background image

Printed in Japan    2014/4       QY-1120E/QY-1110U

addendum sheet

feuillet d’addenda / 

apéndice

 / 

Ergänzungsblatt / 

Aggiunta

 / 

addendumvel / 

tilläggsark

 / 

X]XSHáQLHQLH

ijȪȜȜȠʌĮȡĮȡIJȒȝĮIJȠȢ

English

Français

Deutsch

Español

INSTALLING THE MICROPHONE / 

INSTALLATION DE MICROPHONE

 / 

INSTALACIÓN DEL MICRÓFONO / 

INSTALLIEREN DES MIKROFON

‡ ([WHUQDOPLFURSKRQHKDVWREHFRQQHFWHGDWWKHEDFNRIWKHPDLQXQLWGXULQJLQVWDOODWLRQLIQHFHVVDU\

Note:

‡ 'RQRWOHDYHWKHPLFURSKRQHLQWKHSODFHVZLWKZLQGSDVVLQJVXFKDVDLURXWOHWRIWKHDLUFRQGLWLRQHUHWF7KLVPD\FDXVHD

PDOIXQFWLRQ,QDGGLWLRQLIOHDYHLWLQWKHSODFHVVXEMHFWHGWRGLUHFWVXQKLJKWHPSHUDWXUHFDQFDXVHGLVWRUWLRQGLVFRORUDWLRQZKLFKPD\
UHVXOWLQDPDOIXQFWLRQ

‡ /HPLFURSKRQHH[WHUQHGRLWrWUHFRQQHFWpDXGRVGHO¶DSSDUHLOSULQFLSDODXFRXUVGHO¶LQVWDOODWLRQVLQpFHVVDLUH

Remarque :

‡ 1HODLVVH]SDVOHPLFURSKRQHGDQVGHVOLHX[H[SRVpVDXYHQWWHOOVTXHODVRUWLHG¶DLUG¶XQFOLPDWLVHXUHWF&HODSHXWSURYRTXHUXQ

G\VIRQFWLRQQHPHQW(QRXWUHVLYRXVOHODLVVH]GDQVGHVOLHX[H[SRVpVGLUHFWHPHQWDXVROHLOXQHWHPSpUDWXUHpOHYpHSHXWSURYRTXHU
XQHGLVWRUVLRQRXXQHGpFRORUDWLRQSRXYDQWRFFDVLRQQHUXQG\VIRQFWLRQQHPHQW

‡ (OPLFUyIRQRH[WHUQRWLHQHTXHVHUFRQHFWDGRHQODSDUWHWUDVHUDGHODXQLGDGSULQFLSDOGXUDQWHODLQVWDODFLyQVLIXHUDQHFHVDULR

Nota:

‡ 1RGHMHHOPLFUyIRQRGHOHQOXJDUHVFRQFRUULHQWHVGHDLUHFRPRODVDOLGDGHODLUHDFRQGLFLRQDGRHWF3RGUtDFDXVDUXQPDO

IXQFLRQDPLHQWR$GHPiVVLGHMDHOPLFUyIRQRH[SXHVWRGLUHFWDPHQWHDODOX]GHOVROODVDOWDVWHPSHUDWXUDVSXHGHQFDXVDUGLVWRUVLyQ
\GHFRORUDFLyQTXHWDPELpQSXHGHQSURYRFDUHOPDOIXQFLRQDPLHQWRGHODSDUDWR

‡ 'DVH[WHUQH0LNURSKRQPXVVEHLGHU,QVWDOODWLRQJHJHEHQHQIDOOVDXIGHU5FNVDXSWJHUlWHVDQJHVFKORVVHQZHUGHQ

Hinweis:

‡ /DVVHQ6LHGDV0LNURIRQQLFKWDQ2UWHQZRHVHLQHP/XIW]XJDXVJHVHW]WLVWZLHHWZDHLQHU.OLPLHUEHLNDQQHV]XHLQHU

)HKOIXQNWLRQNRPPHQ/DVVHQ6LHHVDX‰HUGHPQLFKWDQ2UWHQPLWGLUHNWHU6RQQHQHLQVWUDKOXQJGHQQKRKH7HPSHUDWXUHQN|QQHQ]X
9HUIRUPXQJHQXQG9HUIlUEXQJHQIKUHQZDVZLHGHUXP]XHLQHU)HKOIXQNWLRQIKUHQNDQQ

0LFURSKRQH

0LFURSKRQH

 /

0LFUyIRQR

0LNURIRQ

9LVRU&OLS7\SH$

&OLSGH3DUHVROHLO7\SH$

 /

Clip Tipo A de Visor /

%OHQGHQ.OHPPH7\S$

0,&+ROGHU

6XSSRUW0,&

 /

3RUWD0,&

0,.+DOWHU

9LVRU&OLS7\SH%

&OLSGH3DUHVROHLO7\SH%

 /

Clip Tipo B de Visor /

%OHQGHQ.OHPPH7\S%

$WWDFKWKHPLFURSKRQHZLWKWKH0,&KROGHURUYLVRUFOLS

)L[H]OHPLFURSKRQHDYHFOHVXSSRUW0,&RXOHFOLSGHSDUHVROHLO

 /

$JUHJXHHOPLFUyIRQRFRQHOVRVWHQHGRU0,&RHOFOLSGHYLVHUD

6FKOLH‰HQ6LHGHQ0,.+DOWHURGHUGLH9LVLHU.OHPPHDQ

8VHWKHH[WHUQDOPLFURSKRQHZKHQXVLQJ,QWHOOLJHQW92,&(RU%OXHWRRWKKDQGVIUHH

8WLOLVH]OHPLFURSKRQHH[WHUQHORUVGHO¶XWLOLVDWLRQ,QWHOOLJHQW92,&RXPDLQVOLEUHV%OXHWRRWK

8WLOLFHHOPLFUyIRQRH[WHUQRFXDQGRVHXWLOL]D,QWHOOLJHQW92,&RPDQRVOLEUHV%OXHWRRWK

9HUZHQGHQ6LHGDVH[WHUQH0LNURIRQEHL,QWHOOLJHQW92,&(RGHU%OXHWRRWK)UHLVSUHFKDQODJH

Summary of Contents for NX604

Page 1: ...TATION WITH BUILT IN NAVIGATION 6 2 INCH TOUCH PANEL CONTROL MULTIMEDIA STATION 6 2 INCH TOUCH PANEL CONTROL STATION MULTIMEDIA DVD AVEC NAVIGATION INTEGREE ET COMMANDE PAR ECRAN TACTILE DE 6 2 POUCES STATION MULTIMEDIA ET COMMANDE PAR ECRAN TACTILE DE 6 2 POUCES ESTACIQN MULTIMEDIA DVD CON NAVEGACIQN INTEGRADA YCONTROL DE PANEL TACTIL DE 6 211 ESTACIQN MULTIMEDIA CON CONTROL DE PANEL TACTIL DE 6 ...

Page 2: ...arion Hay muchas ventajas al registrar su producto Le invitamos a que visite nuestro sitio en internet www clarion com para registrar su producto de Clarion Hemos hecho el registro de producto facil en nuestro sitio La forma de registro es corta yfacil de completar Una vez que Ia registre podremos proporcionarle Ia informacion de su producto Registrese en www clarion com es facil mantener su produ...

Page 3: ...FACTURE ThieproductincludeetechnologyownedbyMicr odtCorporltlonandcannot beusedordistributedwtthoutaOO OS fromMSLGP HD Radio T8Chnology manufactur d under license from iBiquity Digital Corporation U S and Foreign Pat rts HD RadioTM end the HO HO Radio and lvc Jogosarepropri t ytr dema kaofiBiguttyDisJit Corp Manufactured under ranae from Dofby l aboratoriel MDolb andthedouble Dsxmbo Wtr demarksofO...

Page 4: ...LC a subsidiary of Rovi Corporation This is an official DivX Certified device that has passed rigorous testing to verify that it plays DivX video Visit divx com for more information and software tools to convert your files into DivX videos ABOUT DIVX VIDEO ON DEMAND This DivX Certified device must be registered in order to play purchased DivX Video on Demand VOD movies To obtain your registration ...

Page 5: ...D card is inserted to enjoy data in microSD cards 6 The map microSD is housed in here To update the map open this cover and remove and insert the card Do not open the cover for other operations 7 This is where DVD video CD MP3 WMA and DivX discs are inserted This document uses the following inline graphics and conventions to indicate operations using the buttons on the operation panel Number lnlin...

Page 6: ...mote control sold separately 5 This is the Antitheft Indicator This light blinks when the Antitheft Activation setting is set to ON to indicate that the antitheft function is activated 4 NX604 FX503 This document uses the following inline graphics and conventions to indicate operations using the buttons on the operation panel Number lnline graphic Description of operation I MENU Short press This d...

Page 7: ...r down then removing it moves you to the previous or next page This operation is called flicking The screen can be switched to the next or previous menu screen by flicking or touching You can select the desired source in the main menu screen Source Media Modes When you select the desired source mode for example the DVD Video USB or iPod mode the following screen will appear Viewing DVDs NX604 only...

Page 8: ...elephone calls connection telephone calls communications with other 8 uetooth compatible devices and pairing are not possible A so during hands free operation there is no audio output 1 IMENUI J J 2 l m at BT Devices Connection 3 mJfor the device you want to add 4 Select the Bluetooth connection mode MEMO Functions that you can use vary depending on the 8 uetooth connection method For details refe...

Page 9: ...t driving related information and Internet information What is Smartphone linking You can connect the unit to your smartphone and operate the various applications that run on your smartphone from the unit For example you can output audio that is played from the speakers connected to the unit or display images displayed in applications on the unit This is called Smartphone linking The following lis...

Page 10: ...roid for Device Type on the Settings menu 2 Start Smart Access on the smartphone 3 Set Usage Setting in BT Devices Connection on the Settings menu and then connect your smartphone via Bluetooth 4 Connect the unit to the smartphone The following two connection methods are also available for some smartphones 1 For MHL connection Connect to the cigarette lighter port etc on the vehicle to 5supply po ...

Page 11: ...e Japanese restaurant The search results list screen is displayed The words you talked or the related items are displayed The search history is displayed This displays the details of the place the expiration date of Intelligent VOICE etc and sets as a destination or a waypoint switches the units of mi km and deletes the search history This switches the search area to the around of destination or c...

Page 12: ...rvice terms and conditions A Total Traffic Network a division of Clear Channel Broadcasting Inc holds the rights to the traffic incident data and RDS TMC network through which it is delivered You may not modify copy scan or use any other method to reproduce duplicate republish transmit or distribute in any way any portion of traffic incident data You agree to indemnify defend and hold harmless lnr...

Page 13: ...cribed below This may cause a fire accident or electrical shock A location exposed to rain or dust An unstable location or where the system may fall Do not install this unit in a place exposed to direct sunlight heat or a place where the vent holes or heat radiation holes are covered When you install the antenna mount it in a place where the elements of the antenna do not protrude beyond the edge ...

Page 14: ... antenna NX604 only USB Cable Notice The provided disc CD ROM manual cannot be played back on this unit 3 GENERAL CAUTIONS e Do not open the case There are no user serviceable parts inside If you drop anything into the unit during installation consult your dealer or an authorized Clarion service center 4 CAUTIONS ON INSTALLATION e Prepare all articles necessary for installing the main unit before ...

Page 15: ...A Vehicle Center Panel 2 Figure 4 2 Some panel openings are too small for the unit depending on the vehicle type and model In such a case trim the upper and lower sides of the panel frame by about 0 5 to 1 5 mm so the unit can be inserted smoothly 3 If a hook on the installation bracket interferes with the unit bend and flatten it with a nipper or similar tool Typical Mounting Brackets Example 1 E...

Page 16: ...t use a cable tie to tie them down Figure 6 Cable tie Figure 6 8 INSTALLING THE GPS ANTENNA NX604 ONLY Do not install the GPS antenna in a place where it may interfere with the operation of the airbag or hinder the driver s visual range Do not use the navigation system with the GPS antenna cable cut off The power line in the cable may be short circuited e The supplied GPS antenna is for installati...

Page 17: ...r 9 V lR E C ON N E C _lO_N ___ Radio antenna jack _ Refer to the following page GPS antenna jack NX604 only Steering wheel remote control terminal sold separately USB terminal A r i g i HDMI HL dapter smartphone conversion a o o I HDMI conversion cable 0 smartphone W I _ I Rear Monitor __ video output terminal video input terminal Right audio input terminal Left I I iPod iPhone Connection cable C...

Page 18: ...arking brake lamp Electro tap sold separately EB lead to battery Parking brake signal lead Parking brake lead Grass green 0 Connecting the Accessories e How to attach the electro tap 1 Place the Parking brake lead at the stopper and fold it back in the direction of the arrow 2 Pass the Parking brake signal lead through and fold it back in the direction of the arrow Parking brake signal lead Stoppe...

Page 19: ...1111111111111111111111111111111111111111111 280 9286 00 Clarion Co Ltd All Rights Reserved Copyright 2014 Clarion Co Ltd Printed in Japan I lmprime au Japan I lmpreso en Jap6n QY 111 OU QZ 311 OU 2014 4 ...

Page 20: ...Owner s manual NX604 FX503 DVD MULTIMEDIA STATION WITH BUILT IN NAVIGATION 6 2 INCH TOUCH PANEL CONTROL MULTIMEDIA STATION 6 2 INCH TOUCH PANEL CONTROL ...

Page 21: ...our Clarion experience There are many benefits to registering your product We invite you to visit our website at www clarion com to register your Clarion product We have made product registration simple with our easy to use website The registration form is short and easy to complete Once you re registered we can keep you informed of important product information Register at www clarion com it s ea...

Page 22: ...croSD card FX503 10 How to insert the microSD card 10 How to remove the microSD card 10 Adjusting the audio volume 11 Switching the display screen NX604 only 11 Switching to the audio screen 11 Switching to the map screen 11 Displaying the AV control bar NX604 only 11 Turning off the screen 11 Listening to the radio 11 Setting the unit to receive HD Radio broadcasts NX604 only 11 Receiving radio b...

Page 23: ...g to Pandora internet radio 30 How to listen to Pandora internet radio 30 Playing stations 30 Pausing play 30 Skipping the track being played 30 Rating the track currently being played 30 Bookmarking 30 Making stations 30 Deleting stations 31 Registering Bluetooth compatible devices 31 What is Bluetooth 31 Registering Bluetooth compatible devices pairing 31 Switching the connected Bluetooth compat...

Page 24: ...ssories 62 Index 63 To Ensure Safe Use Symbols relating to safety The possibility of the driver or other people being injured is indicated as follows and the following describes these dangers and how to avoid them Be sure to read these important warnings WARNING This indicates the possibility that failure to follow this instruction might lead to death or serious injury CAUTION This explains things...

Page 25: ...t Pay particular attention to handling the unit during use or immediately after turning the engine off On vehicles with a keyless entry system the unit may stop operating if you bring the key close to it Also skipping might occur if you bring the key close to the unit or Bluetooth Audio device If this happens move the key away There may be static or the screen may be distorted if electrical compon...

Page 26: ...ning and 4V 6ch RCA Output FX503 Smartphone Connectivity Built in Bluetooth Hands free HFP and Audio Streaming A2DP AVRCP Advanced Sound Tuning and 4V 6ch RCA Output Expanding Systems microSD memory card External Amplifier Rear Vision Camera Bluetooth Telephone AUX etc The illustrations for the main unit are of the NX604 USB Memory Rear Monitor Expanding audio features iPod iPhone Expanding visual...

Page 27: ...his device may not cause interference and 2 this device must accept any interference including ineterference that may cause undesired operation of this device MANUFACTURED NCL 276 1215 00 QZ 3010U A FCC ID AX2FX503 IC 419C FX503 530 1710kHz 87 9 107 9MHz THIS DEVICE COMPLIES WITH DHHS RULES 21 CFR CHAPTER I SUBCHAPTER J APPLICABLE AT DATE OF MANUFACTURE This product includes technology owned by Mi...

Page 28: ...roSD card is inserted to enjoy data in microSD cards p P 10 6 The map microSD is housed in here To update the map open this cover and remove and insert the card Do not open the cover for other operations 7 This is where DVD video CD MP3 WMA and DivX discs are inserted p P 10 This document uses the following inline graphics and conventions to indicate operations using the buttons on the operation p...

Page 29: ...the signal from the remote control sold separately 5 This is the Antitheft Indicator This light blinks when the Antitheft Activation setting is set to ON to indicate that the antitheft function is activated p P 42 This document uses the following inline graphics and conventions to indicate operations using the buttons on the operation panel Number Inline graphic Description of operation 1 MENU Sho...

Page 30: ... Turn the engine key to the ACC or ON position The unit turns on After the opening screen is displayed touch OK The current position map screen or the audio screen is displayed When the engine key is turned to the OFF position the unit is turned off MEMO s 7HEN THE NTITHEFT CTIVATION FUNCTION IS SET THE PASSWORD ENTRY SCREEN IS DISPLAYED p P 42 How to use menus The unit has a main menu for using a...

Page 31: ...g the microSD card NX604 To enjoy MP3 WMA data in microSD cards the microSD card must be loaded into the unit Attention s NSERT AND REMOVE THE MICRO3 CARD AFTER TURNING OFF THE UNIT BECAUSE THE MICRO3 CARD MIGHT GET DAMAGE s 4HE MAP MICRO3 CARD IS ALREADY INSERTED INTO THE MICRO3 CARD LOADING SLOT UNDER THE SLOT COVER F THE MAP MICRO3 CARD IS REMOVED THE UNIT DOES NOT FUNCTION O NOT REMOVE OR INSE...

Page 32: ... WORK 8 ONLY 1 Press the rotary volume knob NX604 or POWER FX503 The screen turns off Press the rotary volume knob NX604 or POWER FX503 again to display the screen as before When the audio screen is previously displayed the audio main menu screen of the selected source is displayed MEMO s 4HE SCREEN TEMPORARILY TURNS ON WHEN YOU RECEIVE A CALL OR USE THE CAMERA Listening to the radio You can enjoy...

Page 33: ...a station that can be received in the area you are driving You can receive any desired station at the touch of a button without having to adjust the frequency There are four preset channel lists FM1 FM2 FM3 and AM Up to six stations can be registered in each list There are two ways of registering to preset channel lists manual and automatic When receiving digital FM broadcasting is being received ...

Page 34: ...al broadcasts The information about the song being broadcast is registered as a bookmark Notice s BOOKMARK FOR A SONG BEING BROADCAST CAN BE CREATED IF ONE OF THE FOLLOWING ITEMS CAN BE RECEIVED 4HE NAME OF THE SONG ARTIST OR ALBUM INFORMATION RELATED TO THE 52 OR IMAGE INFORMATION Selecting a bookmark 1 MENU Tuner 2 The bookmark list is displayed 3 Select the items that you want to display The bo...

Page 35: ...tion is saved to the unit Up to 50 songs MEMO s F A SONG IS TAGGED WHILE THE I0OD IS CONNECTED TO THE UNIT THE TAG INFORMATION IS TRANSFERRED AUTOMATICALLY TO THE I0OD Downloading tags to your iPod To download tags to your iPod connect the iPod to the unit All existing tags are automatically transferred to the iPod and deleted from the unit MEMO s 7HEN TRANSFERRING TAGS TO THE I0OD THE RADIO MODE ...

Page 36: ...eived Notice s HANNELS WHICH PARENTAL LOCK IS SET ARE NOT INCLUDED IN TUNING WHEN LL HANNELS OR ATEGORIES IS SELECTED FOR 3EEK ODE Selecting channels from channel lists 1 MENU SiriusXM 2 3 4 Select the desired channel Entering a channel number to select it 1 MENU SiriusXM 2 3 4 Enter the channel number 5 OK Registering preset channels Up to 30 channels can be registered to preset channels 1 MENU S...

Page 37: ...l is not a valid SiriusXM channel The channel number has been entered incorrectly or the channel was removed from the SiriusXM channel lineup Ch Locked Lock Code The selected channel has been locked by the parental controls A prompt to enter the unlock code will appear p P 15 Subscription updated Press OK to continue An update to your SiriusXM subscription has been received by the SiriusXM tuner P...

Page 38: ... ON A 6 ONLY WHEN THE VEHICLE HAS STOPPED 7HILE YOU ARE DRIVING YOU CAN ENJOY ONLY AUDIO 1 Load the DVD or MENU DVD CD The DVD loaded in the unit is played Menu keys are displayed by touching the screen The screen size and play status are displayed If five seconds passes with no operations the keys displayed on screen are hidden To manually hide the keys touch Back Playing the previous or next cha...

Page 39: ... ADJUSTMENTS CAN BE SET FOR BOTH THE DAY AND NIGHT SCREENS Switching the screen size 1 MENU DVD CD 2 Touch the screen 3 4 Display Mode settings key default Full Entering a title or chapter number to play a title or chapter 1 MENU DVD CD 2 Touch the screen 3 4 Select at 10Key Search 5 Title or Chapter 6 Enter the number 7 OK The entered title or chapter is played Playing from menus DVD video discs ...

Page 40: ...spect ratios are different video is reshaped and displayed No parts of the video are clipped Pan Scan The video is displayed with its height aligned in the vertical direction of the screen When the video and screen aspect ratios are different video is displayed with its left and right sides clipped Letter Box The video is displayed with its width aligned in the horizontal direction of the screen W...

Page 41: ...depending on the parental level setting made on the unit Example When the viewing restriction of the DVD is parental level 3 The DVD can be played only when the parental level set on the unit is level 3 to 8 If an attempt is made to play a DVD when the parental level set on the unit is level 1 to 2 then a warning message Please change the parental level will be displayed The default parental level...

Page 42: ...yed Playing from the folder list track list 1 MENU DVD CD 2 Only the track currently being played is repeated All tracks in the folder currently being played are repeated MP3 WMA only All tracks in the disc are repeated All tracks in the disc are played at random All tracks in the folder currently being played are played at random MP3 WMA only 3 Touch the Trick Play key The screen returns to the p...

Page 43: ...ity kept intact The copyright of DivX content is protected so check the status of the device that is playing and the viewing count limit Also to view DivX VOD Video On Demand content the device that is playing must be registered as a DivX certified device Register DivX certified devices by the following procedure For details browse the Rovi Corporation website 1 Acquire a DivX account on your pers...

Page 44: ...ly being played is selected the folder list remains displayed and play begins from the first track of the selected folder To display the track list select the same folder again 4 Select the track Play begins from the selected track Playing the previous next folder 1 While playing Each touch of moves you to the previous or next folder and the first track in the folder is played Scan play Ten second...

Page 45: ...HE POINT IN THE VIDEO MAY DIFFER DEPENDING ON THE I0OD 4O WATCH VIDEO SELECT THE VIDEO FILE AGAIN Listening to iPod viewing iPod video Compatible iPod models iPod iPhone can be connected by the special connector cable CCA 750 separately sold or Lightning USB cable supplied with iPod iPhone Some functions are restricted depending on the iPod model and software version For information about compatib...

Page 46: ... CASE THIS SYMPTOM CAN BE REMEDIED BY SETTING THE MUSIC APPLICATION TO THE FOREGROUND ON THE I0OD 1 MENU USB iPod iPod video is played Menu keys are displayed by touching the screen To pause or resume play touch The track name currently being played is displayed If five seconds passes with no operations the keys displayed on screen are hidden To manually hide the keys touch Back MEMO s 7HEN AUDIO ...

Page 47: ... AUTOMATIC CONNECTION FROM THE UNIT IS NOT PERFORMED PERATE THE AUDIO DEVICE YOU WANT TO CONNECT TO ESTABLISH THE CONNECTION TO THE UNIT MEMO s OR DETAILS ON LUETOOTH UDIO DEVICES REFER TO THE RESPECTIVE 5SER S ANUAL s 5P TO FIVE LUETOOTH UDIO DEVICES INCLUDING HANDS FREE DEVICES CAN BE PAIRED 7HEN FIVE DEVICES ARE ALREADY PAIRED ONE DEVICE MUST BE DELETED FROM THE PAIRING INFORMATION AND A NEW DE...

Page 48: ...1 MENU BT Audio 2 3 4 Select the track Play begins from the selected track Playing under specified conditions You can search tracks to be played from folders or categories and play them Notice s OR THIS FUNCTION ONLY LUETOOTH UDIO THAT IS COMPATIBLE WITH 62 0 6ER CAN BE USED 7ITH SOME TYPES OF LUETOOTH UDIO DEVICE THIS FUNCTION CANNOT BE USED s 7HEN THE LUETOOTH UDIO PLAYER THAT IS PLAYING THE AUD...

Page 49: ...itching the audio mode to AUX1 or AUX2 WARNING s For your safety the driver should not watch the video or operate the controls while driving Please note that watching and operating the video while driving are prohibited by law in some countries Preparations The following cables are required for connecting external devices to the unit When using AUX1 To listen to audio s Commercially available 3 5 ...

Page 50: ...djust the image quality while viewing the video image on screen 6 Back This sets the newly adjusted image setting Image quality adjustments can be set for both the day and night screens Switching the screen size Notice s 7HEN THE SCREEN SIZE IS SWITCHED THE IMAGE SOMETIMES APPEARS DIFFERENT FROM THE ORIGINAL VIDEO IMAGE 1 MENU 2 AUX1 or AUX2 3 Touch the screen 4 Display Mode settings key default F...

Page 51: ... Listening to Pandora internet radio Pandora is free personalized radio that offers effortless and endless music enjoyment and discovery If you have any issues with the Pandora application on your mobile phone please direct them to pandora support pandora com How to listen to Pandora internet radio Listen to Pandora internet radio by following the procedure below For iPhone 1 Install Pandora appli...

Page 52: ...PHONE CALLS COMMUNICATIONS WITH OTHER LUETOOTH COMPATIBLE DEVICES AND PAIRING ARE NOT POSSIBLE LSO DURING HANDS FREE OPERATION THERE IS NO AUDIO OUTPUT 1 MENU 2 Set at BT Devices Connection 3 Add for the device you want to add 4 Select the Bluetooth connection mode MEMO s UNCTIONS THAT YOU CAN USE VARY DEPENDING ON THE LUETOOTH CONNECTION METHOD OR DETAILS REFER TO P 56 Handsfree Smartphone Linkin...

Page 53: ...ON THE DEVICE 7HEN REGISTERING A DEVICE FOLLOW THE ON SCREEN INSTRUCTIONS s FTER PAIRING IS COMPLETE THE CONNECTION MAY NEED TO BE CONFIRMED ON THE LUETOOTH COMPATIBLE DEVICE s OR DETAILS ON LUETOOTH OPERATION ON THE LUETOOTH COMPATIBLE DEVICE REFER TO THE 5SER S ANUAL FOR THE DEVICE s 4HE LUETOOTH COMPATIBLE DEVICE S RECEPTION SENSITIVITY AND REMAINING BATTERY POWER AS DISPLAYED ON THE UNIT MAY N...

Page 54: ...O AN AREA WHERE RADIO WAVES CANNOT BE RECEIVED THE LINE WILL BE DISCONNECTED s URING HANDS FREE TELEPHONE CALLS THE AUDIO SOURCE CANNOT BE SWITCHED OR SELECTED s T MAY NOT BE POSSIBLE TO MAKE OR RECEIVE CALLS UNLESS THE CELLPHONE IS IN STANDBY Making calls from the outgoing incoming calls log Notice s 9OU CANNOT MAKE CALLS FROM THE INCOMING CALLS LOG WHEN THE INCOMING CALL WAS FROM A WITHHELD NUMB...

Page 55: ...ering a phonebook You can register the phonebook on a cellphone in advance to the unit and make calls from there To register the phonebook on a cellphone use the phonebook download function on the cellphone With some cellphones phonebooks cannot be downloaded For details refer to the User s Manual for the cellphone MEMO s FTER A PHONEBOOK IS DOWNLOADED THE CELLPHONE CONNECTION IS SOMETIMES DISCONN...

Page 56: ...ND USING THE OPTIMUM PRICE PLAN SUCH AS A FLAT RATE DATA PLAN BASED ON THE FREQUENCY OF USE Notice s 7HILE YOU ARE DRIVING SOME APPLICATIONS CANNOT BE OPERATED SO AS TO PREVENT OBSTRUCTION TO DRIVING s NFORMATION CONTENT THAT IS DISTRIBUTED IN REAL TIME BELONGS TO THIRD PARTIES HAVING THE RIGHTS CONCERNED 4HE CONTENT OF SERVICES MIGHT BE CHANGED OR SUSPENDED FOR REASONS OF THIRD PARTIES HAVING THE...

Page 57: ...ion methods are also available for some smartphones The unit HDMI cable sold separately Connect to the cigarette lighter port etc on the vehicle to supply power HDMI conversion cable commercially available product 1 For MHL connection 2 For HDMI connection The unit HDMI cable sold separately Attention s 5SE ONLY AN CONVERSION CABLE THAT SUPPORTS TRANSFER 5 Start the application on the unit Startin...

Page 58: ...SION Preparations Install and start up Smart Access on the smartphone For iPhone connect iPhone to the unit via Bluetooth or USB For Android smartphones connect the smartphone to the unit via Bluetooth Using a remote control sold separately Cautions during remote control operations Pay attention to the following points when using the remote control The remote control sometimes cannot be operated w...

Page 59: ...the surrounding area When inserting the battery into the remote control pay attention to polarity and pole and insert it as instructed Failure to follow instructions might cause the battery to burst or leak or cause injury and contaminate the surrounding area Do not heat or disassemble the battery or put it in fire or water Doing so might cause the battery to burst or leak or cause fire or injury ...

Page 60: ... mirror image A mirror image is an image obtained by inverting the left and right of an image like in a rear mirror or side mirror on a vehicle The image in the rear camera cannot be seen or is difficult to view at night or in dark locations The camera is in a drip proof sealed structure to prevent condensation on the lens Never loosen the screws on the camera body or disassemble the camera This w...

Page 61: ...e B Position about 20 in 50 cm from the rear end of the vehicle C Approximately vehicle width 8 in 20 cm Adjusting the guidelines When adjusting guidelines marks must be drawn on the ground Prepare tools for drawing lines on the ground such as duct tape Also be sure to do the adjustments to match the car you drive WARNING s Before adjusting the guidelines stop at a safe location s Before getting o...

Page 62: ... settings You can set various operations sound quality and video image quality relating to the unit Notice s 7HILE YOU ARE DRIVING SELECTABLE ITEMS ARE LIMITED Making general settings for the unit 1 MENU System Language This switches the language of text that is displayed in screens and messages Default English When the language is switched the unit is automatically restarted and the language is s...

Page 63: ... screen to where you want to register it and then take your finger away from the screen This operation is called dragging Shortcut registration area The icon you dragged is registered to the shortcut keys max 5 icons Setting the illumination display color on the control panel NX604 only 1 MENU 2 Illumination Color settings key 3 Select the color Color1 Color9 Select from the prepared colors Scan S...

Page 64: ...BE CHANGED 1 MENU 2 Set at In Car Device setting 3 Name or PIN 4 Enter the new name default CAR BT or PIN default 1234 5 Set Setting sound quality Make sound quality related settings 1 MENU Sub Woofer Control This adjusts the output level of a connected sub woofer speaker Default 0 High Pass Filter This sets the cutoff frequency of the high pass filter for the front and rear speakers Default Throu...

Page 65: ...ew by manually switching to the day screen for example when the headlights are lit during the day and the screen is difficult to view When Auto is selected the screen automatically switches to the night screen when the parking light is lit MEMO s 7HEN THE ENGINE KEY IS TURNED TO THE h v POSITION THEN BACK TO THE h v POSITION Auto IS SET Brightness Adjust the image quality by or Image quality adjus...

Page 66: ... MP3 WMA NX604 only No sound is output after a disc is inserted or the disc is immediately ejected Load the disc with its label surface face up CDs recorded as CD R RW or copy protected CDs sometimes cannot be used Check the CD in use again Finalize the disc so that it can be used MIX MODE CDs cannot be played eject them 8 cm discs cannot be played eject them Cannot remove the disc even by pressin...

Page 67: ...T to the Dock connector Also remove the iPod from the unit and reconnect it microSD card USB memory Cannot play from microSD card Check to see if the microSD card can be used on the unit p P 50 Cannot insert the microSD card Insert the microSD card into the loading slot with its label surface face up NX604 Insert the microSD card into the loading slot with its label surface face down FX503 Cannot ...

Page 68: ... beforehand Start up the linking compatible application on the smartphone beforehand Reconnect the smartphone in a place with good reception Disconnect the connector cable and reconnect it Check the OS setting on the unit In the case of Android smartphones enable the HDMI output setting on the smartphone Next check what resolutions of HDMI output are possible on the unit Also check to see if the s...

Page 69: ...immediately after the unit is started up Wait a while before retrying the operation Some menus cannot be operated while driving Stop the vehicle in a safe place and apply the side brake before doing any operations Smartphone linking The error screen is displayed while the application is in use Use the smartphone in a place with good reception The Smartphone linking that could previously be used ca...

Page 70: ...other than CD DA e g over burned CDs DTS CD Video CD CD R and CD RW discs that have not been finalized DVDs that can be played Discs with mark Discs whose region number is 1 or ALL DivX discs Commercially available DVD videos can be played on the unit Note on region numbers of DVD video discs The DVD video system assigns a region number to DVD players and DVD discs by sales area The DVD video regi...

Page 71: ... engine key to the OFF position Doing so might result in damage or loss of recorded data When using microSD cards on the unit also read the warning and cautionary instructions provided by the manufacturer of the personal computer and peripheral devices Do not leave microSD cards at places where they are likely to get hot such as on the dashboard or at places subject to direct sunlight Doing so mig...

Page 72: ...d When discs NX604 only microSD cards USB memory contain large data other than music data tunes sometimes cannot be played Display of the play time sometimes deviates depending on the data content of the WMA file Also skipping or jumping sometimes occurs partially or noise sometimes occurs depending on the bitrate The sampling frequency and bitrates that can be played differ according to the recor...

Page 73: ...solution Play at 30 fps 32 x 32 to 720 x 480 Play at 25 fps 32 x 32 to 720 x 576 Audio codec MP3 MPEG1 2 AudioLayer 3 MPEG BC MPEG1 2 AudioLayer 2 Bit rate kbps 16 320 32 384 Sampling rate kHz 16 22 05 24 32 44 1 48 16 22 05 24 32 44 1 48 Audio Coding mode 1 0 2 0 Dual Mono MP3 Surround 1 0 2 0 Dual Mono Audio codec MPEG2 5 AC3 Bit rate kbps 6 160 32 640 Sampling rate kHz 8 11 025 12 32 44 1 48 Au...

Page 74: ...duct is provided with a Warranty Be sure to check the information and keep the form in a safe place Warranty period Check the warranty period written on the Warranty Repair after end of warranty period If performance can be maintained by repairing this product we shall repair it for a charge in accordance with the customer s wishes Specifications Navigation GPS unit NX604 only Reception frequency ...

Page 75: ...d and associated logos are trademarks of Rovi Corporation or its subsidiaries and are used under license DivX Certified to play DivX video including premium content Covered by one or more of the following U S patents 7 295 673 7 460 668 7 515 710 7 519 274 ABOUT DIVX VIDEO DivX is a digital video format created by DivX LLC a subsidiary of Rovi Corporation This is an official DivX Certified device ...

Page 76: ...awful activities by you in connection herewith B Total Traffic Network traffic data is informational only User assumes all risk of use Total Traffic makes no representations about content traffic and road conditions route usability or speed C THE LICENSED MATERIAL IS PROVIDED TO LICENSEE AS IS AND WHERE IS TOTAL TRAFFIC NETWORK INCLUDING BUT NOT LIMITED TO ANY AND ALL THIRD PARTY PROVIDERS OF ANY ...

Page 77: ...ing or Smartphone Linking Only Notice s F THE ABOVE CONNECTION MODE IS SELECTED LUETOOTH AUDIO FUNCTION CANNOT BE USED Deleting data initializing Delete initialize all data saved on the unit 1 MENU 2 Restore at Reset to Factory Setting The confirmation screen is displayed 3 OK This clears all data saved on the unit MEMO s ATA AFTER UPDATES IS SAVED INITIALIZATION IS NOT DONE TO PROGRAMS THAT ARE U...

Page 78: ...e locations described below This may cause a fire accident or electrical shock A location exposed to rain or dust An unstable location or where the system may fall s Do not install this unit in a place exposed to direct sunlight heat or a place where the vent holes or heat radiation holes are covered s When you install the antenna mount it in a place where the elements of the antenna do not protru...

Page 79: ...e tie 1 Finisher Warranty card GPS antenna NX604 only USB Cable Notice s 4HE PROVIDED DISC 2 MANUAL CANNOT BE PLAYED BACK ON THIS UNIT 3 GENERAL CAUTIONS Do not open the case There are no user serviceable parts inside If you drop anything into the unit during installation consult your dealer or an authorized Clarion service center 4 CAUTIONS ON INSTALLATION Prepare all articles necessary for insta...

Page 80: ...ts attached to the vehicle Screws marked are attached to the vehicle Figure 4 3 Mounting bracket 1 pair for the left and right sides 8 Hexagonal screw M5 x 8 Main Unit Center Panel 2 2 Some panel openings are too small for the unit depending on the vehicle type and model In such a case trim the upper and lower sides of the panel frame by about 0 5 to 1 5 mm so the unit can be inserted smoothly 3 I...

Page 81: ...rface before installing the GPS antenna Stick the double sided tape to the bottom face of the GPS antenna Double sided tape Bottom face of the GPS antenna Vehicles other than NISSAN and TOYOTA In some cases the center panel may require modification Trimming filing etc 6 REMOVING THE MAIN UNIT When the main unit is to be removed disassemble it in the reverse of the order in INSTALLTING THE MAIN UNI...

Page 82: ...t Left Black Black Yellow Red White Red White audio input terminal video output terminal SiriusXM Connect Vehicle Tuner terminal sold separately Rear audio output terminal Android smartphone Android smartphone External Amplifier Rear Monitor Steering wheel remote control terminal sold separately Rear Vision Camera terminal Purple Right Left Gray Red White Front audio output terminal Subwoofer outp...

Page 83: ... sold separately Parking brake lead Grass green Parking brake signal lead Parking brake lead to battery How to attach the electro tap 1 Place the Parking brake lead at the stopper and fold it back in the direction of the arrow 2 Pass the Parking brake signal lead through and fold it back in the direction of the arrow Parking brake signal lead Stopper Parking brake signal lead Parking brake lead Gr...

Page 84: ... Inserting removing discs 10 Intelligent VOICE 37 iPod Audio 24 iPod Video 24 iTunes Tagging 14 L Loudness 43 Low Pass Filter 43 M Main Menu Icons 41 Making calls Handset Phonebook 34 Incoming outgoing calls log 33 Telephone number 33 Manually registering stations Radio 13 Manual tuning Radio 12 MENU 7 8 9 microSD card 22 50 MP3 20 50 N NAVI AV 7 O Operation panel 7 P Pairing 31 Pandora Radio 30 P...

Page 85: ...ching cellphone connections 32 Switching display screen 11 System Language 41 T Time 42 Title Chapter 18 Tuning SiriusXM Radio 15 Tuning from list Radio 12 Turning off the screen 11 Turning power ON OFF 9 U USB memory 22 50 V Virtual Bass 43 Vocal Image Control 43 Volume 7 8 Volume Smoother 44 W WMA 20 50 ...

Page 86: ...All Rights Reserved Copyright 2014 Clarion Co Ltd 2014 QY 1110U QZ 3110U QCA 306 1 0 ...

Page 87: ...ULHQWHV GH DLUH FRPR OD VDOLGD GHO DLUH DFRQGLFLRQDGR HWF 3RGUtD FDXVDU XQ PDO IXQFLRQDPLHQWR GHPiV VL GHMD HO PLFUyIRQR H SXHVWR GLUHFWDPHQWH D OD OX GHO VRO ODV DOWDV WHPSHUDWXUDV SXHGHQ FDXVDU GLVWRUVLyQ GHFRORUDFLyQ TXH WDPELpQ SXHGHQ SURYRFDU HO PDO IXQFLRQDPLHQWR GHO DSDUDWR DV H WHUQH 0LNURSKRQ PXVV EHL GHU QVWDOODWLRQ JHJHEHQHQIDOOV DXI GHU 5 FNVHLWH GHV DXSWJHUlWHV DQJHVFKORVVHQ ZHUGHQ Hi...

Page 88: ...Owner s manual Navigation NX604 ...

Page 89: ...al to fully understand the screens and features Easy map updates It is easy to keep the navigation system up to date Simply download new map data from Clarion s portal site store them on a microSD card and insert it into the Clarion NX604 via the front card slot Unpleasant surprises are now avoided as navigation maps will match the real world Latest Map Guarantee When you start using the product y...

Page 90: ...pulating the map 20 2 3 5 Quick menu 21 2 3 6 Checking the details of the current position Where Am I 24 3 On road navigation 26 3 1 Selecting the destination of a route 26 3 1 1 Combined Search 27 3 1 1 1 Combined Search Navigating to a recent destination History 29 3 1 1 2 Combined Search Navigating to a Favorite destination 30 3 1 1 3 Combined Search Navigating to an address 31 3 1 1 4 Combined...

Page 91: ...d in a photo 67 3 1 10 Building a route from the list of destinations Create Route 68 3 2 Viewing the entire route on the map 69 3 3 Checking route parameters and accessing route related functions 70 3 4 Modifying the route 71 3 4 1 Selecting a new destination when already having a route New Route Waypoint or Final Destination 71 3 4 2 Setting a new starting position for the route 72 3 4 3 Editing...

Page 92: ...mation in route planning 90 5 1 10 1 Real time traffic information TMC 90 5 2 More menu 92 5 3 Settings menu 93 5 3 1 Sound and Warnings 95 5 3 2 Customize Quick menu 97 5 3 3 Traffic settings 97 5 3 4 Route settings 97 5 3 5 User profiles 100 5 3 6 Map settings 100 5 3 7 Visual guidance settings 101 5 3 8 Display settings 103 5 3 9 Regional settings 103 5 3 10 Trip monitor settings 103 5 3 11 Log...

Page 93: ...you change your mind later you can enable or disable the log collection in Settings page 104 It is important that you look at the display only when it is safe to do so If you are the driver of the vehicle we recommend that you operate Clarion Mobile Map before you start your journey Plan the route before your departure and stop if you need to change the route You must obey the traffic signs and fo...

Page 94: ...in Regional settings page 103 2 You are now asked whether you allow the software to collect usage information and GPS logs that may be used for improving the application and the quality and coverage of maps Tap to allow the anonymous statistics or disable this function Later you can turn them on or off individually in Log collection settings page 104 3 The Configuration wizard starts Tap to contin...

Page 95: ...all parts of Clarion Mobile Map from the Navigation menu You have the following options Tap to select your destination by entering an address or selecting a place of interest a location on the map or one of your Favorite destinations You can also look up your recent destinations from the Smart History or enter a coordinate Tap to display the route parameters and the route in its full length on the...

Page 96: ...larion Mobile Map saves your selections and applies the new settings without confirmation as soon as you use the controls Type Example Description How to use it Button Tap it to initiate a function to open a new screen or to set a parameter Tap it once Button with value Some buttons display the current value of a field or setting Tap the button to change the value After the change the new value is...

Page 97: ... keyboards to enter text and numbers Each key is a touch screen button 2 2 1 Using keyboards You only need to enter letters or numbers when you cannot avoid it You can type with your fingertips on the full screen keyboards and you can switch between various keyboard layouts for example English Greek or numerical Task Instruction Switching to another keyboard layout for example from an English keyb...

Page 98: ...rd entry saving your input Tap Canceling the keyboard entry returning to the previous screen Tap 2 2 2 Beyond single screen tap You usually need to tap the screen only once However some useful features can be accessed with combined touch screen tapping Those are the following Action Details Tapping and holding the screen Tap and keep pressing the following buttons to reach extra functions Tap and ...

Page 99: ...The Map screen is the most frequently used screen of Clarion Mobile Map A small live map is displayed on the Navigation menu as a part of the button To enlarge this small map and open the Map screen tap This map shows the current position the Vehimarker a blue arrow by default the recommended route an orange line and the surrounding map area When there is no GPS position the Vehimarker is transpar...

Page 100: ...hen you are navigating an active route and when you have no specified destination the orange line is not displayed Default data fields when cruising without a destination tap and hold any of the fields to change its value Field Description Shows your current speed given by the GPS receiver Shows the speed limit of the current road if the map contains it Shows the current time corrected with time z...

Page 101: ...ion and heading If roads are near it is aligned to the nearest road to suppress GPS position errors and the direction of the icon is aligned to the direction of the road If you select off road navigation The Vehimarker is at your exact GPS position The direction of the icon shows your current heading 2 3 2 2 Selected map location Cursor and selected map object You can mark a map location in the fo...

Page 102: ...d the next street or the next city town There is a field in the top left corner that displays the next maneuver Both the type of the event turn traffic circle exiting freeway etc and its distance from the current position are displayed A smaller icon shows the type of the second next maneuver if it is near the first one Otherwise only the next maneuver is displayed Most of these icons are very int...

Page 103: ...e map Highlighted arrows represent the lanes and direction you need to take Where additional information is available signposts substitute arrows Signposts are displayed at the top of the map The color and style of the signposts are similar to the real ones you can see above road or by the roadside They show the available destinations and the number of the road the lane leads to All signposts look...

Page 104: ...cture and the Map screen returns 2 3 3 5 Freeway exit services You may need a gas station or a restaurant during your journey This feature displays a new button on the map when you are driving on freeways Tap this button to open a panel with the details of the next few exits or service stations Tap any of them to display the exit area on the map You can now easily add this exit as a waypoint to yo...

Page 105: ... position displayed on the map If roads are near it is aligned to the nearest road Normally if GPS position is available the route starts from the current position If there is no valid GPS position Clarion Mobile Map uses the last known position as the start point Waypoint intermediate destination An intermediate destination of the route before reaching the final destination Destination end point ...

Page 106: ... list of event categories 3 Tap the traffic category you are interested in or tap to see the list of all events 4 Now tap any of the list items to see its details and to display the affected road segment in its full length on the map Note If there are traffic events on the recommended route that the application has not bypassed the icon will open the list of significant traffic events to let you q...

Page 107: ...it in 3D map view mode If you zoom out further the map switches to 2D view mode Tap the button once to modify the view in large steps or tap and hold the button to modify it continuously and smoothly Tilting up and down Changes the vertical view angle of the map in 3D mode Tap the button once to modify the view in large steps or tap and hold the button to modify it continuously and smoothly Rotati...

Page 108: ...ctions that are frequently needed during navigation It can be opened directly from the Map screen by tapping The menu will close after a few seconds of inactivity or if you tap Most of these functions are shortcuts They are accessible from the menu system There are more functions available than the number of buttons in the menu In Settings you can choose the function of each button page 97 The fol...

Page 109: ...nearby emergency or roadside assistance For details see the next chapter Tap the Current Street field on the Map screen This button cancels the route and stops navigation The button is replaced with the next one if waypoints are given My Route Cancel Route page 74 This button skips the next waypoint from the route n a This button opens a 2D map scaled and positioned to show the entire route My Rou...

Page 110: ...n you can replace the active route with a previously saved route My Route More Load Route With this function you can search for Places of Interest in various different ways Find Find Places page 50 This button opens the Map screen and starts simulating the active route My Route More Simulate Navigation page 83 This button opens the GPS Information screen with satellite position and signal strength...

Page 111: ...he Where Am I screen Open the Quick menu and tap the button Information on this screen Latitude and Longitude coordinate of the current position in WGS84 format Altitude elevation information coming from the GPS receiver often inaccurate House number on the left House number on the right In the middle of the screen you can see whether the position is current or the time left since it was last upda...

Page 112: ...uick search The following services can be searched around the current position or the last known position Car repair and roadside assistance services Police stations Medical and emergency services Gas stations Tap any of the buttons select a Place from the list and navigate to it NX604 English 25 ...

Page 113: ...tion and add it to your route to create a multi point route You can add as many destinations to your route as you like You can also use Clarion Mobile Map for off road navigation For details see page 85 3 1 Selecting the destination of a route Clarion Mobile Map offers you several ways of choosing your destination Enter a full address or a part of an address for example a street name without a hou...

Page 114: ... but you can see them again if you tap the information button on the right side of the input field 5 You can see the input field at the top of the screen Right below that you see the search area the city town around which the search is carried out The default search area is the city town where you are located For a local search skip the next step 6 optional To search in a different area do as foll...

Page 115: ...e after a few seconds of searching you can tap to switch to the result screen 9 The result screen also opens with hints Tap anywhere to suppress them Once you select a destination they will not appear again 10 You see all results in the list regardless of their type Addresses Places Place categories Favorite and recent destinations are mixed within one list 11 You have the following options Tap th...

Page 116: ...ng to a recent destination History To find one of your recent destinations in Combined Search carry out the search as described earlier For the input text you can use either a part of the name or a part of the address of the recent destination When you get to the result screen do as follows 1 Tap at the top of the screen 2 The list is now filtered What you see is the list of recent destinations wi...

Page 117: ...t to the result screen do as follows 1 Tap at the top of the screen 2 The list is now filtered What you see is the list of your Favorite destinations with a matching name 3 Scroll down the list if necessary and then select one of the destinations from the list 4 Once the destination is selected a full screen map appears with the selected point in the middle If necessary tap the map somewhere else ...

Page 118: ... necessary and then select one of the addresses from the list 4 Once the destination is selected a full screen map appears with the selected point in the middle If necessary tap the map somewhere else to modify the destination The Cursor appears at the new location Tap to confirm the destination or tap to select a different destination 5 After a short summary of the route parameters the map appear...

Page 119: ...lows 1 Tap at the top of the screen 2 The list is now filtered What you see is the list of matching intersections 3 Scroll down the list if necessary and then select one intersection from the list 4 Once the destination is selected a full screen map appears with the selected point in the middle If necessary tap the map somewhere else to modify the destination The Cursor appears at the new location...

Page 120: ...Places from one provider only Look for the provider logos at the top of the screen Tap one of them to see Places from that provider only 4 Scroll down the list if necessary and then select one of the Places from the list 5 Once the destination is selected a full screen map appears with the selected point in the middle If necessary tap the map somewhere else to modify the destination The Cursor app...

Page 121: ...rdered with Place categories at the beginning but if you want you can filter the list to contain Place categories only Tap at the top of the screen to filter the list 2 Scroll the list and select one of the categories You get the list of Places in that category ordered by their distance from your current position If the selected category contains subcategories you will see all Places in that categ...

Page 122: ... find an address by entering the exact address including house number the center of a city town an intersection the midpoint of a street any of the above starting the search with the ZIP code 3 1 2 1 Entering an address United States To enter an address as the destination do as follows 1 If you are on the Map screen tap to return to the Navigation menu 2 In the Navigation menu tap the following bu...

Page 123: ... names that match the string appear in a list after entering a couple of characters to open the list of results before it appears automatically tap Select the city town from the list 5 Enter the street name a Tap b Start entering the street name on the keyboard c Find the street you need The most likely street name is always shown in the input field To accept it tap If the desired name does not sh...

Page 124: ...l screen map appears with the selected point in the middle If necessary tap the map somewhere else to modify the destination The Cursor appears at the new location Tap to confirm the destination or tap to select a different destination 8 After a short summary of the route parameters the map appears showing the entire route The route is automatically calculated Tap to modify route parameters or tap...

Page 125: ... keyboard and select one from the list If you select a country without a state you can search for a city town in all its states 4 If needed select a new city town a Tap b Start entering the name of the city town on the keyboard c Find the city town you need The most likely city town name is always shown in the input field To accept it tap If the desired name does not show up the names that match t...

Page 126: ...appears automatically tap Select the street from the list 6 Enter the house number a Tap b Enter the house number on the keyboard To enter letters tap c Tap to finish entering the address If the entered house number cannot be found the midpoint of the street is selected as the destination 7 A full screen map appears with the selected point in the middle If necessary tap the map somewhere else to m...

Page 127: ...on the Map screen tap to return to the Navigation menu 2 In the Navigation menu tap the following buttons 3 By default Clarion Mobile Map proposes the country and state where you are If needed tap the button with the name of the country enter the first few letters of the destination country or state on the keyboard and select a country and state from the list If you select the country without a st...

Page 128: ...nter the house number on the keyboard To enter letters tap c Tap to finish entering the address If the entered house number cannot be found the midpoint of the street is selected as the destination 6 A full screen map appears with the selected point in the middle If necessary tap the map somewhere else to modify the destination The Cursor appears at the new location Tap to confirm the destination ...

Page 129: ...eturn to the Navigation menu 2 In the Navigation menu tap the following buttons 3 Select the country state and city town as described earlier page 35 4 Enter the street name a Tap b Start entering the street name on the keyboard c Find the street you need The most likely street name is always shown in the input field To accept it tap If the desired name does not show up the names that match the st...

Page 130: ...essary tap the map somewhere else to modify the destination The Cursor appears at the new location Tap to confirm the destination or tap to select a different destination 7 After a short summary of the route parameters the map appears showing the entire route The route is automatically calculated Tap to modify route parameters or tap and start your journey NX604 English 43 ...

Page 131: ...ame a Tap b Start entering the street name on the keyboard c Find the street you need The most likely street name is always shown in the input field To accept it tap If the desired name does not show up the names that match the string appear in a list after entering a couple of characters to open the list of results before it appears automatically tap Select the street from the list 5 Enter the in...

Page 132: ... short summary of the route parameters the map appears showing the entire route The route is automatically calculated Tap to modify route parameters or tap and start your journey 3 1 2 6 Selecting a city town center as the destination The city town center is not the geometric center of the city town but an arbitrary point the map creators have chosen In towns and villages it is usually the most im...

Page 133: ...om the list 5 Instead of entering the street name tap This way the center of the displayed city town becomes the destination of the route 6 A full screen map appears with the selected point in the middle If necessary tap the map somewhere else to modify the destination The Cursor appears at the new location Tap to confirm the destination or tap to select a different destination 7 After a short sum...

Page 134: ... as described earlier page 35 4 Enter a new city town using its ZIP code a Tap b Tap to open the numeric keypad c Start entering the ZIP code d Find the city town you need The most likely ZIP code is always shown in the input field To accept it tap If the desired number does not show up open the list of results by tapping Select the ZIP code from the list 5 Enter the street name a Tap b Start ente...

Page 135: ...nter the house number on the keyboard To enter letters tap c Tap to finish entering the address If the entered house number cannot be found the midpoint of the street is selected as the destination 7 A full screen map appears with the selected point in the middle If necessary tap the map somewhere else to modify the destination The Cursor appears at the new location Tap to confirm the destination ...

Page 136: ... list the items that contain the specified letters You can speed up finding an intersection Search first for the street with a less common or less usual name fewer letters are enough to find it If one of the streets is shorter search for that one first You can then find the second one faster You can search for both the type and the name of a road If the same word appears in several names for examp...

Page 137: ...n search for a Place by its category you can search for a Place by its name In addition you can search for special services from the Where Am I screen 3 1 3 1 Quick search for a Place of Interest The Quick search feature lets you quickly find a Place by its name The search is always carried out along the recommended route if it exists or around your current location if there is no destination give...

Page 138: ... full screen map appears with the selected point in the middle The name and address of the Place is displayed at the top of the screen 6 optional Tap to see the details of the selected Place Tap to return to the map 7 If necessary tap the map somewhere else to modify the destination The Cursor appears at the new location Tap to confirm the destination or tap to select a different destination 8 Aft...

Page 139: ...rent position is not available either no GPS signal they are searched around the last known position If an active route exists parking lots are searched around the destination of the route If there is no active route destination is not selected they are searched around the current position If the current position is not available either no GPS signal they are searched around the last known positio...

Page 140: ... the necessary detour If you need to reorder the list tap 6 Browse the list if necessary and tap one of the list items A full screen map appears with the selected point in the middle The name and address of the Place is displayed at the top of the screen 7 optional Tap to see the details of the selected Place Tap to return to the map 8 If necessary tap the map somewhere else to modify the destinat...

Page 141: ...rom this position Tap to search for a place within a selected city town The result list will be ordered by the distance from the center of the selected city town Tap to search for a place around the destination of the active route The result list will be ordered by the distance from the destination Tap to search along the active route and not around a given point This is useful when you search for...

Page 142: ...the route 8 Sometimes the list of brands in the selected Place subcategory appears Select one brand or tap to list all Places in the selected subcategory around the selected location or along the route 9 Finally the results appear in a list 10 optional The Places in the list are ordered by their distance from the current or last known position from the selected city town from the destination or by...

Page 143: ...wing the entire route The route is automatically calculated Tap to modify route parameters or tap and start your journey 3 1 3 4 Searching for a Place of Interest by name You can search for Places of Interest by their names You can search around different locations or along your route in the whole Place database or in one Place category or subcategory only 1 If you are on the Map screen tap to ret...

Page 144: ...tion Tap to search along the active route and not around a given point This is useful when you search for a later stopover that results in a minimal detour only such as searching for upcoming gas stations or restaurants The result list will be ordered by the length of the necessary detour 5 optional If you have selected select the city town to search in 6 Select one of the main Place categories e ...

Page 145: ...s containing the entered character sequence 11 optional The Places in the list are ordered by their distance from the current or last known position from the selected city town from the destination or by the length of the necessary detour If you need to reorder the list tap 12 Browse the list if necessary and tap one of the list items A full screen map appears with the selected point in the middle...

Page 146: ...ntire route The route is automatically calculated Tap to modify route parameters or tap and start your journey 3 1 3 5 Searching for a Place of Interest by its phone number You can search for Places of Interest by their phone number 1 If you are on the Map screen tap to return to the Navigation menu 2 In the Navigation menu tap the following buttons 3 The numeric keyboard appears Enter the phone n...

Page 147: ...tional Tap to see the details of the selected Place Tap to return to the map 9 If necessary tap the map somewhere else to modify the destination The Cursor appears at the new location Tap to confirm the destination or tap to select a different destination 10 After a short summary of the route parameters the map appears showing the entire route The route is automatically calculated Tap to modify ro...

Page 148: ...at type of Places 5 optional The Places in the list are ordered by their distance from the current or last known position from the selected city town from the destination or by the length of the necessary detour If you need to reorder the list tap 6 Browse the list if necessary and tap one of the list items A full screen map appears with the selected point in the middle The name and address of the...

Page 149: ... is automatically calculated Tap to modify route parameters or tap and start your journey 3 1 4 Selecting a map location as the destination 1 If you are on the Map screen tap to return to the Navigation menu 2 In the Navigation menu tap the following buttons 3 Locate your destination on the map move and scale the map as needed 4 Tap the location that you want to select as your destination The Curs...

Page 150: ...tions is described on page 79 1 Access the list of Favorites If you are on the Map screen tap to open the Quick menu If you are in the Navigation menu tap 2 Tap The list of Favorite destinations is displayed 3 Tap the Favorite that you want to set as your destination If necessary browse down to see more of the list or tap and enter a few letters from the name of the Favorite destination 4 A full s...

Page 151: ... when the Cursor is at the desired location tap and select Now that the Home location is set you can quickly navigate to it 1 To select the Home location do one of the following If you are on the Map screen tap and then tap this button can be added to the Quick menu in Settings page 97 If you are in the Navigation menu tap and then tap 2 A full screen map appears with the selected point in the mid...

Page 152: ...menu tap and then tap 2 The list of recent destinations appears Smart History promotes three destinations to the first page based on your previous routes most likely destinations The rest of the destinations are ordered by time they were last selected If necessary scroll the list to see earlier destinations 3 Select a destination from the list 4 A full screen map appears with the selected point in...

Page 153: ...an also select a destination by entering its coordinate Do as follows 1 If you are on the Map screen tap to return to the Navigation menu 2 In the Navigation menu tap 3 Open the menu and tap 4 You can enter the latitude and longitude values in any of the following formats decimal degrees degrees and decimal minutes or degrees minutes and decimal seconds 5 optional If necessary tap then and enter t...

Page 154: ... Tap to modify route parameters or tap and start your journey 3 1 9 Navigate to a location stored in a photo You can also set the location stored in a photo as your destination Do as follows 1 In the Find menu tap and then tap 2 A list of the photos stored in the device appear Select a photo to set its location as the destination 3 A full screen map appears with the selected point in the middle If...

Page 155: ...ot appear in the list Files must be located on an inserted microSD card either in the root folder or in a pictures folder 3 1 10 Building a route from the list of destinations Create Route You can also build your route destination by destination from the My Route menu 1 If you are on the Map screen tap to return to the Navigation menu 2 In the Navigation menu tap 3 Tap 4 There is only one line in ...

Page 156: ...re you want to insert the new route point in the list and repeat the above procedure 3 2 Viewing the entire route on the map It is easy to get a map overview of the active route Do as follows 1 If you are on the Map screen tap to return to the Navigation menu 2 In the Navigation menu tap 3 Tap The active route is displayed in its full length on the map together with additional information and cont...

Page 157: ...on your route The symbol of the vehicle type used in route calculation The route planning method e g Fast 4 You have the following options on this screen for detailed instructions on how to use them see the next chapter Tap to edit the route to add or remove destinations or change their sequence You can also set a route start point other than your current location This can be useful to plan and sa...

Page 158: ...nation to the route or append the newly selected destination at the end of the current route Tap to plan a new route to the newly selected location The previous destination and waypoint s are deleted Tap to add the newly selected location as an intermediate destination to your route The other destinations of the route remain intact Note the new waypoint is placed among destinations to keep the rou...

Page 159: ...he GPS receiver Then you can set the starting point of the route to a different location than the current GPS position 1 If you are on the Map screen tap to return to the Navigation menu 2 In the Navigation menu tap 3 If you already have a route tap If you are starting a new route tap 4 The first line is the start of the route normally the current GPS position Tap and confirm your action at the wa...

Page 160: ...te already existed it is now recalculated starting from the selected location 8 To return to normal navigation tap 3 4 3 Editing the list of destinations Edit Route You can edit the route by modifying the list of destinations You can add or remove destinations modify the start position or reorder the list 1 If you are on the Map screen tap to return to the Navigation menu 2 In the Navigation menu ...

Page 161: ...ed to pause the active route when you start driving again Clarion Mobile Map restarts the voice instructions from your position 3 4 5 Canceling the active route To cancel the navigated route do one of the following If you are on the Map screen tap and then tap If you have a route with waypoints you need to tap until all waypoints are deleted In the Navigation menu tap and then tap The active route...

Page 162: ...estination Do as follows 1 Select a destination as explained earlier and get to the route confirmation screen 2 Tap 3 Tap 4 You see the basic details of three route alternatives with the selected route planning method Tap any of them to see it on the map 5 Or if you cannot find a good alternative tap and scroll down for routes with different routing methods NX604 English 75 ...

Page 163: ...ith a different route planning method you can modify the Route settings page 97 There is another way to do this and to compare different route alternatives with the same route planning method Do as follows 1 If you are on the Map screen tap to return to the Navigation menu 2 In the Navigation menu tap 3 Tap 4 Tap 5 You see the basic details of three route alternatives with the selected route plann...

Page 164: ...e The orange line now shows the new recommended route 3 4 8 Changing the vehicle used in route planning To recalculate the active route for a different vehicle do as follows These changes can also be made in Settings page 97 1 On the Map screen tap and then tap 2 Tap and then tap one of the following 3 Clarion Mobile Map recalculates the route optimized for the new vehicle type The orange line now...

Page 165: ...e the road for a longer period of time They can be enabled or disabled separately from toll roads Clarion Mobile Map includes toll roads pay roads where there is a per use charge in the routes by default If you disable toll roads Clarion Mobile Map plans the best toll free route Clarion Mobile Map includes ferries in a planned route by default However a map does not necessarily contain information...

Page 166: ...lect a destination as described before It can be an address a Place any location on the map a previously used destination from History etc 2 When the full screen map appears with the selected location in the middle tap 3 Tap 4 optional Using the keyboard you can change the name offered for the Favorite Tap to enter numbers or symbols 5 Tap to save the location as a new Favorite destination NX604 E...

Page 167: ...then tap If you are in the Navigation menu tap and then tap 2 The list of Favorite destinations is displayed 3 Tap the Favorite that you want to edit If necessary browse down to see more of the list or tap and enter a few letters from the name of the Favorite destination 4 A full screen map appears with the selected point in the middle 5 Tap to see the details of the selected Place 6 Tap any of th...

Page 168: ...sing 1 Browse the map and select a location The red Cursor appears there 2 Tap 3 Scroll down the list and tap 4 On the newly opened screen select the type of the alert point the direction from which you expect the alert and if applicable the speed limit for this alert point 5 Tap to save the location as a new alert point NX604 English 81 ...

Page 169: ...map and select the alert point to edit The red circle appears around the alert point 2 Tap 3 Scroll down the list and tap 4 On the newly opened screen modify the type of the alert point the direction from which you expect the alert or if applicable the speed limit for this alert point 5 Tap to save the changes to the alert point 82 NX604 English ...

Page 170: ...igation menu tap 3 Tap 4 Scroll down the list and tap The simulation starts from the starting point of the route and using a realistic speed it leads you through the whole recommended route a optional You have the following controls during the simulation the control buttons disappear after a few seconds but you can open them again if you tap the map Jump to the next route event maneuver NX604 Engl...

Page 171: ...simulation Jump to the previous route event maneuver Tap to increase the speed of the simulation to 4 8 or 16 times faster Now tap again to return to the normal speed b Tap to stop the simulation 84 NX604 English ...

Page 172: ... the same as described at on road navigation The only difference is that route points are linked to form a route with straight lines regardless of the road network and traffic regulations 4 2 Navigating in off road mode The real difference between the on road and off road modes is the navigation itself When you are on the Map screen with an off road route your position and heading is not aligned w...

Page 173: ... Smart Zoom will zoom in if you drive slowly and zoom out when you drive at high speed 5 1 2 Daytime and night color themes Clarion Mobile Map uses different color themes during the day and during the night for both the map and the menu screens Daytime colors are similar to paper road maps and the menus are bright The night color themes use dark colors for large objects to keep the average brightn...

Page 174: ...able this method combines the benefits of Fast and Short Clarion Mobile Map calculates as if it were calculating the Fast route but it takes other roads as well to save fuel Results in a route with fewer turns and no difficult maneuvers With this option you can make Clarion Mobile Map to take for example the freeway instead of a series of smaller roads or streets Vehicle types Maneuver restriction...

Page 175: ...ommended route For further information about Route settings see page 97 5 1 5 Green routing Route calculation is not only about finding the quickest or shortest route For some of the vehicle types you can also check the fuel consumption and CO2 emission when planning a route and you can create cost effective routes with less effect on the environment In Route settings you can edit the parameters o...

Page 176: ...pecific text file if needed You can also add your own alert points or edit the previously uploaded points See page 81 for details The application can warn you when you approach road safety cameras like speed cameras or dangerous areas like school zones or railroad crossings You can set up the different alert types individually in Sound and Warning settings page 95 The following alert types are ava...

Page 177: ...tion in route planning The recommended route is not always the same between two points Real time traffic information can help you avoid current traffic events like temporary road closures or a traffic jam caused by an accident The function is subject to data availability You can display the live traffic information on the map if you browse the map and select this option from the More menu A 2D map...

Page 178: ...an set the minimum delay that can trigger a route recalculation or you can instruct Clarion Mobile Map to have you confirm the new recommended route before it takes effect You can do these in Traffic settings page 97 A special icon is displayed on the Map screen to show you whether traffic events are received The icon shows the status of the traffic receiver when there are no traffic events on you...

Page 179: ...s On the map screen tap the following buttons Button Description You can configure the program settings and modify the behavior of Clarion Mobile Map Fine tune route planning options change the look of the Map screen turn on or off warnings or restart the Configuration wizard and so on See the next chapter for details Visit www naviextras com to get additional content such as new maps or 3D landma...

Page 180: ...to GPX files for later use Select a country from the list and see useful driving information about the selected country Information may include speed limits on different road types the maximum blood alcohol level and any compulsory equipment you need to show when stopped by the police Run the Demo and watch sample route simulations to see how navigation works The About section provides you with pr...

Page 181: ... the Map screen Display related settings These settings allow you to customize the application for your local language measurement units time and date settings and formats as well as to choose the time zone Trip logs and track logs contain useful information about your trips Trip logs can be saved manually when you reach your destination or you can turn on the automatic saving here The application...

Page 182: ...tions how much they tell and how often they speak Maps may contain information about the speed limits of the road segments Clarion Mobile Map is able to warn you if you exceed the current limit This information may not be available for your region ask your local dealer or may not be fully correct for all roads in the map This setting lets you decide whether you wish to receive visible and or audib...

Page 183: ...r above the given speed limit Only when speeding The audio alert is only played when you exceed the given speed limit When approaching The audio alert is always played when approaching one of these alert points In order to draw your attention the alert is different when you exceed the speed limit Maps may contain driver alert information Tap this button to turn on or off these warnings and to set ...

Page 184: ...le Map avoids traffic events if it makes sense You can also set the minimum delay that triggers route recalculation and you can instruct the application if you want to confirm every recalculation Tap this button to open the list of traffic event types and select which events to take into account in route calculation 5 3 4 Route settings These settings determine how routes will be calculated Button...

Page 185: ... toll roads Clarion Mobile Map plans the best toll free route Clarion Mobile Map includes ferries in a planned route by default However a map does not necessarily contain information about the accessibility of temporary ferries You might also need to pay a fare on ferries Clarion Mobile Map excludes unpaved roads by default unpaved roads can be in a bad condition and usually you cannot reach the s...

Page 186: ...and normal cars Gives a short route to minimize the distance to travel It can be practical for slow vehicles Searching for a short route regardless of the speed this route type is rarely practical for normal vehicles Gives a quick but fuel efficient route based on the fuel consumption data given in Route settings page 97 Travel cost and CO2 emission calculations are estimations only They cannot ta...

Page 187: ...ime and night use change the blue arrow to a 3D car model show or hide 3D buildings turn track logging on or off and manage you Place visibility sets which Places to show on the map The map is always shown on the screen so that you can see the effect when you change a setting Button Description Switch the map view between a 3D perspective view a 2D heading up view and a 2D north up view Adjust the...

Page 188: ...the name of the Place category to open the list of its subcategories Tap to save the current Place visibility set or to load a previously saved one Here you can also revert to the default visibility settings 5 3 7 Visual guidance settings Adjust how the software helps you navigate with different kinds of route related information on the Map screen The data fields in the corner of the Map screen ca...

Page 189: ...f the following options Tap Dismiss or just ignore the message if you want to keep the original route Tap Preview to see the overview of the original route and the detour to make the decision You can accept the detour as offered or increase the bypassed freeway segment before accepting Turn to the suggested new direction and the route will be automatically recalculated Similar to the above possibi...

Page 190: ...ome voice guidance languages You can also set other country specific units used to display different values in the application By default time zone is taken from the map information and adjusted by your current location Here you can set time zone and daylight saving manually 5 3 10 Trip monitor settings Trip logs contain useful information about your trips Trip logs can be saved manually when you ...

Page 191: ... to track any personal information Here you can enable or disable collecting these logs Anonymous statistical information on using the navigation software is collected for later development purposes Understanding how different people use the application can help us improve the user interface and the program workflow Anonymous track logs are collected for later development purposes Your trips can h...

Page 192: ...le Map comes with different color themes for daytime or night use of the map and menu screens Themes are custom graphic settings and they can have different colors for streets blocks or surface waters in 2D and 3D modes and they display shades or shadows in different ways in 3D mode One daytime scheme and one night scheme is always selected for the map and for the menus Clarion Mobile Map uses the...

Page 193: ... for more than just cameras Various other types of proximity alert points like school zones and railroad crossings are also available Route A sequence of route events i e maneuvers for example turns and traffic circles to reach the destination The route contains one start point and one or more destinations The start point is the current or last known position by default If you need to see a future...

Page 194: ...without the express written consent of Clarion 2014 Clarion 2006 2014 TomTom All rights reserved This material is proprietary and the subject of copyright protection database right protection and other intellectual property rights owned by TomTom or its suppliers The use of this material is subject to the terms of a license agreement Any unauthorized copying or disclosure of this material will lea...

Page 195: ...2014 4 QY 1110U QCA 306 100 All Rights Reserved Copyright 2014 Clarion Co Ltd ...

Page 196: ... can output audio that is played from the speakers connected to the unit or display images displayed in applications on the unit This is called Smartphone linking The following lists the smartphones that can be linked to the unit e Covered models iPhone 4 iPhone 4s Android smartphones as of March 2014 Android devices only e Compatible Bluetooth profile SPP serial port profile HID human interface d...

Page 197: ......

Page 198: ...ion ou au remplacement du produit qui est sujet uniquement aIa discretion de Clarion 6 Ce produit doit est retourne dans son emballage d origine ou equivalent Le colis doit etre entierement assure et tous frais de transport doivent etre prepayes Clarion n assumera aucune responsabilite en cas de perte ou dommages survenue Iars du transport 7 TOUS PRODUITS CLARION ACQUIS PAR L ENTREMISE AUTRE QUE P...

Page 199: ... repair of the product or replacement of the product at the sole discretion of Clarion 6 Product must be shipped in its original carton or equivalent carton fully insured with shipping charges prepaid Clarion will not assume any responsibility for any loss or damage incurred in shipping 7 CLARION PRODUCTS PURCHASED FROM A SOURCE OTHER THAN AN AUTHORIZED CLARION DEALER INCLUDING ANY AND ALL PURCHAS...

Reviews: