 ϲϓ Δϟ ίϹ ϥϣ έΛϛ ϭ 99 έΎΑΗΧϻ ΔΟϳΗϧ Δϳϧϭϳ ϡϳϘόΗ ΓΩΣϭ έηϧ ϊϣ ΝέΩϟ ϲϓ ϩΎϳϣϟ ϑΩϬϟ Δϳϧϭϳ ϡϳϘόΗ ΓΩΣϭ ϊϣ Δγϣϼϣϟ ϡϳϘόΗϟ ΏϭϠγ ΕΎΑϭέϛϳϣϟ ϥϣ ϥϳϋϭϧ ϡ ΩΧΗγΎΑ έΎΑΗΧϻ έΟ ϡΗ 15059465001 0101 ϡϗέ ΕΎϳέρϔϠϟ ΓΩΎοϣϟ Halo ΔϘϳέρ ΔϳΑ έΗϟ ΎϳέϳΗϛΑϟ ϊϧϣϟ ΔλλΧϣϟ ΔϘϳέρϟ ϥϣ ϖϘΣΗ έΎΑΗΧϻ ΔϘϳέρ ...

Страница 42: ...en if the humidity in the room is moderate there may be dew condensation on a cold window or wall Q8 The clean sign does not change The front panel remains open Change the sensitivity of the sensor A ƔSuch problems are likely to occur when the sensitivity of the sensor is low high You can change the sensitivity as you want The initial setting is Medium Stop operation then press and hold and simult...

Страница 43: ...ϰϠϋ ϯΩϧ ϑϳΛϛΗ ΩΟϭϳ A Ɣ νόΑ ϙΎϧϫ ϥϭϛϳ ΩϘϓ ˬΔϟΩΗόϣ Δϓέϐϟ ΔΑϭρέ ΕϧΎϛ Ϋ ϰΗΣ έ ΩΟϟ ϭ ΓΩέΎΑϟ ΓΫϓΎϧϟ ϰϠϋ ϯΩϧϟ ϑϳΛϛΗ Q8 ˮέϳϐΗΗ ϻ ϑϳυϧΗϟ Δϣϼϋ ˮΔΣϭΗϔϣ ϰϘΑΗ ΔϳϣΎϣϷ ΔΣϭϠϟ αΟϣϟ ΔϳγΎγΣ έϳϳϐΗΑ ϡϗ A Ɣ ΔϳγΎγΣ ϥϭϛΗ ΎϣΩϧϋ ΟέϷ ϰϠϋ ϝϛΎηϣϟ ϩΫϫ ϝΛϣ ΙΩΣΗ ΔόϔΗέϣ ΔοϔΧϧϣ αΟϣϟ ΎϫΩϳέΗ ϲΗϟ ΔΟέΩϠϟ ΔϳγΎγΣϟ έϳϳϐΗ ϙϧϛϣϳ ργϭΗϣ ϥϭϛϳ ϲϟϭϷ Ω ΩϋϹ ϰϠϋ ϙϟΫ ΩόΑ ρϐο ϭ ˬϝϳϐηΗϟ ϑΎϘϳΈΑ ϡϗ έ έϣΗγϻ ϊϣ ϥϣ ίΗϣ ϝϛηΑ ϭ ϭϬϟ Δϳϣϛ Ε έη ϣ ϲοΗ ΎϫέϭΩΑϭ ϲ...

Страница 44: ...complete the product switches operation to clean air mode automatic air volume and airflow If dirt is detected the product operates in Cleaning mode again To end press to cancel Absence cleaning mode The product returns to the operating mode before Absence cleaning mode Q15 There is dust in the room even after running Absence cleaning mode A Ɣ Absence cleaning cleans dirt in the air and cannot rem...

Страница 45: ... ΑϳέϘΗ ΔϘϳϗΩ 60 ΓΩϣϟ ϑϳυϧΗϟ ϊοϭ ϭ ϑϳυϧϟ ϭϬϟ ϊοϭ ϰϟ ϝϳϐηΗϟ ϝϳΩΑΗΑ ΞΗϧϣϟ ϡϭϘϳ ˬ ϑϳυϧΗϟ ϲ ΎϘϠΗϟ ϭϬϟ ϖϓΩΗϭ ϭϬϟ Δϳϣϛ ϑϳυϧΗϟ ϊοϭ ϲϓ ΞΗϧϣϟ ϝϣόϳγϓ ˬΔΑέΗ ϥϋ ϑηϛϟ ϡΗ Ϋ ϯέΧ Γέϣ ΎϐϟϹ ϰϠϋ ρϐο ˬ ΎϬϧϺϟ ιΎΧηϷ ΏΎϳϏ ϲϓ ϑϳυϧΗϟ ϊοϭ ΏΎϳϏ ϲϓ ϑϳυϧΗϟ ϊοϭ ϝΑϗ ϝϳϐηΗϟ ϊοϭ ϰϟ ΞΗϧϣϟ Ωϭόϳ ιΎΧηϷ Q15 ϊοϭ ϝϳϐηΗ ΩόΑ ϰΗΣ Δϓέϐϟ ϲϓ έΎΑϏ ϙΎϧϫ ιΎΧηϷ ΏΎϳϏ ϲϓ ϑϳυϧΗϟ A Ɣ ΓΩϭΟϭϣϟ ΔΑέΗϷ ϑϳυϧΗΑ ιΎΧηϷ ΏΎϳϏ ϲϓ ϑϳυϧΗϟ ϡϭϘϳ ϰϠϋ ΩϭΟϭϣϟ έΎΑϐϟ ϥϣ ι...

Страница 46: ... the tank tray or the humidifying filter dirty P 30 32 ƔIs water in the tank replaced with fresh tap water every day P 8 ƔIf humidification is not required discard the water in the tank and tray ƔIf the product is used in a room where people smoke or barbecue a shorter replacement cycle of filters may be required P 28 ĺWhen the product is used in such environment we recommend that you use the vent...

Страница 47: ...ĸ 29 ι ϥϳΩϳΩΟ ϥϳΣηέϣΑ ΎϣϬϟ ΩΑΗγΎΑ ϡϘϓ ˬΩΟ ϭΗϟ ϲϓ νέόϟ έϣΗγ Ϋ ΎϣϬϔυϧ Ɣ 33 ˬ31 ι ˮϥϳΧγΗϣ ΏϳρέΗϟ ηέϣ ϭ ΝέΩϟ ϭ ϥ ίΧϟ ϝϫ Ɣ 9 ι ˮϡϭϳ ϝϛ έϭΑϧλϟ ϥϣ ΔΑΫϋ ϩΎϳϣΑ ΎϬϟ ΩΑΗγ ϡΗϳ ϥ ίΧϟ ϲϓ ΓΩϭΟϭϣϟ ϩΎϳϣϟ ϝϫ Ɣ ΝέΩϟ ϭ ϥ ίΧϟ ϲϓ ΓΩϭΟϭϣϟ ϩΎϳϣϟ ϥϣ ιϠΧΗ ˬΎ ΑϭϠρϣ ΏϳρέΗϟ ϥϛϳ ϡϟ ϭϟ ϰΗΣ Ɣ ΕΎΣηέϣϟ ϝ ΩΑΗγ ΓέϭΩ ϥϭϛΗ ΩϘϓ ˬ ϭη ϝϔΣ ϭ ϥϳϧΧΩϣ ΎϬΑ ΩΟϭϳ ΔϓέϏ ϲϓ ΞΗϧϣϟ ϡ ΩΧΗγ ϡΗϳ ϥΎϛ Ϋ 29 ι Δϳέϭέο έλϗϷ ĸ ϥϣ ίΗϣ ϝϛηΑ ΔϓέϐϠϟ ΔϳϭϬΗ ϡΎυϧ ϡ ...

Страница 48: ...ration Dry the interior of the product completely if water enters inside Reconnect and turn on the product ƔHas the product been shaken inclined or given impact ĺDisconnect and connect the power plug again ƔHave magnets metallic objects or similar objects been placed on the product ĺDisconnect and connect the power plug again The product does not operate ƔHas the filter replacement notification in...

Страница 49: ...ϟ ΓΩΎϋΈΑ ϡϗ ϪϠϳϐηΗ ϥϭΩΑ ϡϭϳ ϑλϧ ϥϣ έΛϛϷ ΞΗϧϣϟ ϙέΗ ϭ ϝΧ Ωϟ ϰϟ ϩΎϳϣϟ ΕϠΧΩ Ϋ ˬϝΧ Ωϟ ϥϣ ϝϣΎϛϟΎΑ ΞΗϧϣϟ ϑϳϔΟΗΑ ϡϗ ϪϠϳϐηΗϭ ΞΗϧϣϟ ϝϳλϭΗ ΓΩΎϋΈΑ ϡϗ Ɣ ˮΕΎϣΩλϟ ϭ ΔϟΎϣϹ ϭ ί ίΗϫϼϟ ΞΗϧϣϟ νέόΗ ϝϫ ĸ ϯέΧ Γέϣ ϪϠλϭϭ ϲ ΎΑέϬϛϟ αΑΎϘϟ ϝλϓ Ɣ ˮΞΗϧϣϟ ϰϠϋ ΔϬΑΎηϣ ϡΎγΟ ϭ ΔϳϧΩόϣ ϡΎγΟ ϭ ΔϳγϳρΎϧϐϣ έΎΟΣ ϊοϭ ϡΗ ϝϫ ĸ ϯέΧ Γέϣ ϪϠλϭϭ ϲ ΎΑέϬϛϟ αΑΎϘϟ ϝλϓ ϝϣόϳ ϻ ΞΗϧϣϟ Ɣ 13 ι ˮ ϲοϣ ηέϣϟ ϝ ΩΑΗγ έΎρΧ έη ϣ ϝϫ ΔϳϟΎΗϟ ΔϟΎΣϟ ϲϓ έϭϔϟ ϰϠϋ ωίϭϣϟΎΑ ...

Страница 50: ... amount may vary with the indoor temperature and humidity P 42 3 If there is water in the tray the product uses its water to humidify a little If you do not want to humidify empty the tank and tray 4 The applicable floor area refers to the floor area when the product is operating in Hi mode The area when operating in Clean air mode is in accordance with the Japan Electrical Manufacturers Associati...

Страница 51: ...ΟέΩ 20 Δϓέϐϟ Γέ έΣ ΔΟέΩ Ϫϳϓ ΕϐϠΑ ϑέυ ΕΣΗ ϩϼϋ ϝϭΩΟϟ ϲϓ ΓέϭϛΫϣϟ ΏϳρέΗϟ Δϳϣϛ έΎΑΗΧ ϡΗ 2 43 ι ΔΑϭρέϟ ϭ ΔϳϠΧ Ωϟ Γέ έΣϟ ΔΟέΩ ΏγΣ ϰϠϋ ΏϳρέΗϟ Δϳϣϛ ϑϠΗΧΗ Ωϗ ΝέΩϟ ϭ ϥ ίΧϟ ώϳέϔΗΑ ϡϘϓ ˬΏϳρέΗϟ ϲϓ ΏϏέΗ ϻ Εϧϛ Ϋ ϼϳϠϗ ΏϳρέΗϠϟ ϪΑ ΔλΎΧϟ ϩΎϳϣϟ ϡΩΧΗγϳ ΞΗϧϣϟΎϓ ˬΝέΩϟ ϲϓ ϩΎϳϣ ϙΎϧϫ ϥϛϳ ϡϟ Ϋ 3 έΎϳόϣ έϳϳΎόϣϟ Ύ Ϙϓϭ ΎϬϳϓ ϑϳυϧϟ ϭϬϟ ϊοϭ ϝϳϐηΗ ϡΗϳ ϲΗϟ ΔΣΎγϣϟ Hi ϊοϭϟ ϲϓ ΞΗϧϣϟ ϝϳϐηΗ ΎϬϳϓ ϥϛϣϳ ϲΗϟ ΔϳοέϷ ΔΣΎγϣ ϰϟ Δϳοέϸϟ Δϣ ϼϣϟ ΔΣΎγϣ...

Страница 52: ...ヱ ㄏ ㄔㄐㄏㄊ チヤㄐㄓㄑㄐㄓ ㄕㄊㄐㄏ Web Site http www panasonic com Panasonic Corporation 2015 XL95M8950 F0815I0 Printed in Japan ϥΎΑΎϳϟ ϲϓ ΔϋΎΑρϟ ΕϣΗ VXL95M_EN ARA indd 52 10 15 2015 5 47 49 PM ...

Отзывы: