CLEANING AND MAINTENANCE
Warning!
$OZD\VXQSOXJWKHDSSOLDQFHEHIRUHFOHDQLQJLW/HWWKHDSSOLDQFHWRFRROGRZQIRUDIHZ
minutes.
Warning!
Never immerse the appliance in water or other liquids.
Warning!
Check the state of the power cable of your appliance on a regular basis before using it, and if it
is damaged, take it to the service centre closest to you to have it replaced only by specialised
personnel.
Do not use abrasive products for cleaning the appliance.
'RQRWSRXUGHVFDOLQJSURGXFWVRURWKHUVFHQWHGVXEVWDQFHVLQWRWKHWDQN2WKHUZLVHWKH
warranty may be revoked.
Cleaning the appliance
To prevent lime residue from forming, empty the tank following use and after having turned off the
appliance and unplugged it from the socket-outlet.
Clean the water tank from time to time by putting fresh water in it. To remove limestone deposits
IURPWKHWDQNDGGDWDEOHVSRRQRIYLQHJDU5LQVHDQGHPSW\'RQRWWXUQRQWKHDSSOLDQFH
Clean plastic parts with a damp, non-abrasive cloth and dry them with a dry cloth.
)ROORZWKHLQVWUXFWLRQVRQWKHODEHOWRFOHDQWKHZDVKDEOHFORWK
Limestone cleaning
Damage caused by limescale is not covered by warranty.
$JRRGPDLQWHQDQFHDQGUHJXODUFOHDQLQJSUHVHUYHDQGPDLQWDLQWKHDSSOLDQFHHI¿FLHQWIRUDORQJHU
period greatly reducing the risk of scale formation. If despite this, after some time, the appliance
function should be compromised, due to constant use of hard and very hard water, it is possible to
carry out a descaling operation to eliminate the malfunction.
Perform the cleaning once every three months. If very hard water is used clean every month.
Warning!
Never leave the appliance unattended while in use.
Carry out the scale cleaning operation in a ventilated room. When cleaning the limescale, ap-
ply steam to a resistant surface or on a washable cloth. Do not breathe the vapours produced
during the descaling cleaning.
)LOOWKHWDQNZLWKDPL[WXUHRIZKLWHYLQHJDUDQGRIIUHVKFOHDQZDWHU
3RXUWKHPL[WXUHLQWKHWDQN
3ODFHWKHDSSOLDQFHVRWKDWWKHVWHDPLVQRWGLVSHQVHGRQDQ\REMHFWRUVXUIDFH
3OXJLQWRWKHPDLQVVRFNHW
Turn the steam control knob (E). Leave the appliance into operation
IRUDWOHDVWRQHPLQXWH7XUQWKHVWHDPFRQWURONQRE(RQ0,1/HDYHRIIWKHDSSOLDQFHIRUD
PLQXWH5HSHDWXQWLOWKHUHOHDVHRIVWHDPLVQRWLFHG
Let the all the steam come out until there
is no more solution in the tank. If necessary, repeat the operation.
23
EN
Summary of Contents for 1122996
Page 3: ...Fig 19 CLICK Fig 18 Fig 17 Fig 14 Fig 15 Fig 16...
Page 80: ...80 EL...
Page 81: ...81 EL...
Page 82: ...ULHWH 82 EL...
Page 83: ...83 EL...
Page 84: ...3 4 5 0 1 2 G 61 9 84 EL...
Page 85: ...PO PO PO I 85 EL...
Page 86: ...2 PO PO 2 86 EL...
Page 87: ...87 EL...
Page 88: ...88 EL...
Page 89: ...0 1 PO 89 EL...
Page 90: ...PO PO 90 EL...
Page 91: ...91 RU...
Page 92: ...92 RU...
Page 93: ...ULHWH 93 RU...
Page 94: ...94 RU...
Page 95: ...95 RU...
Page 96: ...3 4 5 0 1 2 0RG 61 96 RU...
Page 97: ...I 97 RU...
Page 98: ...2 2 98 RU...
Page 99: ...99 RU...
Page 100: ...100 RU...
Page 101: ...0 1 101 RU...
Page 102: ...102 RU...
Page 108: ...L 6 350 350 K 350 50 50 20 f 7 E D 8 E 15 18 OFF E 5 350 K L 6 350 108 AR...
Page 109: ...OFF E 16 5 I 18 L 17 19 17 J A H 3 3 11 10 12 109 AR...
Page 110: ...9 J A H 3 9 10 13 14 15 110 AR...
Page 111: ...2 3 1 3 1 2 3 E 4 MIN E 5 6 350 6 7 111 AR...
Page 112: ...350 6 350 6 5 112 AR...
Page 113: ...Rys 19 KLIK Rys 18 Rys 17 Rys 14 Rys 15 Rys 16...