background image

Health and safety information

Exposure to Radio Frequency (RF) Signals

Certification Information (SAR) 

<RXUZLUHOHVVSKRQHLVDUDGLRWUDQVPLWWHUDQGUHFHLYHU,WLVGHVLJQHGDQG

PDQXIDFWXUHGQRWWRH[FHHGWKHH[SRVXUHOLPLWVIRUUDGLRIUHTXHQF\5)

HQHUJ\VHWE\WKH)HGHUDO&RPPXQLFDWLRQV&RPPLVVLRQ)&&RIWKH86

JRYHUQPHQW7KHVH)&&H[SRVXUHOLPLWVDUHGHULYHGIURPWKH

UHFRPPHQGDWLRQVRIWZRH[SHUWRUJDQL]DWLRQVWKH1DWLRQDO&RXQVHORQ

5DGLDWLRQ3URWHFWLRQDQG0HDVXUHPHQW1&53DQGWKH,QVWLWXWHRI

(OHFWULFDODQG(OHFWURQLFV(QJLQHHUV,(((,QERWKFDVHVWKH

UHFRPPHQGDWLRQVZHUHGHYHORSHGE\VFLHQWLILFDQGHQJLQHHULQJH[SHUWV

GUDZQIURPLQGXVWU\JRYHUQPHQWDQGDFDGHPLDDIWHUH[WHQVLYHUHYLHZV

RIWKHVFLHQWLILFOLWHUDWXUHUHODWHGWRWKHELRORJLFDOHIIHFWVRI5)HQHUJ\
7KHH[SRVXUHOLPLWVHWE\WKH)&&IRUZLUHOHVVPRELOHSKRQHVHPSOR\VD

XQLWRIPHDVXUHPHQWNQRZQDVWKH6SHFLILF$EVRUSWLRQ5DWH6$57KH

6$5LVDPHDVXUHRIWKHUDWHRIDEVRUSWLRQRI5)HQHUJ\E\WKHKXPDQ

ERG\H[SUHVVHGLQXQLWVRIZDWWVSHUNLORJUDP:NJ7KH)&&UHTXLUHV

ZLUHOHVVSKRQHVWRFRPSO\ZLWKDVDIHW\OLPLWRIZDWWVSHUNLORJUDP

:NJ7KH)&&H[SRVXUHOLPLWLQFRUSRUDWHVDVXEVWDQWLDOPDUJLQRI

VDIHW\WRJLYHDGGLWLRQDOSURWHFWLRQWRWKHSXEOLFDQGWRDFFRXQWIRUDQ\

YDULDWLRQVLQPHDVXUHPHQWV
6$5WHVWVDUHFRQGXFWHGXVLQJVWDQGDUGRSHUDWLQJSRVLWLRQVDFFHSWHGE\

WKH)&&ZLWKWKHSKRQHWUDQVPLWWLQJDWLWVKLJKHVWFHUWLILHGSRZHUOHYHOLQ

DOOWHVWHGIUHTXHQF\EDQGV$OWKRXJKWKH6$5LVGHWHUPLQHGDWWKHKLJKHVW

FHUWLILHGSRZHUOHYHOWKHDFWXDO6$5OHYHORIWKHSKRQHZKLOHRSHUDWLQJ

FDQEHZHOOEHORZWKHPD[LPXPYDOXH7KLVLVEHFDXVHWKHSKRQHLV

GHVLJQHGWRRSHUDWHDWPXOWLSOHSRZHUOHYHOVVRDVWRXVHRQO\WKHSRZHU

UHTXLUHGWRUHDFKWKHQHWZRUN,QJHQHUDOWKHFORVHU\RXDUHWRDZLUHOHVV

EDVHVWDWLRQDQWHQQDWKHORZHUWKHSRZHURXWSXW

%HIRUHDQHZPRGHOSKRQHLVDYDLODEOHIRUVDOHWRWKHSXEOLFLWPXVWEH

WHVWHGDQGFHUWLILHGWRWKH)&&WKDWLWGRHVQRWH[FHHGWKHH[SRVXUHOLPLW

HVWDEOLVKHGE\WKH)&&7HVWVIRUHDFKPRGHOSKRQHDUHSHUIRUPHGLQ

SRVLWLRQVDQGORFDWLRQVHJDWWKHHDUDQGZRUQRQWKHERG\DVUHTXLUHG

E\WKH)&&  


)RUERG\ZRUQRSHUDWLRQWKLVPRGHOSKRQHKDVEHHQWHVWHGDQGPHHWV

WKH)&&5)H[SRVXUHJXLGHOLQHVZKHQXVHGZLWKD6DPVXQJDFFHVVRU\

GHVLJQDWHGIRUWKLVSURGXFWRUZKHQXVHGZLWKDQDFFHVVRU\WKDWFRQWDLQV

QRPHWDODQGWKDWSRVLWLRQVWKHKDQGVHWDPLQLPXPRIFPIURPWKH

ERG\
1RQFRPSOLDQFHZLWKWKHDERYHUHVWULFWLRQVPD\UHVXOWLQYLRODWLRQRI)&&

5)H[SRVXUHJXLGHOLQHV
6$5LQIRUPDWLRQRQWKLVDQGRWKHUPRGHOSKRQHVFDQEHYLHZHGRQOLQHDW

KWWSZZZIFFJRYRHWHDIFFLG

3OHDVHXVHWKHSKRQH)&&,'QXPEHUIRU

Содержание GT-P3100B

Страница 1: ... provider www samsung com English EU 11 2011 Rev 1 0 To install Kies PC Sync Download the latest version of Kies from the 1 Samsung website www samsung com kies and install it on your PC Using a USB cable connect your device to your PC 2 Samsung Kies will launch automatically Refer to the Kies help for more information ...

Страница 2: ...ectronic version of the user manual For more information refer to the user manual at www samsung com The manual is available as an Adobe Acrobat file pdf If you do not have Adobe Reader you can download the free program at www adobe com 7 3 ...

Страница 3: ... date on the latest news sports and weather manage your multimedia and business files and browse the web for maps business locations and more Read me first Please read all safety precautions and this manual carefully before using your device to ensure safe and proper use The descriptions in this manual are based on the default settings of your device Images and screenshots used in this user manual...

Страница 4: ...accessing www samsung com Software sound sources wallpapers images and other contents provided in this device are licenced for limited use between Samsung and their respective owners Extracting and using these materials for commercial or other purposes is an infringement of copyright laws Samsung is not liable for such copyright infringement by the user Please keep this manual for future reference...

Страница 5: ...opyright 2011 Samsung Electronics This user manual is protected under international copyright laws No part of this user manual may be reproduced distributed translated or transmitted in any form or by any means electronic or mechanical including photocopying recording or storing in any information storage and retrieval system without the prior written permission of Samsung Electronics Trademarks S...

Страница 6: ...of their respective owners Windows Media Player is a registered trademark of Microsoft Corporation Wi Fi theWi Fi CERTIFIED logo and theWi Fi logo are registered trademarks of theWi Fi Alliance DivX DivX Certified and associated logos are trademarks of Rovi Corporation or its subsidiaries and are used under licence All other trademarks and copyrights are the property of their respective owners ...

Страница 7: ... and software tools to convert your files into DivX videos DivX Certified to play DivX video up to HD 720p including premium content ABOUT DIVXVIDEO ON DEMAND This DivX Certified device must be registered in order to play purchased DivXVideo on Demand VOD movies To obtain your registration code locate the DivXVOD section in your device setup menu Go to vod divx com for more information on how to c...

Страница 8: ... started 17 Turn your device on and off 17 Get to know your device 18 Use the touch screen 23 Get to know the Home screen 25 Access applications 29 Customise your device 30 Enter text 35 Web 41 Browser 41 Pulse 45 Market 46 YouTube 47 Maps 47 Latitude 49 Places 50 Navigation 50 Samsung Apps 51 Communication 52 Calling 52 Contents ...

Страница 9: ...player 66 Camera 68 Video player 78 Gallery 79 Photo editor 81 Personal information 82 Contacts 82 Calendar 85 Memo 87 Connectivity 88 PC connections 88 Wi Fi 90 Wi Fi Direct 92 Bluetooth 93 AllShare 95 Mobile network sharing 98 GPS 100 TV connections 101 VPN connections 102 Tools 104 Alarm 104 ...

Страница 10: ...ager 112 Voice Search 112 World clock 113 Settings 114 Access the Settings menu 114 Wireless and networks 114 Call 116 Sound 118 Screen 119 Power saving mode 120 Location and security 120 Applications 122 Accounts and sync 123 Motion 124 Privacy 124 Storage 124 Language and input 125 Accessibility 129 Date and time 130 About device 130 ...

Страница 11: ...Contents 10 Troubleshooting 131 Safety precautions 136 Index 147 ...

Страница 12: ...e or malfunctions that are not covered by your manufacturer s warranty The items supplied with your device and available accessories may vary depending on your region or service provider You can purchase additional accessories from your local Samsung dealer The supplied accessories perform best for your device Accessories other than the supplied ones may not be compatible with your device ...

Страница 13: ...purchase a Universal Subscriber Identity Module USIM card To install the SIM or USIM card Open the cover of the SIM card slot 1 Insert the SIM or USIM card with the gold coloured 2 contacts facing down Close the cover of the SIM card slot 3 Charge the battery Your device has a built in battery Before using the device for the first time you must charge the battery Use only Samsung approved chargers...

Страница 14: ...ur device If the battery is completely discharged you cannot turn on the device even with the USB power adapter connected Allow a depleted battery to charge for a few minutes before you try to turn on the device Connect the USB cable to the USB power adapter and 1 then plug the end of the USB cable into the multifunction jack The shape of the USB power adapter may differ depending on your region C...

Страница 15: ...ing properly bring your device and the charger to a Samsung Service Centre When the battery is fully charged first unplug the USB 3 power adapter and USB cable from the device and then from the power outlet To save energy unplug the USB power adapter when not in use The USB power adapter does not have a power switch so you must unplug the USB power adapter from the outlet when not in use to avoid ...

Страница 16: ...ard formatted with a different file structure your device will ask you to reformat the memory card Frequent writing and erasing of data will shorten the lifespan of memory cards When you insert a memory card in your device the file directory of the memory card will appear in the external_sd folder under the internal memory Open the cover of the memory card slot 1 Insert a memory card with the gold...

Страница 17: ...ferring or accessing information as this could result in loss of data or damage to the memory card or device Format the memory card Formatting your memory card on a PC may cause incompatibilities with your device Format the memory card only on the device Open the application list and select Settings Storage Erase SD card Format SD card Erase everything Before formatting the memory card remember to...

Страница 18: ...e follow the on screen instructions to set up your device To turn off your device press and hold and select Power off OK Follow all posted warnings and directions from authorised personnel in areas where the use of wireless devices is restricted such as aeroplanes and hospitals To use your device s non network services only switch to Flight mode ...

Страница 19: ...ce provider Icon Definition No signal Signal strength GPRS network connected EDGE network connected UMTS network connected OpenWLANs available WLAN connected Bluetooth activated Receiving GPS data Synchronised with the web Call in progress Call on hold Speakerphone activated Missed call Uploading data Downloading data ...

Страница 20: ...ltimedia message New email message New Google Mail New voice mail message Alarm activated Event notification Roaming outside of normal service area Flight mode activated Music playback in progress Error occurred or caution required Battery power level Unable to charge Current time 1 If you use a charger that is not approved by Samsung this indicator will not appear 1 ...

Страница 21: ...harges can cause the touch screen to malfunction Do not allow the touch screen to come into contact with water The touch screen may malfunction in humid conditions or when exposed to water For optimal use of the touch screen remove the screen protection film before using your device Your touch screen has a layer that detects small electrical charges emitted by the human body For best performance t...

Страница 22: ...option list Drag and drop Tap and hold your finger on an item and then drag your finger to move the item Double tap Tap twice quickly with your finger to zoom in or out while viewing photos Rotate the touch screen Your device has a built in motion sensor that detects its orientation If you rotate the device the interface will automatically rotate according to the orientation To set the interface t...

Страница 23: ...any direction until it reaches the border of the circle You can activate the screen lock feature to prevent others from using or accessing your personal data and information saved in your device p 32 Get to know the Home screen When the device is in Idle mode you will see the Home screen From the Home screen you can view indicator icons widgets shortcuts to applications and other items Scroll left...

Страница 24: ...wing section System bar From the system bar you can quickly navigate screens access applications view system information and more 1 3 4 2 5 6 Number Function 1 Capture the current screen Capture the current screen and open the drawing pad tap and hold 2 Return to the previous screen 3 Return to the Home screen Access the task manager tap and hold 4 Open the list of recent applications Access the a...

Страница 25: ...en select 1 Select an item category 2 Widgets Add widgets Widgets are small applications that provide convenient functions and information App Shortcuts Add shortcuts to applications Wallpaper Set a background image More Add shortcuts to items such as bookmarks contacts and maps Select an item to add to the Home screen 3 Move items on the Home screen Tap and hold an item to move until the Home scr...

Страница 26: ...icon to the location you want or move it to 2 another panel of the Home screen Use the notifications panel From the Home screen or while using an application select the right side of the system bar and then select an option on the notifications panel You can view the device s current status and use the following options Wi Fi Activate or deactivate theWLAN feature Notifications Set the device to a...

Страница 27: ...d Select 3 to return to the previous screen Select to return to the Home screen Access recent applications Select 1 to view the applications you have accessed recently Select an application 2 Use the task manager Your device is a multitasking device It can run more than one application at the same time However multitasking may cause hang ups freezing memory problems or additional power consumption...

Страница 28: ...time zone set the time and date and change 2 other options Turn the touch tone on or off Open the application list and select Settings Sound Audible selection Adjust the device s volume Press theVolume key up or down 1 Select 2 and drag the sliders to adjust the volume level for call ringtones media sounds notifications and alarm sounds Switch to Silent mode To mute or unmute your device do one of...

Страница 29: ... 1 Wallpaper Select an image folder 2 If you selected Gallery or Wallpaper select Home screen wallpaper Select an image 3 If you selected a live wallpaper select 4 Set wallpaper If you selected an image from Gallery move or resize the rectangle to select a portion of the image and then select OK Samsung is not responsible for any use of default images or wallpapers provided on your device Activate...

Страница 30: ...word to prevent unauthorised people from using the device without your permission Once you set a screen lock your device will require an unlock code each time you turn it on or unlock the touch screen If you forget your PIN or password bring your device to a Samsung Service Centre to reset it Samsung is not responsible for any loss of security codes or private information or other damages caused b...

Страница 31: ...t 2 Continue Enter the PIN again and select 3 OK Set an unlock password Open the application list and select 1 Settings Location and security Configure lock screen Password Enter a new password alphanumeric and select 2 Continue Enter the password again and select 3 OK Lock your SIM or USIM card You can lock your device by activating the PIN supplied with your SIM or USIM card Open the application...

Страница 32: ...new SIM or USIM card in your device the Find my mobile feature will automatically send the contact number to specified recipients to help you locate and recover your device To use this feature you need a Samsung account for controlling the device from the web remotely Open the application list and select 1 Settings Location and security SIM change alert Read the terms and conditions select the che...

Страница 33: ...ext by selecting characters on the virtual keypad inputting handwriting on the screen or speaking words into the microphone You cannot enter text in some languages To enter text you should change the writing language to one of the supported languages p 125 Change the keyboard type You can change the keyboard type Select on the system bar and select a keyboard type Android keyboard Samsung keypad o...

Страница 34: ... 8 3 Number Function 1 Change case 2 Switch between Number Symbol mode and ABC mode 3 Move the cursor to the next text input field 4 Clear your input 5 Start a new line or field 6 Insert an emoticon Open the emoticon list tap and hold 7 Enter text by voice This feature may be unavailable depending on the selected input language 8 Insert a space ...

Страница 35: ...3 9 11 10 5 6 12 Number Function 1 Minimise the virtual keypad 2 Move the cursor to the next text input field 3 Change case 4 Switch between Number Symbol mode and ABC mode 5 Access the keypad settings Change the keypad type or activate the voice input feature tap and hold 6 Insert a space 7 Clear your input 8 Start a new line 9 Attach an item ...

Страница 36: ... XT9 When you enter the first three letters of a word the alternate word list appears You can use a variety of gestures in Handwriting mode to edit text For more information about gestures select Handwriting settings Gesture guide Enter text using the Swype keypad Select the first character of a word and drag your finger 1 to the second character without releasing the finger from the screen Contin...

Страница 37: ...y to enter characters on the upper half of the key When you tap and hold a key until the character list appears you can enter special characters and symbols You can also use the following keys 7 8 3 4 1 2 3 9 5 6 11 10 Number Function 1 Change the input language 2 Move the cursor to the next text input field 3 Change case 4 Access the swype tip screen Open the help information tap and hold 5 Switc...

Страница 38: ...uage 11 Insert a space Copy and paste text While you are entering text you can use the copy and paste feature to use text in other applications Tap and hold a word 1 Drag 2 or to select the text you want Select 3 to copy or to cut the text onto the clipboard In another application tap and hold the text input field 4 Select 5 Paste to insert the text from the clipboard into the text input field ...

Страница 39: ...ly depending on your region or service provider Available icons may vary depending on your region or service provider Browse web pages Open the application list and select 1 Browser to launch your homepage To access a specific web page select the URL input field enter the web address of the web page and select Navigate web pages with the following keys 2 3 4 1 2 7 5 6 8 The above screen may differ...

Страница 40: ... bookmarks and recent internet history 8 Bookmark the current web page While browsing the web page use the following options To zoom in place two fingers on the screen and spread them apart To zoom out move your fingers closer together You can also double tap the screen To open a new tab select New tab To open a new tab without saving cookies select New incognito tab To search for text on the web ...

Страница 41: ...mation by voice This feature may be unavailable depending on your region or service provider Open the application list and select 1 Browser Select 2 Select 3 and say a keyword into your device s microphone The device searches for information and web pages related with the keyword Open multiple pages You can open multiple pages and switch back and forth between them Open the application list and se...

Страница 42: ... if necessary Select 5 OK To use bookmark options select tap and hold a bookmark To open the web page in the current tab select Open To open the web page in a new tab select Open in new tab To edit the bookmark select Edit bookmark To add the bookmark shortcut to the Home screen select Add shortcut to home To send the web address of the web page to others select Share link To copy the web address ...

Страница 43: ...ws articles on your device Read feeds Open the application list and select 1 Pulse If you are launching this application for the first time 2 select OK and tap the screen to clear the hint Select 3 to update feeds To read the feeds you added to your favourite list select Scroll up or down to select a feed source 4 Scroll left or right and select a feed 5 While reading a feed use the following opti...

Страница 44: ...op for games and mobile applications This feature may be unavailable depending on your region or service provider Download and install an application Open the application list and select 1 Market You can also select Shop at the top right of the application list If you are launching this application for the first time 2 select Accept Search for a file or application and download it 3 Uninstall an a...

Страница 45: ... virtual keys 4 Upload videos Open the application list and select 1 YouTube Select 2 Your Channel Select your Google account if it is linked toYouTube You 3 can also select Add account and set up an account to sign inYouTube Select 4 Upload and then select a video Enter details for the upload and select 5 Upload Maps Learn to use Google Maps to find your location search the map for streets cities...

Страница 46: ...the device select To search for a place around you select To get directions to a specific destination select To add layers to the map select To access a list of other options select To zoom in place two fingers on the screen and spread them apart To zoom out move your fingers closer together To add a star to the location select the balloon of the location name Get directions to a specific destinat...

Страница 47: ...our friends and view friends locations via Google Latitude This feature may be unavailable depending on your region or service provider Open the application list and select 1 Latitude The device automatically joins Latitude Select 2 Select from Contacts or Add via email address Select a friend you want to add or enter an email address 3 and select Add friends Select 4 Yes When your friend accepts ...

Страница 48: ...ce select Directions To view the phone number of the place select Call Navigation Learn to use the GPS navigation system to find and show your destination with voice guidance Navigation maps your current location and other navigational data may differ from actual location information You should always pay attention to road conditions traffic and any other factors that may affect your driving and f...

Страница 49: ... applications directly to your device Featuring a wealth of games news reference social networking navigation health related applications and more Samsung Apps gives you instant access to a huge choice of mobile experience Your device gets smarter with fully optimised applications from Samsung Apps Explore amazing applications and make your mobile life even better This feature may be unavailable d...

Страница 50: ...he buttons or the touch screen when you make accept end or reject calls Make a call Open the application list and select 1 Phone Dialer and enter an area code and a phone number Select 2 Call to make a voice call For a video call select Video call To end the call select 3 End Use the phonebook to save numbers you dial frequently p 82 To quickly access the call log to redial the numbers you dialled...

Страница 51: ...rs Open the application list and select Settings Call Set reject messages Call an international number Open the application list and select 1 Phone Dialer and tap and hold 0 to insert the character Enter the complete number you want to dial country 2 code area code and phone number and then select Call to dial the number Use a headset By plugging a headset into the device you can answer and contro...

Страница 52: ...o use this feature To open the dialling screen select Dialer To activate the speakerphone feature select Speaker In noisy environments you may have difficulty hearing some calls while using the speakerphone feature For better audio performance use the normal phone mode To turn off the microphone so that the other party cannot hear you select Mute To listen and talk to the other party via a Bluetoo...

Страница 53: ... To hide your image from the other party select Hide me To select an alternative image or video to be shown to the other party select Images or Videos To use the other party s image tap and hold the other party s image You can capture an image of the screen or record the video call by selecting Capture or Record View and dial missed calls Your device will display calls you have missed on the displ...

Страница 54: ... Select 3 Auto reject list Press 4 Add Enter a number to reject and select 5 Save To add more numbers repeat steps 4 5 6 Use Fixed Dialling Number FDN mode In FDN mode your device will restrict outgoing calls except for the numbers stored in the FDN list To activate FDN mode Open the application list and select 1 Settings Call Fixed Dialing Numbers Enable FDN Enter the PIN2 supplied with your SIM ...

Страница 55: ...ce area Open the application list and select 1 Settings Call Call forwarding a call type Select a condition 2 Enter a number to which calls will be forwarded and select 3 Enable Your setting will be sent to the network Set call waiting Call waiting is a network feature to alert you of an incoming call while you are on a previous call This feature is available only for voice calls Open the applicat...

Страница 56: ...create and send text SMS or multimedia MMS messages and view or manage messages you have sent or received You may incur additional charges for sending or receiving messages while outside your home service area For details contact your service provider Send a text message 1 Open the application list and select Messaging Select 2 Add recipients of your message 3 Enter phone numbers manually separati...

Страница 57: ... device will convert the message as a multimedia message Press 4 Add subject and enter a subject for the message Select 5 Enter message here and enter your message text Select 6 and add an item You can select a file from the file list or create a new photo or video Select 7 Send to send the message View a text or multimedia message 1 Open the application list and select Messaging Your messages are...

Страница 58: ...e provider for the number Google Mail You can retrieve new email messages from Google Mail to your Inbox When you access this application the Inbox screen appears The total number of unread messages displays in the title bar and unread messages display in bold This feature may be unavailable depending on your region or service provider This Google Mail menu may be labelled differently depending on...

Страница 59: ...ark the message as not important select Mark as not important To add a label to a message select Change labels To register the message to the spam list select Report spam To hide the message select Mute To move the message to the inbox folder select All Mail and drag the message to Inbox To reload the messages select Refresh To customise the email settings select Settings To reply to the message s...

Страница 60: ...inished setting up the email account the email messages are downloaded to your device If you have created more than two accounts you can switch between email accounts Select an account name at the top left of the screen and select the one you want to retrieve messages from Send an email message Open the application list and select 1 Email an email account Select 2 Add recipients of your message 3 ...

Страница 61: ...er retrieving email messages you can view them offline Open the application list and select 1 Email an email account Select 2 to update the message list Select an email message 3 From the message view use the following options To move to the previous or next message select or To search for an email message select To reload the messages select To create a new message select To reply to the message ...

Страница 62: ...message select To save an attachment to your device select the attachment tab Available options may differ in landscape view and portrait view Talk Learn to chat with friends and family via GoogleTalk This feature may be unavailable depending on your region or service provider Set your status Open the application list and select 1 Talk Enter your Google account and password and select 2 Sign in if...

Страница 63: ...add a friend to a chat select Add to chat To end the chat select 4 Social Hub Learn to access Social Hub the integrated communication application for Social Network Service SNS email messages contacts or calendar information Visit socialhub samsungapps com for more details Open the application list and select 1 Social Hub If you are launching this application for the first time add 2 an account or...

Страница 64: ...files or the web browser mid xmf rtttl imy rtx ota amr wav mxmf Some file formats are not supported depending on the software of the device If the file size exceeds the available memory an error can occur when you open files Playback quality may vary by content type Some files may not play properly depending on how they are encoded Add music files to your device Start by transferring files to your...

Страница 65: ... to music via a Bluetooth headset select Via Bluetooth You cannot use this option when you connect a headset to your device To send a music file to others select Share via To set a music file as various tones select Set as an option To customise your music player select Settings You can control the music player with a headset In Idle mode press and hold the headset button to launch the music playe...

Страница 66: ...wing settings to customise your music 3 player Option Function Equaliser Select a default equaliser type Sound effects Select a sound effect Music auto off Set the music player to turn off automatically after a specific period of time Camera Learn how to capture and view photos and videos You can take photos at resolutions up to 2048 x 1536 pixels 3 2 megapixels and videos at resolutions up to 128...

Страница 67: ...sary 2 adjustments 4 5 6 1 3 2 Number Function 1 Use camera shortcuts Change the flash settings Switch between the front and rear camera lense Change the shooting mode Select the length of the delay before the camera takes a photo Adjust the exposure value You can add or remove shortcuts to frequently used options p 77 2 Change the camera settings ...

Страница 68: ...is saved automatically After taking photos select the image viewer icon to view the captured photos To view more photos scroll left or right You can also tap the screen and scroll through the thumbnails of photos at the bottom of the screen To zoom in place two fingers on the screen and spread them apart To zoom out move your fingers closer together You can also double tap the screen To send a pho...

Страница 69: ... 2 Scene mode a scene Make any necessary adjustments 3 Select 4 to take a photo Capture a photo in Self shot mode You can take photos of yourself conveniently using the front camera lens Open the application list and select 1 Camera to turn on the camera Select 2 Self portrait Make any necessary adjustments 3 Select 4 to take a photo Capture a photo in Smile shot mode Your camera can recognise peo...

Страница 70: ...ing mode Panorama Make any necessary adjustments 3 Select 4 to take the first photo Slowly move the device in any direction and align the 5 green frame with the viewfinder When you have aligned the green frame and viewfinder the camera will automatically take the next photo Repeat step 5 to complete the panoramic photo 6 Capture a photo of action You can capture shots of a moving subject and then ...

Страница 71: ...ts to frequently used options Self portrait Switch between the front and rear camera lenses Flash Change the flash setting You can manually turn the flash on or off or set the camera to automatically use the flash when needed Shooting mode Change the shooting mode Scene mode Change the scene mode Exposure value Adjust the exposure value Focus mode Take close up photos or set the camera to focus on...

Страница 72: ... to include location information for your photos To improve GPS signals avoid shooting in locations where the signal may be obstructed such as between buildings or in low lying areas or in poor weather conditions Your location may appear on your photos when you upload them to the web To avoid this deactivate the GPS tag setting Storage Select a memory location for storing captured photos Reset Res...

Страница 73: ... a video of yourself Change the recording mode for attaching to a message or for saving normally Select the length of the delay before the camera recording a video Adjust the exposure value You can add or remove shortcuts to frequently used options p 77 2 Change the camcorder settings 3 Check the camcorder status Length of video that can be recorded according to available memory Default storage lo...

Страница 74: ...ter recording videos select the image viewer icon to view the recorded videos To view more videos scroll left or right You can also tap the screen and scroll through the thumbnails of videos at the bottom of the screen To play a video select To send a video to others select Share via To delete a video select Delete To access Gallery select Go to gallery Customise camcorder settings Before recordin...

Страница 75: ...ance according to lighting conditions Outdoor visibility Activate Outdoor visibility to select an appropriate lighting condition Guidelines Display the guidelines on the preview screen Storage Select a memory location for storing recorded videos Reset Reset menus and recording options Edit the shortcut icons You can add or remove shortcuts to frequently used options From the preview screen select ...

Страница 76: ...elect 1 Video player Select a view mode at the top of the screen 2 Select a video to play 3 Control playback with the virtual keys 4 While playing a video use the following options To send a video to others select Share via To view the list of bookmarks select Bookmarks This option appears only if you have bookmarked during playback by selecting To display subtitles select Subtitles This option ap...

Страница 77: ... Demand Each time you lock the screen while playing a DivXVideo On Demand one of your available rental counts will be decremented Some file formats are not supported depending on the software of the device If the file size exceeds the available memory an error can occur when you open files Playback quality may vary by content type Some files may not play properly depending on how they are encoded ...

Страница 78: ... a photo to others select To delete a photo select To view photo details select Details To rotate a photo anti clockwise select Rotate left To rotate a photo clockwise select Rotate right To set a photo as wallpaper or an image for a contact select Set picture as To crop an image from a photo select Crop To print a photo using aWLAN or USB connection select Print Your device is compatible only wit...

Страница 79: ...order select or If you select Grab you can adjust the selection size by selecting To reverse the selection select Select 4 Done Use the following options to edit the photo 5 Option Function Rotate or flip the image Resize the image by dragging the rectangle or selecting 100 an option Crop the image by moving or dragging the rectangle Apply a colour effect Apply a filter effect Use additional tools...

Страница 80: ...ist and select 1 Contacts Select 2 Select a memory location 3 If you have more than one account select an account to which you want to add the contact Enter contact information 4 Select 5 Done to add the contact to memory You can retrieve contacts by synchronising your assigned account Open the application list and select 1 Contacts Select 2 View SNS friends Select an account 3 Select contacts 4 D...

Страница 81: ...ct 2 Search contacts and enter the first few letter of a name Select the contact s name 3 Once you find a contact you can use the following options To call the contact select or To send a message select To send an email message select an email address To edit the contact information select Edit To delete the contact select OK To set the contact as your favourites select Import or export contacts T...

Страница 82: ...Select 2 Import Export Export to SD card Select 3 OK to confirm Copy or move contacts To copy or move contacts from the SIM or USIM card to your device Open the application list and select 1 Contacts Select 2 Import Export Import from SIM card Select a memory location 3 If you have more than one account select an account to which you want to add the contact Select contacts and select 4 Copy or Mov...

Страница 83: ...ication list and select 1 Contacts Select 2 Groups Enter a name for the group 3 Select 4 Edit members Select members from the contact list and select 5 Done When you are finished select 6 Done Calendar Learn to create and manage daily weekly or monthly events and set alarms to remind yourself of important events Change the calendar view Open the application list and select 1 Calendar Select a view...

Страница 84: ...3 To view events of a specific date Open the application list and select 1 Calendar Select a date on the calendar 2 To move to a specific day by entering a date manually select Go to enter the date by selecting or and select Set Select an event to view its details 3 Stop an event alarm If you set an alarm for a calendar event the event alarm icon will appear at the specified time Select 1 on the s...

Страница 85: ...t 4 Done View memos Open the application list and select 1 Memo Select a memo to view its details 2 To use additional features with a memo select Tool Function Delete the memo Change the background colour of the memo Lock the memo Print the memo using aWLAN or USB connection Your device is compatible only with some Samsung printers Upload your memo on community websites Send the memo to others ...

Страница 86: ... Settings Applications Development and then clear the check box next to USB debugging Connect with Samsung Kies Ensure that Samsung Kies is installed on your PC You can download the program from the Samsung website www samsung com kies Samsung Kies will work on bothWindows and Macintosh computers Using a USB cable connect the multifunction jack on your 1 device to a PC Samsung Kies will launch aut...

Страница 87: ...nd access the file directory If you insert a memory card in the device you can access the file directory of the memory card by using the device as a memory card reader The file directory of the memory card will appear as a removable disk separate from the internal memory If you want to transfer files from or to a memory card 1 insert a memory card into the device Using the USB cable connect the mu...

Страница 88: ...perated in the EU without restriction indoors but cannot be operated outdoors in France Activate theWLAN feature Open the application list and select 1 Settings Wireless and networks Select 2 Wi Fi to activate theWLAN feature An activeWLAN running in the background will consume battery power To preserve battery power activate theWLAN only when needed Find and connect to aWLAN Open the application ...

Страница 89: ...n Open the application list and select 1 Settings Wireless and networks Wi Fi settings Select a network indicated asWPS available and select the 2 drop down menu next to Network setup Select 3 WPS push button OK Press aWPS button on the access point within 2 minutes 4 To connect to aWLAN with aWPS PIN Open the application list and select 1 Settings Wireless and networks Wi Fi settings Select a net...

Страница 90: ...t 6 OK Wi Fi Direct Learn to use theWi Fi Direct feature to connect two devices via aWi Fi network without requiring an access point Connect your device to another device Open the application list and select 1 Settings Wireless and networks Wi Fi Direct settings Wi Fi Direct Select 2 Scan Select a device and then select 3 Connect When the owner of the other device accepts the connection the device...

Страница 91: ...am information with Bluetooth If the devices are within range of one another you can exchange information between them even if they are located in different rooms Samsung is not responsible for the loss interception or misuse of data sent or received via the Bluetooth wireless feature Always ensure that you share and receive data with devices that are trusted and properly secured If there are obst...

Страница 92: ...Select a device 2 Enter a PIN for the Bluetooth wireless feature or the 3 other device s Bluetooth PIN if it has one and select OK Alternatively select Accept to match the PIN between your device and the device When the owner of the other device enters the same PIN or accepts the connection pairing is complete If the pairing is successful the device will automatically search for available services...

Страница 93: ... for the Bluetooth wireless 2 feature and select OK if necessary Select 3 on the system bar and select Accept to confirm that you are willing to receive data from the device Received data is saved to the bluetooth folder If you receive a contact file select My files bluetooth a contact file to import it to your contact list AllShare Learn to use the Digital Living Network Alliance DLNA service tha...

Страница 94: ...r a name for your device as a media server Share media Turn on video image and music sharing with other DLNA enabled devices Access point network Select a connection profile to use for DLNA connections Upload from other devices Set whether or not to accept the upload from other devices Default memory Select the default memory location for saving downloaded media files Play your files on another DL...

Страница 95: ... the one that 2 contains media files Select a media category 3 files Playback begins at the selected player Control playback using icons of your device 4 Play files of one device on the other device Open the application list and select 1 AllShare Select a device as the media server the one that 2 contains media files Select a media category 3 files Playback begins at the selected player Select 4 Y...

Страница 96: ...ivate theWLAN tethering feature Select 3 Configure portableWi Fi hotspot to configure network settings to use your device as an access point Option Function Network SSID View and edit the device name that will be shown to external devices Security Select the security type Password View or edit the network key to prevent unauthorised access to the network When you are finished select 4 Save From an...

Страница 97: ...etwork connection clear the check box next to USB tethering The sharing method for the network connection may differ depending on the PC s operating system Share your device s mobile network via the Bluetooth wireless feature Open the application list and select 1 Settings Wireless and networks Bluetooth settings Select 2 Bluetooth to turn on the Bluetooth wireless feature Find and pair with other...

Страница 98: ...nternal antenna area or cover this area with your hands or other objects while using the GPS functions This feature may be unavailable depending on your region or service provider Activate location services You must activate location services to receive location information and search the map Open the application list and select 1 Settings Location and security Adjust the following settings to act...

Страница 99: ...r device to aWLAN to get information of yourTV and ensure that the infrared port is facing theTV Open the application list and select 1 SmartRemote Rotate the device anti clockwise to landscape orientation 2 Select an option next to 3 Set Up Smart Remote Now Select 4 Choose Brand the brand of yourTV Select 5 Test Power On Off Yes to check the connection between your device andTV Select 6 Done To a...

Страница 100: ...ur private network securely through a public network such as the internet Your device should already be configured with internet access If you have trouble accessing the internet you need to edit connections If you are not sure about the connection information to enter ask your service provider Set upVPN connections Open the application list and select 1 Settings Wireless and networks VPN settings...

Страница 101: ...dentify you You can import certificates from theVPN server or download from the web Set CA certificate Select a certificate authority CA certificate that theVPN server uses to identify you You can import certificates from theVPN server or download from the web DNS search domains Enter the domain name server DNS address When you are finished select 4 Save Connect to a private network Open the appli...

Страница 102: ...m sounds To stop the alarm drag in any direction until it reaches the border of the circle To repeat the alarm after a specified length of time drag in any direction until it reaches the border of the circle Delete an alarm Open the application list and select 1 Alarm Select an alarm to delete 2 Select 3 Delete OK You can delete or deactivate alarms by tapping and holding an alarm and selecting De...

Страница 103: ...downloaded from the web and email Open the application list and select 1 Downloads Select a download folder 2 To open a downloaded file select the log 3 To delete a log select the check box and then select eBook Learn to open and read books and PDF files Read books Open the application list and select 1 eBook If you are launching this application for the first time read 2 the disclaimer and select...

Страница 104: ...tap and hold a word and select Highlight from the pop up window To add a memo tap and hold a word and select Memo from the pop up window To search a word on the web tap and hold a word and select Search from the pop up window Create a drawing memo with the following tools 6 Tool Function Highlight the text Draw on the book Erase the drawing or highlight Customise the pen and highlight settings Imp...

Страница 105: ... voice select Select the item s name you want to access 3 My files Learn to quickly and easily access all of your images videos music sound clips and other types of files stored on your device Supported file formats Type Format Image Extension BMP GIF JPG PNG Video Extension 3gp mp4 avi divx wmv asf flv mkv webm Codec MPEG4 H 263 H 264 VC 1 DivX XviD VP8 WMV7 8 DivX3 11 Sorenson H 263 Music Extens...

Страница 106: ...ur when you open files Playback quality may vary by content type Some files may not play properly depending on how they are encoded Open a file Open the application list and select 1 My files Select a drop down menu at the top right of the screen 2 and select an option to sort the file list Select a folder 3 To move up one level in the file directory select To return to the top level of the file d...

Страница 107: ...check box next to files to send 2 Select 3 an option Delete files Open the application list and select 1 My files Select a check box next to folders or files to delete 2 Select 3 Yes Pen memo Learn to create sketch memos with various tools Open the application list and select 1 Pen memo Select 2 Create a drawing memo with the following tools 3 Tool Function Enter your text Write or draw on the scr...

Страница 108: ...e application list and select 1 Polaris Office If you are launching this application for the first time 2 register as an online user or skip the registration Select 3 New file a document type Enter contents in the document 4 When you are finished select 5 Enter a name for the document and select the location to 6 save the document Select 7 Save Open a document Open the application list and select ...

Страница 109: ...just the document to fit the screen select Reflow text To send a file to others select Send To read the document via the text to speech feature select Text to speech To print the file using aWLAN or USB connection select Print Your device is compatible only with some Samsung printers Manage documents online To add an account Open the application list and select 1 Polaris Office Select 2 Add accoun...

Страница 110: ...he list of all the applications currently running on your device Download View the total amount of memory used for applications installed on your device RAM manager Check and manage the RAM memory Storage View the used and available memory on your device and memory card Help View help information about extending battery life Voice Search Learn to use the voice command feature to search for locatio...

Страница 111: ...cation list and select 1 World clock Select 2 Enter a city name and select a city from the list 3 You can select a city in the world map view Select 4 To add more world clocks repeat steps 2 4 5 To apply the summer time to the clocks tap and hold a clock and select DST settings ...

Страница 112: ...y non network services Wi Fi Turn theWLAN feature on or off Wi Fi settings Wi Fi Turn theWLAN feature on or off p 90 Network notification Set the device to notify you when an open network is available Wi Fi sleep policy Set when the device will turn off the WLAN feature AddWi Fi networks AddWLAN APs manually Wi Fi Direct settings Wi Fi Direct Activate theWi Fi Direct feature to connect two devices...

Страница 113: ...th devices Visible time out Set duration that your device is visible Show received files View files received from other devices via the Bluetooth wireless feature Find nearby devices Search for available Bluetooth devices Tethering and portable hotspot USB tethering Activate the USB tethering feature to share your device s mobile network connection with PCs via USB When connected to a PC your devi...

Страница 114: ...e Packet data Set to allow packet switched data networks for network services Data roaming Set the device to connect another network when you are roaming or your home network is not available Access Point Names Set up access point names APNs Network Mode Select a network type Network operators Search for available networks and select a network for roaming Call Customise the settings for calling fe...

Страница 115: ...calls to numbers in the FDN list You must enter the PIN2 supplied with your SIM or USIM card and reboot the device Voicemail Voice mail service Select or set your service provider Voice mail numbe r Enter the number to access the voice mail service You can obtain this number from your service provider Additional settings Caller ID Display your caller ID to other parties for outgoing calls Call wai...

Страница 116: ... for call ringtones notifications media sounds alarm ringtones and system sounds Vibration intensity Adjust the vibration intensity of the haptic feedback Phone ringtone Select a ringtone to alert you to incoming calls Notification ringtone Select a ringtone to alert you to events Audible touch tones Set the device to sound when you touch the keys on the dialling screen Audible selection Set the d...

Страница 117: ... locked Mode Select a display mode Auto rotate screen Set whether or not to rotate the content automatically when the device is rotated Animation Set the device to display animation when you switch between windows Timeout Set the length of time the device waits before turning off the display s backlight Quick launch Select an application to create a shortcut You can launch the application by selec...

Страница 118: ...t in use Turn off Sync Turn off sync when the device is not synchronising with a web server Brightness Activate the brightness setting for Power saving mode Brightness Set the brightness level for Power saving mode Timeout Set the length of time the device waits before turning off the display s backlight Learn about power saving Learn how to reduce battery consumption Location and security Change ...

Страница 119: ...ce to protect data and information saved on the device Once the device is encrypted you must enter the password each time you turn on the device You must first charge the battery because it may take more than an hour to encrypt your device Encrypt SD card Encrypt SD card Protect your personal information by encrypting the data on your memory card Full encryption Set to encrypt all files on your me...

Страница 120: ...administrators to apply new policies to your device Use secure credentials Use certificates and credentials to ensure secure use of various applications Install from USB storage Install encrypted certificates that are stored in the USB storage Set password Create and confirm a password for accessing credentials Clear storage Erase the credential contents from the device and reset the password Appl...

Страница 121: ...service information to be sent to a Location Manager service for testing This is for application development Samsung Apps Select a network connection WLAN or packet switched data network to get notifications for new applications from Samsung Apps This feature may be unavailable depending on your region or service provider Accounts and sync Change the settings for the auto sync feature or manage ac...

Страница 122: ...left or right Privacy Change the settings for managing your settings and data Back up my data Set to back up your settings and application data to the Google server Backup account Add and view your Google account to back up your data Automatic restore Set to restore your settings and application data when the applications are reinstalled on your device Factory data reset Reset your settings to the...

Страница 123: ...offensive words your device recognised from voice search results Text to speech settings Listen to example Listen to the spoken text for an example Always use my settings Set to use the speech rate and language settings you specify over the settings saved in applications Default engine Set the speech synthesis engine to be used for spoken text Install voice data Download and install voice data for...

Страница 124: ...ype keyboard Personal dictionary Set up your own dictionary The words in your dictionary will appear as suggestions for your text inputs Preferences Audio feedback Set to alert you when there are no alternative words for your input if you double tap a word Vibrate on keypress Set the device to vibrate when you touch a key Show tips Set the device to automatically display tips for your actions when...

Страница 125: ...d keyboard Set the device to use the Android keyboard Active input methods Select languages for text input Settings Auto capitalisation Set the device to automatically capitalise the first letter after a final punctuation mark such as a full stop question mark or exclamation mark Vibrate on key press Set the device to vibrate when you touch a key Sound on key press Set the device to sound when you...

Страница 126: ...full stop Set the device to insert a full stop when you double tap the space bar Sound on keypress Set the device to sound when you touch a key Auto capitalization Set the device to automatically capitalise the first letter after a final punctuation mark such as a full stop question mark or exclamation mark Voice input Activate the voice input feature to enter text by voice on the Samsung keypad H...

Страница 127: ...ice to end a call when you press Tap and hold delay Set the recognition time for tapping and holding the screen Torch light Turn the torch light on or off Mono audio Enable mono sound when you listen to audio with one earbud Call answering ending The power key ends call Set the device to end a call when you press Automatic answering Set the device to answer an incoming call when you press the Home...

Страница 128: ...utomatic date and time Automatically update the date and time when you move across time zones Set date Set the current date manually Set time Set the current time manually Select time zone Set your home time zone Use 24 hour format Set to the time to be displayed in 24 hour format Select date format Select a date format About device Access information about your device check the device s status an...

Страница 129: ...n disable this feature by using the Lock SIM card menu PUK Your SIM or USIM card is blocked usually as a result of entering your PIN incorrectly several times You must enter the PUK supplied by your service provider PIN2 When you access a menu requiring the PIN2 you must enter the PIN2 supplied with the SIM or USIM card For details contact your service provider Your device displays network or serv...

Страница 130: ...pgraded to the latest version If the touch screen is scratched or damaged take it to your local Samsung Service Centre Your device freezes or has fatal errors If your device freezes or hangs you may need to close programs or reset the device to regain functionality If your device is frozen and unresponsive press and hold for10 15 seconds The device will reboot automatically If this does not solve ...

Страница 131: ...Ensure that the microphone is close to your mouth If using a headset ensure that it is properly connected Audio quality is poor Ensure that you are not blocking the device s internal antenna When you are in areas with weak signals or poor reception you may lose reception Move to another area and try again When dialling from contacts the call is not connected Ensure that the correct number is store...

Страница 132: ...pplication If you receive error messages when launching the camera try the following Charge the battery Free some memory by transferring files to a PC or deleting files from your device Restart the device If you are still having trouble with the camera application after trying these tips contact a Samsung Service Centre Error messages appear when opening music files Some music files may not play o...

Страница 133: ...o connect to if necessary Ensure that your device and the other Bluetooth device are within the maximum Bluetooth range 10 m If the tips above do not solve the problem contact a Samsung Service Centre A connection is not established when you connect the device to a PC Ensure that the USB cable you are using is compatible with your device Ensure that you have the proper drivers installed and update...

Страница 134: ...charging or touch your device with wet hands Do not short circuit the charger Do not drop or cause an impact to the charger or the device Do not charge the battery with chargers that are not approved by the manufacturer Do not use your device during a thunderstorm Your device may malfunction and your risk of electric shock is increased Handle and dispose of the device and chargers with care Use on...

Страница 135: ...e where prohibited Comply with all regulations that restrict the use of a mobile device in a particular area Do not use your device near other electronic devices Most electronic devices use radio frequency signals Your device may interfere with other electronic devices Do not use your device near a pacemaker Avoid using your device within a 15 cm range of a pacemaker if possible as your device can...

Страница 136: ...ts of the aircraft Electronic devices in a motor vehicle may malfunction due to the radio frequency of your device Electronic devices in your car may malfunction due to radio frequency of your device Contact the manufacturer for more information Comply with all safety warnings and regulations regarding mobile device usage while operating a vehicle While driving safely operating the vehicle is your...

Страница 137: ... in the case of fire traffic accident or medical emergencies Use your device to help others in emergencies If you see an auto accident a crime in progress or a serious emergency where lives are in danger call a local emergency number Call roadside assistance or a special non emergency assistance number when necessary If you see a broken down vehicle posing no serious hazard a broken traffic signal...

Страница 138: ...may malfunction or the battery may discharge from exposure to magnetic fields Magnetic stripe cards including credit cards phone cards passbooks and boarding passes may be damaged by magnetic fields Do not use carrying cases or accessories with magnetic closures or allow your device to come in contact with magnetic fields for extended periods of time Do not store your device near or in heaters mic...

Страница 139: ...When using your device for extended periods hold the device with a relaxed grip press the keys lightly and take frequent breaks If you continue to have discomfort during or after such use stop use and see a physician Ensure maximum battery and charger life Avoid charging batteries for more than a week as overcharging may shorten battery life Over time unused batteries will discharge and must be re...

Страница 140: ...avoid injury to yourself or others Do not carry your device in your back pockets or around your waist You can be injured or damage the device if you fall Do not disassemble modify or repair your device Any changes or modifications to your device can void your manufacturer s warranty For service take your device to a Samsung Service Centre Do not paint or put stickers on your device Paint and stick...

Страница 141: ...llow only qualified personnel to service your device Allowing unqualified personnel to service your device may result in damage to your device and will void your manufacturer s warranty Handle SIM cards or memory cards with care Do not remove a card while the device is transferring or accessing information as this could result in loss of data and or damage to the card or device Protect cards from ...

Страница 142: ... contact their supplier and check the terms and conditions of the purchase contract This product and its electronic accessories should not be mixed with other commercial wastes for disposal This EEE is compliant with RoHS Correct disposal of batteries in this product Applicable in the European Union and other European countries with separate battery return systems The marking on the battery manual...

Страница 143: ...NESS LEGALITY OR COMPLETENESS OF ANY CONTENT OR SERVICE MADE AVAILABLETHROUGH THIS DEVICE AND UNDER NO CIRCUMSTANCES INCLUDING NEGLIGENCE SHALL SAMSUNG BE LIABLE WHETHER IN CONTRACT ORTORT FOR ANY DIRECT INDIRECT INCIDENTAL SPECIAL OR CONSEQUENTIAL DAMAGES ATTORNEY FEES EXPENSES OR ANY OTHER DAMAGES ARISING OUT OF OR IN CONNECTIONWITH ANY INFORMATION CONTAINED IN OR AS A RESULT OF THE USE OF ANY C...

Страница 144: ...all log 58 calls answering 53 forwarding 57 international numbers 53 multiparty 54 rejecting 53 using headset 53 using options during voice 54 viewing missed 55 waiting 57 call waiting 57 camera customising camcorder 76 customising camera 73 recording videos 74 connections Bluetooth 93 PC 88 TV 101 VPN 102 WLAN 90 contacts copying 84 creating 82 importing or exporting 83 retrieving 83 device custo...

Страница 145: ...ettings about device 130 accessibility 129 accounts and sync 123 applications 122 call 116 date and time 130 language and input 125 email sending 62 viewing 63 file manager copying or cutting files 109 deleting files 109 opening files 108 supported file formats 107 find my mobile 34 fixed dialling number mode 56 Google Mail 60 Google Maps 47 GoogleTalk 64 home screen adding items 27 moving items 2...

Страница 146: ...s 90 usingWPS 91 world clock 113 YouTube 47 uploading videos 47 watching videos 47 location and security 120 motion 124 power saving mode 120 privacy 124 screen 119 sound 118 storage 124 wireless and networks 114 silent mode 30 SIM card installing 12 locking 33 sketch memo 109 SmartRemote 101 task manager 112 text input 35 text memos 87 text messages sending 58 viewing 59 time and date set 30 touc...

Страница 147: ...SXEOLF DQG WR DFFRXQW IRU DQ YDULDWLRQV LQ PHDVXUHPHQWV 6 5 WHVWV DUH FRQGXFWHG XVLQJ VWDQGDUG RSHUDWLQJ SRVLWLRQV DFFHSWHG E WKH ZLWK WKH SKRQH WUDQVPLWWLQJ DW LWV KLJKHVW FHUWLILHG SRZHU OHYHO LQ DOO WHVWHG IUHTXHQF EDQGV OWKRXJK WKH 6 5 LV GHWHUPLQHG DW WKH KLJKHVW FHUWLILHG SRZHU OHYHO WKH DFWXDO 6 5 OHYHO RI WKH SKRQH ZKLOH RSHUDWLQJ FDQ EH ZHOO EHORZ WKH PD LPXP YDOXH 7KLV LV EHFDXVH WKH SKR...

Страница 148: ...XO LQWHUIHUHQFH WR UDGLR FRPPXQLFDWLRQV RZHYHU WKHUH LV QR JXDUDQWHH WKDW LQWHUIHUHQFH ZLOO QRW RFFXU LQ D SDUWLFXODU LQVWDOODWLRQ I WKLV HTXLSPHQW GRHV FDXVH KDUPIXO LQWHUIHUHQFH WR UDGLR RU WHOHYLVLRQ UHFHSWLRQ ZKLFK FDQ EH GHWHUPLQHG E WXUQLQJ WKH HTXLSPHQW RII DQG RQ WKH XVHU LV HQFRXUDJHG WR WU WR FRUUHFW WKH LQWHUIHUHQFH E RQH RU PRUH RI WKH IROORZLQJ PHDVXUHV 5HRULHQW RU UHORFDWH WKH UHFHLY...

Страница 149: ...LHV PD EH GDQJHURXV DQG YRLG WKH SKRQH ZDUUDQW LI VDLG DFFHVVRULHV FDXVH GDPDJH RU D GHIHFW WR WKH SKRQH OWKRXJK RXU SKRQH LV TXLWH VWXUG LW LV D FRPSOH SLHFH RI HTXLSPHQW DQG FDQ EH EURNHQ YRLG GURSSLQJ KLWWLQJ EHQGLQJ RU VLWWLQJ RQ LW ...

Страница 150: ...detailed in Annex IV of Directive 1999 5 EC has been followed with the involvement of the following Notified Body ies BABT Forsyth House Churchfield Road Walton on Thames Surrey KT12 2TD UK Identification mark 0168 The technical documentation kept at Samsung Electronics QA Lab which will be made available upon request Representative in the EU Samsung Electronics Euro QA Lab Blackbushe Business Par...

Отзывы: