manualshive.com logo in svg

ABB REACT 2 Series, Product Manual

Share
Download
ABB REACT 2 Series Product Manual Download Page 88

- 88 -

000901AG

5 - Installation

I

nput connection to PV generator (DC side)

Once preliminary checks have been carried out and no problems found with 

WKHSKRWRYROWDLFV\VWHPDQGWKHFKDQQHOFRQ¿JXUDWLRQKDVEHHQVHOHFWHG

(parallel or independent) you may connect the inputs to the inverter.

Check for correct polarity in the input strings and absence of any leakage to ground in the PV 
generator. When exposed to sunlight, the PV panels supply DC direct voltage to the inverter. 
The inside of the inverter may only be accessed after the equipment has been disconnected 
from the grid and from the photovoltaic generator.

:DUQLQJ 7KH LQYHUWHUV WR ZKLFK WKLV GRFXPHQW UHODWHV WR DUH :,7+287 ,62/$7,21
75$16)250(5WUDQVIRUPHUOHVV7KLVW\SHLQYROYHVWKHXVHRILQVXODWHGSKRWRYROWDLFSDQHOV
,(&&ODVV$5DWLQJDQGWKHQHHGWRPDLQWDLQWKHSKRWRYROWDLFJHQHUDWRUÀRDWLQJZLWK

respect to earth: no pole of the generator must be connected to earth.

To avoid risks of electrical shock, all wiring operations must be carried out with the DC disconnect 
switch internal and external (if present, applying LOTO procedures on it) to OFF position and 
with the external AC disconnect switch to OFF position (applying LOTO procedures on it).

)RUWKHFRQQHFWLRQVRIWKHVWULQJVWKHTXLFN¿WFRQQHFWRUVRQHIRUHDFKSROH

of each string) located on the lower side of the REACT2-UNO are used.

‡&RQQHFWDOOWKH

strings required by the system, always checking the 

seal of the connectors. 
The number of connections for each input channel is 2 pairs of 
connectors.

‡*LYHDSXOOWHVWWRFRQ¿UPWKHFRQQHFWLRQLVVHFXUH

&RQQHFW GLUHFWO\ WKH LQGLYLGXDO LQSXW VWULQJV WR WKH 5($&7812 6KRXOG LW EH QHFHVVDU\ WR
PDNHSDUDOOHOVWULQJVRXWVLGHWKHLQYHUWHUWKHPD[LPXPFXUUHQWDOORZHGE\WKHLQGLYLGXDOTXLFN¿W

connector must be respected, which is 18A.

Polarity inversion can cause serious damage. Check polarity before connecting each string!

$FFRUGLQJWRWKHV\VWHPFRQ¿JXUDWLRQFKHFNWKHFRUUHFWVHWWLQJRIWKHFKDQQHOVWRLQGHSHQGHQWRU

in parallel mode. An incorrect setting of the input channels can lead to loss of energy production.

‡,IDQ\VWULQJLQSXWVDUHQRWUHTXLUHG\RXPXVWHQVXUHWKDWFRYHUVDUH

installed to the connectors, and install any which are missing. This is 
necessary both for the inverter grade IP seal, and to avoid damage to 
the free connector which may be used at a later time.

PV

BATTERY

DC SWITCH

GRID

BACKUP

METER

POWER

COMM.

18

19

Summary of Contents for REACT 2 Series

Page 1: ...ABB solar inverters Product manual REACT 2 3 6 to 5 0 kW ...

Page 2: ...e a secure connection between the product and the user s network or any other network as the case may be The user shall establish DQG PDLQWDLQ DQ DSSURSULDWH PHDVXUHV VXFK DV EXW QRW OLPLWHG WR WKH LQVWDOODWLRQ RI UHZDOOV DSSOLFDWLRQ RI authentication measures encryption of data installation of anti virus programs etc to protect the product the network its system and the interface against any kind...

Page 3: ...ion and general information 2 Characteristics 3 Safety and accident prevention 4 Lifting and transport 5 Installation 6 Instruments 7 Operation 8 Maintenance 9 Attachments REACT2 3 6_5 0 TL OUTD Product Manual EN RevA M000044AG EFFECTIVE 18 10 2018 Copyright 2018 ABB All Rights Reserved ...

Page 4: ...d with the manufacturer concerning either hardware or software shall result in the immediate cancellation of the warranty The customer is fully responsible for any changes made to the system LYHQ WKH FRXQWOHVV DUUD RI V VWHP FRQ JXUDWLRQV DQG LQVWDOODWLRQ environments possible it is essential to check the following adequate spaces suitable for housing the equipment airborne noise produced based on...

Page 5: ... field of use 16 Improper or disallowed use 17 Characteristics 18 General conditions 18 Models and range of equipment 19 Identification of the equipment and manufacturer 20 Communication identification label 21 Characteristics and technical data 22 Tightening torques 25 Overall dimensions REACT2 3 6 5 0 TL OUTD 26 Overall dimensions REACT MTR 1PH 27 Overall dimensions Meter ABB B21 27 Overall dime...

Page 6: ...idual risks 50 Lifting and transport 51 General conditions 51 Storage of equipment 52 Special rules for storage of REACT2 BATT 52 Lifting 53 Equipment weight 53 Transport of the equipment 54 Road transport of Battery Unit 54 Unpacking and checking 55 General Handling Information 55 List of components supplied 55 Installation 57 General conditions 57 Environmental checks 58 Wireless signal environm...

Page 7: ...nfiguration of parallel connected channels 87 Input connection to PV generator DC side 88 Installation procedure for quick fit connectors 89 Communication and control signal connections 93 External backup command connection 94 Remote control connection 94 5V output connection 95 Connection of RS485 LOGGER serial communication line 95 Ethernet connection 97 Configurable Relay connection OUTPUT 1 an...

Page 8: ...istration on website and calculation of Admin Plus password 149 Verification of ground leakage 152 Behaviour of a system without leakage 152 Behaviour of a system with leakage 153 Measuring the insulation resistance of photovoltaic generator 154 Storage and dismantling 155 Storage of the equipment or prolonged stop 155 Dismantling decommissioning and disposal 155 Attachments 156 Port and network s...

Page 9: ...O external protective earth 40 Communicationandcontrolsignalscrewterminalblock 12 Input connectors MPPT2 IN2 41 Multifunctional relay screw terminal block 13 Service cable gland 42 AC output BACKUP screw terminal block 14 METER connector 43 AC output GRID screw terminal block 15 Wi Fi antenna connector 44 Cable conduit 16 AC output BACKUP cable gland 50 Meter ABB B21 17 AC output GRID connector 51...

Page 10: ...hical representation of references REACT2 UNO 3 6 5 0 TL external view PV BATTERY DC SWITCH GRID BACKUP METER POWER COMM 12 13 15 14 16 17 03 04 05 02 01 08 09 10 11 07 06 REACT2 BATT external view COMM B POWER B COMM A POWER A 22 23 09 08 24 26 25 20 21 26 ...

Page 11: ...IN1 METER 485 CARD PC 485 CARD LOGGER 485 CARD RS485 LOGGER RS485 METER RS485 PC T R T R RTN T R T R RTN N C N C C C N O N O METER 485 CARD PC 485 CARD LOGGER 485 CARD RS485 LOGGER RS485 METER RS485 PC T R T R RTN T R T R RTN N C N C C C N O N O MEMORY CARD 33 34 35 36 37 38 39 42 43 40 41 44 31 30 32 ...

Page 12: ...85AG 1 Introduction and general information REACT MTR 1PH Meter ABB B21 Meter ABB B23 B24 REACT MTR 1PH S U T A T S E R U S A E M INPUT 110 230 V 50 60 Hz 10 mA max 54 53 52 51 56 56 57 55 3 COMM 5 53 54 53 50 ...

Page 13: ...rmation considered necessary for the use and routine maintenance of the equipment Operator and maintenance personnel skills prerequisites Personnel in charge of using and maintaining the equipment must be skilled for the described tasks and must reliably demonstrate their capacity to correctly interpret what is described in the manual RU VDIHW UHDVRQV RQO D TXDOL HG HOHFWULFLDQ ZKR KDV UHFHLYHG WU...

Page 14: ... of hot zones or zones with parts at high temperatures risk of burns Risk of explosion Risk of injury due to the weight of the equipment Take care during lifting and transport Indicates that the area in question must not be accessed or that the operation described must not be carried out Keep out of the reach of children QGLFDWHV WKDW VPRNLQJ DQG WKH XVH RI QDNHG ÀDPHV LV SURKLELWHG Indicates that...

Page 15: ...E WKH OHWWHUV LV SURYLGHG RQ WKH LGHQWL FDWLRQ ODEHO DC Direct Current AC Alternate current With isolation transformer Without isolation transformer Positive pole of the input voltage DC Negative pole of the input voltage DC Indicates the centre of gravity of the equipment Indicates the requirement to wear acoustic protection devices in order to prevent damage to hearing ...

Page 16: ... PHWHU which measures energy at the connection point to the grid and communicates with REACT2 in order to maximise energy self VXI FLHQF E PDQDJLQJ WKH VWRUDJH V VWHP Limits in field of use The REACT2 system can be used only with photovoltaic modules which do not require the grounding of one of the input poles unless accessories are installed which are compatible with the inverter and enable this ...

Page 17: ... RWKHU machines or equipment unless expressly provided for 0RGLI RSHUDWLQJ SDUDPHWHUV WKDW DUH QRW DFFHVVLEOH WR WKH RSHUDWRU DQG or parts of the equipment to vary its performance or change its insulation OHDQ the equipment with corrosive products that may attack parts or generate electrostatic charges 8VH RU LQVWDOO WKH DSSOLDQFH RU SDUWV RI LW ZLWKRXW KDYLQJ UHDG DQG understood the contents of t...

Page 18: ...overall dimensions and HTXLSPHQW LGHQWL FDWLRQ The customer Installer takes full responsibility if when reading this manual the chronological order of its presentation provided is not observed All information is provided considering occasional inclusion of information in previous chapters In certain cases there may be a need to separately document softwa re functionality or attach supplementary do...

Page 19: ...V WKURXJK LQWHJUDWHG UHOD V DFNXS 2XWSXW RII JULG Battery unit REACT2 BATT nominal battery capacity 4kWh In the system up to three REACT2 BATTs can be used maximum capacity of the system 3x4kWh 12kWh Energy meter REACT MTR 1PH energy meter for single phase line ABB B21 212 energy meter for single phase line ABB B23 212 B24 212 energy meter for three phase line 7KH FKRLFH RI WKH FRPSRQHQWV IRU WKH ...

Page 20: ...0 575 V Idc max charge 13 5 A Idc max discharge 10 A Smax 3600 VA 3 2 4 1 Vdc max Idc max Vdc Operating Range Vdc MPP Isc max Vacr fr Iac max Pacr cos 0 9 φ Vacr fr Sacr Iac max MODEL REACT2 UNO 5 0 TL 575 V 90 575 V 2 x 13 5 A 195 480 V 2 x 15 A Made in Italy PROTECTIVE CLASS I 230 V 1Ø 50 Hz 4500 W 5000 W 22 A INVERTER SOLAR www abb com solar PROTECTIVE EARTHING REQUIRED 230 V 1Ø 50 Hz 3000 VA 1...

Page 21: ...HVV To be used to obtain the SSID of the wireless access point created by the inverter ABB XX XX XX XX XX XX where X is a hex digit of the MAC address To be used to obtain the Host Name http ABB XX XX XX XX XX XX local where X is a hex digit of the MAC address MAC address it s the only required information to register the inverter with Aurora Vision 3URGXFW H To be used as wireless access point pa...

Page 22: ... W 39 FRQQHFWRU 1 PV port protection Reverse polarity protection Yes from current limited source Input overvoltage protection for each MPPT varistor Yes Photovoltaic array isolation control According to local standard DC switch rating for each MPPT 25 A 575 V Output AC port AC grid connection type Single phase 5DWHG SRZHU 3DFU FRVij 3600 W 5000 W 2 0D LPXP RXWSXW SRZHU 3DFPD FRVij 3600 W 5000 W 2 Ma...

Page 23: ...bient temperature range 20 55 C with derating above 50 C 20 55 C with derating above 45 C Relative humidity 4 100 condensing Acoustic noise emission level 50 dB A 1 m Maximum operating altitude without derating 2000 m 6560 ft QYLURQPHQWDO SROOXWLRQ GHJUHH FODVVL FDWLRQ IRU H WHUQDO environments 3 Environmental class Outdoor Suitable for wet location Yes Physical Environmental protection rating IP6...

Page 24: ...e battery will be disabled Suggested ambient temperature 5 30 C Storage temperature 20 25 C 6 months or 20 45 C 3 months Relative humidity 4 100 condensing Physical Cooling Natural Dimension H x W x D 740 mm x 490 mm x 229 mm Weight 50 kg Mounting system Wall bracket Safety Protective class I Marking CE Safety IEC 62619 UN38 3 UN3480 Energy meter REACT MTR 1PH Single phase 20A ABB B21 212 Single p...

Page 25: ...REACT2 UNO external protective earth 11 4 1 Nm Multifunction relay screw terminal block 41 1 5 mm2 Max 0 25 Nm REACT2 BATT REACT2 BATT external protective earth A 25 4 1 Nm REACT2 BATT external protective earth B 24 4 1 Nm REACT MTR 1PH Single phase METER RS485 serial screw terminal block 54 1 5 mm2 Max 0 5 Nm AC power supply screw terminal block 53 4 mm2 Max 0 5 Nm Meter ABB B21 Single phase METE...

Page 26: ...nsions REACT2 3 6 5 0 TL OUTD The overall dimensions are expressed in millimetres and include the wall installation bracket 490mm 490mm 985mm 2 2 9 m m 740mm 740mm 490mm 490mm 490mm 1480mm 2 2 9 m m 740mm 490mm 490mm 490mm 1975mm 2 2 9 m m 490mm ...

Page 27: ...dimensions are given in mm Overall dimensions Meter ABB B21 The overall dimensions are given in mm Overall dimensions Meter ABB B23 B24 The overall dimensions are given in mm REACT MTR 1PH S U T A T S E R U S A E M INPUT 110 230 V 50 60 Hz 10 mA max 100 64 53 35 97 65 97 65 70 ...

Page 28: ... 22 000888AG 2 Characteristics Dimensions bracket REACT2 UNO 3 6 5 0 TL The dimensions of the wall mounting bracket are expressed in mm 401 5 0 5 6 5 6 5 57 63 75 350 417 5 9 15 17 5 15 9 70 ...

Page 29: ... 23 000888AG 2 Characteristics Dimensions bracket REACT2 BATT The dimensions of the wall mounting bracket are expressed in mm 39 325 139 5 503 5 40 102 5 22 22 290 9 15 15 9 68 50 5 30 5 27 4 22 68 ...

Page 30: ...below The HI FLHQF FXUYHV DUH OLQNHG WR WHFKQLFDO SDUDPHWHUV WKDW DUH FRQWLQXDOO EHLQJ GHYHORSHG and improved and should therefore be considered approximate REACT2 UNO 3 6 TL REACT2 UNO 5 0 TL 84 86 88 90 92 94 96 98 100 Efficiency of Rated Output Power 470 Vdc 390 Vdc 200 Vdc 0 10 20 30 40 50 60 70 80 90 100 I FLHQF FXUYHV 84 86 88 90 92 94 96 98 100 Efficiency of Rated Output Power 470 Vdc 390 V...

Page 31: ...nvironmental conditions The power reduction value and the inverter temperature at which it occurs depend on the ambient temperature and on many operating parameters Example input voltage grid voltage and power available IURP WKH SKRWRYROWDLF HOG The inverter can therefore reduce the power during certain periods of the day according to the value of these parameters In any case the inverter guarante...

Page 32: ...tion 50 75 100 Maximum Input Voltage V 95 90 85 80 70 65 60 55 1000 3280 1200 3937 1400 4593 1600 5249 1800 5905 2000 6561 Altitude mt and ft 2200 7217 2400 7874 2600 8530 2800 9186 3000 9842 Altitude Vs Max input voltage 50 75 100 Normalized temperature Tmax derated Tmax sea level 95 90 85 80 70 65 60 55 1000 3280 1200 3937 1400 4593 1600 5249 1800 5905 2000 6561 Altitude mt and ft 2200 7217 2400...

Page 33: ... power available and the setting of the control algorithm For input voltages below 90Vdc the output power of the inverter could be different from zero should the battery be low Vin V Pout 0 20 30 40 50 60 70 80 90 100 0 50 100 150 200 250 300 350 400 450 500 550 600 10 Pout Vs Vin The operating point of REACT2 inside the area of the diagram depends on the level of charge of the battery ies the PV ...

Page 34: ...es below 90Vdc the batteries can only be charged from the grid while over 90Vdc the batteries can be charged from the photovoltaic system and or from the grid at the same time Vin V Pin W 0 500 1000 1500 2000 2500 3000 3500 4000 4500 5000 0 50 100 150 200 250 300 350 400 450 500 550 600 5500 6000 Pin Vs Vin For input voltages below 90Vdc the batteries can only be charged from the grid while over 9...

Page 35: ...nt power Sn 3600VA Maximum reactive power Qn 2200VAR Cos 0 1 1 0 1 REACT2 UNO 5 0 TL Rated output voltage Un 230Vac Rated active power Pn 5000W Maximum apparent power Sn 5000VA Maximum reactive power Qn 3000VAR Cos 0 1 1 0 1 P 20 10 Q Pn P 0 10 20 30 40 50 60 70 90 100 80 100 90 80 70 60 50 40 30 20 10 0 10 20 30 40 50 60 70 80 90 100 0 10 20 30 40 50 60 70 90 80 00 Capability P Q REACT2 UNO 3 6 T...

Page 36: ...ystem mainly associated to wiring on the DC side of the inverter and subsequent distribution on the AC side A photovoltaic panel consists of many photovoltaic cells mounted on the same support VWULQJ FRQVLVWV RI D FHUWDLQ QXPEHU RI SDQHOV FRQQHFWHG LQ VHULHV Q array consists of two or more strings connected in parallel Large photovoltaic systems can include multiple arrays connected to one or more...

Page 37: ...blets 5 7 77 EDWWHU XQLW It temporarily stores the unused energy from the photovoltaic generator The energy stored will subsequently be used whenever the demand for energy is greater than that produced by the generator HQHUJ PHWHU It measures the energy at the connection point to the grid and communicates with REACT2 in order to manage the storage system Based on of domestic consumption and the le...

Page 38: ...tery allowing simpler installation and best performances Meter Utility meter Grid House RS 485 REACT 2 DC line AC line 5HWUR W H LVWLQJ 39 V VWHP REACT 2 can be installed together with an existing PV inverter on AC side of the home grid functioning as battery manager only Existing solar inverter Meter Utility meter Grid House RS 485 REACT 2 DC line AC line ...

Page 39: ...ACT 2 is equipped with 2 WIFI connections 2 Ethernet connections Free connection to Aurora Vision cloud Dedicated mobile app for home owner REACT 2 Smartphone Tablet Desktop Aurora Vision Database Ethernet Router Modem Mobile App Wi Fi network Router Modem ...

Page 40: ...TT 2 Once the batteries are fully charged the system powers the utilities and unused energy is fed into the grid During this stage it is possible that the maximum limit on active power fed into the grid that was set by the operator may be exceeded in this case the REACT2 system can automatically limit the feeding of active power to the grid 3 When the energy supplied by the PV generator LV LQVXI F...

Page 41: ...to the installation position irradiation and according to the domestic consumption Communication and monitoring REACT2 is equipped with a buil in Wi Fi Ethernet logger which enables WKH FRQ JXUDWLRQ DQG PRQLWRULQJ RI WKH V VWHP 7KH HPEHGGHG GDWD logger and direct transferring of data to a secure cloud platform allows customers to monitor and keep their system under control through the dedicated mo...

Page 42: ...ce of the normal parameters that allow the inverter to connect to the grid but will also depend on the external on off command Reactive power feed into the grid The inverter is able to produce reactive power and can feed this power into the grid when the phase factor is set Managing the feed can be controlled directly by the grid company via a dedicated RS485 serial interface or set by the install...

Page 43: ...ual current detection Remote control R R Output 1 N C N O C Output 2 N C N O C L N AC Output AC Backup Output REACT2 UNO Charger Discharger DC DC REACT2 BATT Opt Switch T R T R RTN T R T R RTN WIFI LAN1 LAN2 RS485 PC RS485 METER T R T R RTN RS485 LOGGER Protection Battery pack DC DC DSP contr DC AC DSP contr μP Control circuit BMS DSP Charger Discharger DC DC REACT2 BATT Opt Protection Battery pac...

Page 44: ...panel REACT2 BATT state of health SOH 7KH VWDWH RI KHDOWK 62 LV GH QHG DV WKH UHODWLRQ EHWZHHQ WKH FXUUHQW capacity and the nominal capacity of the battery 4kWh The SOH trend is constantly decreasing for natural aging linked to the use of the battery and is not an indication of its malfunction The downward inclination of the degradation capacity depends on the actual use and in particular on the n...

Page 45: ...Itisessentialtoprovideoperatorswithcorrectinformation Theymustthereforereadandcomply with the technical information provided in the manual and in the attached documentation The instructions provided in the manual do not replace the safety devices and technical data for installation and operation labels on the product and they do not replace the safety regulations in force in the country of install...

Page 46: ...he equipment is not designed to operate in environments that are particularly LQÀDPPDEOH or explosive IThe customer and or installer must appropriately train operators or anyone who may come into close proximity of the equipment and highlight with notices or other means where necessary the hazardous areas or operations at risk PDJQHWLF HOGV KD DUGRXV YROWDJHV KLJK WHPSHUDWXUHV SRVVLEOH GLVFKDUJHV ...

Page 47: ... that can compromise personal safety All operations on the equipment should be performed with suitably insulated clothing and tools E g insulating gloves class 0 RC category Maintenance operations may only be performed after the correct procedure for taking the equipment out of service has been carried out Personnel must NOT go near the equipment with bare feet or wet hands Themaintenancetechnicia...

Page 48: ...mmediately with water for at least 15 minutes Remove clothing if soiled Seek immediate medical attention Electrolyte Vent Product 2UJDQLF VROYHQW HOHFWURO WH YHQW SURGXFWV DUH ÀDPPDEOH 7R DYRLG RI ÀDPPDEOH SURGXFWV WKH IROORZLQJ JXLGHOLQHV PXVW EH REVHUYHG 2SHUDWH WKH DWWHU 6 VWHP XQGHU FRQGLWLRQV RQO DV VSHFL HG HHS VSDUNV ÀDPHV DQG VPRNLQJ PDWHULDOV DZD IURP WKH DWWHU Do not incinerate puncture ...

Page 49: ... changes in colouring deformation or other anomalous conditions during use including charging and storage do not use it 87 21 7KH FDXWLRQ PHVVDJHV VHW RXW EHORZ DUH XVHG WR LQGLFDWH ULVNV RU GDQJHURXV actions which could cause serious harm to people or damage to property Do not use or leave exposed to direct sunlight or in a vehicle which is exposed to the sun The REACT2 BATT could produce heat sm...

Page 50: ...uitable for the system Overheating of surfaces at temperature transformers accumulators coils etc can cause burns Also be careful not to block the cooling slits or systems of the equipment Use suitable protective equipment or wait for the parts to cool down before switching on the equipment Inadequate cleaning compromises cooling and does not allow the safe ty labels to be read Clean the equipment...

Page 51: ...s containing the equipment can be done using pallet trucks or forklifts by picking up the pallet in the area intended for lifting The transport of individual boxes containing the equipment must be done using suitable means and with careful supervision by authorised staff The accident and safety prescriptions for handling and lifting operations must be complied with 4 Lifting and transport ...

Page 52: ... Storage humidity shall be less than 80 RH non condensing Capacity degradation will occur depending on storage time temperature and humidity To minimize capacity degradation storing in a dry place with temperature less than 25 C For the rules on storing the battery refer to the regulations in force in the country concerned In addition to the regulations in force in the Country of interest the foll...

Page 53: ...or can be inserted The number of required operators necessary to lift the equipment must be in accordance to local regulations relating lifting limits per operator The ropes and means used for lifting must be suitable for bearing the weight of the equipment Do not lift several units or parts of the equipment at the same time unless otherwise indicated Equipment weight 5LVN RI LQMXU GXH WR WKH ZHLJ...

Page 54: ... is from 5 C to 40 C The manufacturer guarantees the characteristics of the REACT2 BATT only if the aforementioned condition is respected Transport of new batteries The transport of Battery Units must comply with the general application of the ADR For any exemptions please refer to paragraphs 1 1 3 1 and 1 1 3 6 of the ADR document Transport of end of life batteries Besides complying with the gene...

Page 55: ...the ABB Service General Handling Information When the REACT2 BATT is out of the package pay attention to Do not short circuit the positive and negative Avoid contacting between the metals and the battery unit Do not use seriously scarred or deformed battery unit Do not damage sheath of connectors List of components supplied Inside the package the following components required to correctly install ...

Page 56: ...inverters r Technical documentation 1 Components supplied together with the inverter REACT2 BATT Components available for REACT2 BATT Quantity Bracket for REACT2 BATT wall mounting 1 REACT2 BATT power connection cable 1 REACT2 BATT signal connection cable 1 Cable lug for earth cable 2 0 KH QXWV 0 ÀDW ZDVKHU DQG 0 VHUUDWHG ORFN ZDVKHUV IRU protective earth cable installation 1 1 1 In addition to wh...

Page 57: ...skills and knowledge on the structure and operation of the unit may install the inverter 7KH LQVWDOODWLRQ PXVW EH SHUIRUPHG E TXDOL HG LQVWDOOHUV DQG RU OLFHQVHG HOHFWULFLDQV LQ DF cordance with the existing regulations in the country of installation The removal of the inverter panels covers allows access to the area dedicated to service personnel the operator is not authorized to access this area...

Page 58: ...OH VXEVWDQFHV R QRW LQVWDOO LQ ORFDWLRQV ZLWK D FRQVWDQW SUHVHQFH RI ZDWHU DQG RU KLJK humidity level 5HVSHFW WKH PLQLPXP GLVWDQFHV IURP REMHFWV DURXQG WKH 5 7 UNO and REACT2 BATT that could prevent the inverter installation and UHVWULFW RU EORFN WKH DLU ÀRZ 7KH LQVWDOODWLRQ PXVW WDNH DFFRXQW RI DQ HOHFWULFDO GHYLFHV H J ODPSV switches etc which must be at least 20cm from the equipment These dista...

Page 59: ...stem T2 Correct operation of the REACT2 system with possible reduction of power T3 Operation limited to the inverter part only Management of the battery is disabled 20 10 0 5 30 40 55 T1 T2 T3 C T2 T3 7KH 5 7 812 DQG 5 7 77 FDQ EH LQVWDOOHG VHSDUDWHO using the standard cable Moreover in case of greater distances the LQVWDOODWLRQ LV SRVVLEOH XVLQJ WKH 5 7 7 FDEOH NLW meter cables length Hardware an...

Page 60: ...er from a position which is close to the installation site of the inverter The radio signal level between the inverter and the wireless router can be improved in a number of ways 1 Change the direction of the antenna The antenna has a dead zone at its tip which should not be positioned IDFLQJ WKH ZLUHOHVV URXWHU DV VKRZQ LQ WKH JXUH 2 Find a new position for the router considering the different ty...

Page 61: ... damage the device As the altitude increases the failure rate of some electronic components increases exponentially The inverter operates normally up to 2000 meters Above 2000 meters the inverter works in derating second curve derating by altitude Installations with a high level of humidity Never open the inverter in the case of rain snow or a level of humidity 95 Always carefully seal all unused ...

Page 62: ...BATT Alternatively is possibletoinstalltheREACT2 BATT separately and at greater distances XVLQJ WKH 5 7 7 cable kit 2 meter cables length 3RVLWLRQ WKH 5 7 77 EUDFNHW 20 so that it is perfectly level on the wall and use it as a drilling template To aling the two brackets use the reference point and follow the steps as in the picture W LV WKH LQVWDOOHU V UHVSRQVLELOLW WR FKRRVH an appropriate type o...

Page 63: ...insert the heads of two anchor points present on the back of the battery unit into the slots on the bracket 20 Risk of injury due to the heavy weight of the equipment Hang up the lower part of the REACT2 BATT to the wall using the two anchor points 26 holes diameter 11 mm ...

Page 64: ...art of the REACT2 UNO to the wall using the one anchor point hole diameter 11mm DUHIXOO OLIW WKH 5 7 812 and hook it to the bracket 01 by inserting the two supports in the slots on the inverter Risk of injury due to the heavy weight of the equipment ...

Page 65: ...as insulating gloves 3URFHHG ZLWK LQVWDOODWLRQ RI WKH ABB energy meter 22 22 5HPRYH WKH FDSV IURP WKH EDWWHU connectors To remove the battery signal connectors 08 simply pull it To remove the battery power connectors 09 press the latch highlighted in red and pull it off RQQHFW WKH WZR EDWWHU FDEOHV between inverter and battery unit supplied inside the REACT2 BATT box Give each cable a pull test to...

Page 66: ...e W LV WKH LQVWDOOHU V UHVSRQVLELOLW to choose an appropriate type of screw anchors for the attachment points The choice must be based on the type of support wall frame or other support the type of anchors to be used and their ability to support 4 times the inverter s weight 4x50Kg 200Kg L WKH 5 7 77 EUDFNHW 20 to the support Lift the REACT2 BATT up to the bracket and insert the heads of two ancho...

Page 67: ...ct the cable on REACT2 BATT external protective earth B 24 RI WKH UVW 5 7 77 LQVWDOOHG 3 Connect the other side of the cable on REACT2 BATT external protective earth A 25 For both connection follow the below installation sequence Installation sequence knurled washers jumper earth cable other side ÀDW washers M5 nut torque of 4 1 Nm 5HPRYH WKH FDSV IURP WKH EDWWHU connectors To remove the battery s...

Page 68: ...he meter On the basis of the type of electric supply the following are available 5 7 075 3 54 for single phase grid up to 30A 40 for single phase grid up to 65A 58 for three phase grid up to 65 A it can be used for single phase grid if correctly installed 58 for three phase supplies with an external current transformer it can be used for mono phase supplies if correctly installed The energy meter ...

Page 69: ... cable as indicated in the picture 4 Installthewireontheheadoftheconnectorfollowingtheindicationbelow Screw terminal on the counterpart connector RS485 METER signal 1 T R 3 T R 4 RTN Turn the M2 5 screw with suitable screwdriver torque 0 2Nm 5 Install connector housing torque 0 6Nm 6 Install seal pinch ring pressing screw 7 Pressing screw should be tightened with torque 1Nm 8 Install the counterpa...

Page 70: ...HU VXSSO DQG FRQQHFW WKH SKDVH DQG QHXWUDO 1 RQ WKH VSHFL F WHUPLQDO block 53 set on the upper side of the meter each individual terminal of the terminal block takes a cable with a maximum section from 0 5 to 4mm tightening torque of 0 5Nm RQQHFW WKH FDEOHV RI WKH VHULDO OLQH 7 7 DQG 571 RQ WKH WHUPLQDO block 54 on the lower part of the REACT MTR 1PH respecting the correspondence between the signa...

Page 71: ...least 50W in the house so that the REACT MTR 1PH records drawing of current from the grid Check that the LED MEASURE red is permanently on This con dition indicates that a drawing from the grid is recorded and so that the reading of the direction of the current by the REACT MTR 1PH is correct Here below is set out the behaviour of LEDs on the REACT MTR 1PH MEASURE LED description Permanent Green S...

Page 72: ...OH IRU WKH OHQJWK ZKLFK LV LQGLFDWHG RQ WKH meter 13mm RQQHFW WKH FDEOHV RI WKH VLQJOH SKDVH OLQH LQ DFFRUGDQFH ZLWK WKH OD RXW printed on the meter L and N to the AC connection terminal block 53 and tighten the screws tightening torque 3 0 Nm RQQHFW WKH FDEOHV RI WKH VHULDO OLQH DQG VHW RQ the rear of the ABB B21 50 respecting the correspondence between the signals of the serial line and tighten ...

Page 73: ... display shows Protocol Press to access Press to enable the change in the value Press repeatedly until the display shows Modbus Press WR FRQ UP WKH FKDQJH Press for two seconds to return to the RS485 menu 5 Press repeatedly until the display shows Baud rate Press to access Press to enable the change in the value Press repeatedly and select 19200 Press WR FRQ UP WKH FKDQJH Press for two seconds to ...

Page 74: ...SKDVH OLQH LQ DFFRUGDQFH ZLWK WKH OD RXW printed on the meter L1 L2 L3 and N to the three phase connection terminal block 56 and tighten the screws tightening torque 2 0 Nm Take note of the phase to which the REACT2 system is connected this information will be re quested when the system is commissioned RQQHFW WKH FDEOHV RI WKH VHULDO OLQH DQG RQ WKH terminal block 57 set on the rear of the meter 5...

Page 75: ...WR FRQ UP 4 Press repeatedly until the display shows Protocol Press to access Press to enable the change in the value Press repeatedly until the display shows Modbus Press WR FRQ UP WKH FKDQJH Press for two seconds to return to the RS485 menu 5 Press repeatedly until the display shows Baud rate Press to access Press to enable the change in the value Press repeatedly and select 19200 Press WR FRQ U...

Page 76: ...the AC line conductor must be sized in order to pre vent unwanted disconnections of the inverter from the grid due to high impedance of the line that connects the inverter to the power supply If the impedance is too high it causes an increase in the AC voltage which on reaching the limit set by the standards in the country of installation causes the inverter to switch off In order to allow install...

Page 77: ...ction device must meet the following characteristics REACT2 UNO 3 6 REACT2 UNO 5 0 Differential protection type A AC Differential sensitivity 300 mA Number of poles 2 Installation of the cable on the AC output connector To avoid risks of electrical shock all wiring operations must be carried out with the disconnect switch downstream of the inverter grid side opened and applying LOTO procedure on i...

Page 78: ...the mandatory use of properly crimped ferrules N L Max 6 mm 12mm with ferrules 8mm without ferrules X Ø10 14mm X Y L N 25 mm Y 30mm z 10mm max z QVWDOO WKH VLQJOH ZLUHV SKDVH QHXWUDO DQG JURXQG RQ WKH KHDG RI WKH connector respecting the indications printed on each of the three con nection terminals tightening torque 0 8 1Nm ORVH WKH FRQQHFWRU DQG WLJKWHQ WKH FDEOH JODQG UHVSHFWLQJ WKH WLJKW ening...

Page 79: ...ODWFK ZLWK D ÀDW VFUHZGULYHU 2 Insert the counterpart in the AC output GRID connector 17 being careful to align the reference points present on both connectors which prevent connection errors 3 Push the counterpart until you hear click LYH D SXOO WHVW WR FRQ UP WKH FRQQHFWLRQ LV VHFXUH Click 2 1 3 GRID GRID GRID Q DGGLWLRQ WKH FRQQHFWRU PXVW QRW EH VXEMHFW WR WHQVLOH IRUFHV H DPSOHV GR QRW FRQQHFW...

Page 80: ...ust be long enough to connect the REACT2 UNO external protective earth 11 to the REACT2 BATT external protective earth A 25 2 Fitapropercablelugontheprotectiveearthcable minimumcross sec tion not less than the phase cable and in any case not less than 4mm URP DPRQJ WKH FRPSRQHQWV VXSSOLHG QG WKH 0 QXW 0 ÀDW ZDVKHU and M5 serrated lock washer 4 Install the earth cables following the below installat...

Page 81: ...UQDO VLGH RI WKH FDEOH JODQG b 6FUHZ WKH OWHU RQ WKH WKUHDG RI WKH FDEOH JODQG Insert the backup cable into the REACT2 using the AC output BACKUP cable gland 16 M25 with toroid and make the connections to theAC output BACKUP screw terminal block 42 Use a properly sized tripolar cable and check the tightness of theAC output BACKUP cable gland 16 at the end of the installation PV BATTERY DC SWITCH G...

Page 82: ...ircuit breaker with differen tial thermal magnetic protection Voltage rating 230 Vac Current rating 32 A Magnetic protection type B C Type of differential protection A AC Differential sensitivity 30 mA Number of poles 2 Connection to AC BACKUP output terminal block To avoid ULVNV RI HOHFWULFDO VKRFN DOO ZLULQJ RSHUDWLRQV PXVW EH FDUULHG RXW DIWHU WKH QYHUWHU VZLWFK RII Strip 10mm of sheathing from...

Page 83: ...escribed in the section on 9HUL FDWLRQ RI OHDNDJH WR JURXQG Do not connect the strings if a leakage to ground has been detected as the inverter might not connect to the grid Selection of differential protection downstream of the inverter AllABB string inverters marketed in Europe are equipped with a device for protection against ground faults in accordance with the safety standard IEC 62109 2 sect...

Page 84: ... external protection device For protection of theAC line on the basis of the information above with regard to the differential protection integrated in ABB inverters it is not necessary to install a type B differential switch In accordance with article 712 413 1 1 1 2 of Section 712 of IEC Standard 64 8 7 we hereby GHFODUH WKDW EHFDXVH RI WKHLU FRQVWUXFWLRQ LQYHUWHUV GR QRW LQMHFW ground fault dir...

Page 85: ...WV LQ RUGHU WR EHQH W IURP WKH DELOLW WR OHYHUDJH WKH full power of the inverter output on a single channel MPPT The dual MPPTstructure however allows management of two photovoltaic generatorswhichareindependentofeachother oneforeachinputchannel and which may differ between themselves with regard to installation conditions type and number of photovoltaic modules connected in series A necessary con...

Page 86: ...orizontal plane and the same orientation to SOUTH Thephotovoltaicgeneratorconnected to each of the inputs has a lower power than the power limit of the single input channel AND a maximum current lower than the current limit of the single input channel The condition is advisable from a system energy production viewpoint not from the point of view of the operation of the inverter The photovoltaic ge...

Page 87: ...at the mode which must be selected during the guided setup for commissioning the system is INDEPENDENT 32 IN2 IN2 IN1 IN1 Configuration of parallel connected channels 7KLV FRQ JXUDWLRQ XVHV WKH WZR inputchannels MPPT connectedinparallel This means that the jumper supplied between the positive poles of the DC IN1 and IN2 connectors 32 must be installed and that the mode which must be selected durin...

Page 88: ...tion and with the external AC disconnect switch to OFF position applying LOTO procedures on it RU WKH FRQQHFWLRQV RI WKH VWULQJV WKH TXLFN W FRQQHFWRUV RQH IRU HDFK SROH of each string located on the lower side of the REACT2 UNO are used RQQHFW DOO WKH strings required by the system always checking the seal of the connectors The number of connections for each input channel is 2 pairs of connectors...

Page 89: ...o be used che cking the conforming corresponding part on the manufacturer s website or with ABB 8VLQJ FRUUHVSRQGLQJ SDUWV WKDW DUH QRW FRPSOLDQW ZLWK WKH TXLFN W FRQQHFWRU PRGHOV RQ WKH inverter could cause serious damage to the unit and lead to invalidation of the warranty 87 21 7R DYRLG GDPDJH WR WKH HTXLSPHQW ZKHQ DWWDFKLQJ FDEOHV SD SDUWLFXODU DWWHQ tion to polarity 0h 5 39 6WLFN TXLFN W FRQQH...

Page 90: ... complies with the connector limits Apply the terminal to the conductor using the designated pliers Weidmüller CTF PV WM4 1222870000 Insert the cable with the terminal into the interior of the connector until you hear the click indicating that the terminal is locked inside the con nector Click LUPO WLJKWHQ WKH FDEOH JODQG XVLQJ WKH UHOHYDQW WRRO WR QLVK WKH RSH ration 2 0 2 5 Nm WEIDMÜLLER SET MUL...

Page 91: ...erifying that it complies with the connector limits Apply the terminal to the conductor using the designated pliers Multi Contact 32 6020 19100 Insert the cable with the terminal into the interior of the connector until you hear the click indicating that the terminal is locked inside the con nector Click LUPO WLJKWHQ WKH FDEOH JODQG XVLQJ WKH UHOHYDQW WRRO WR QLVK WKH RSH ration 2 5 Nm Multi Conta...

Page 92: ...ifying that it complies with the connector limits Apply the terminal to the conductor using the designated pliers Amphenol H4TC0002 Insert the cable with the terminal into the interior of the connector until you hear the click indicating that the terminal is locked inside the con nector Click LUPO WLJKWHQ WKH FDEOH JODQG XVLQJ WKH UHOHYDQW WRRO WR QLVK WKH RSH ration 2 6 2 9 Nm Amphenol H4TW0001 7...

Page 93: ...ABB service use only RS485 LOGGER 13 14 T R of the RS485 LOGGER communication line 15 16 T R of the RS485 LOGGER communication line 17 18 Reference RTN of the RS485 LOGGER communication line 19 20 Ground terminal Terminal name Terminal number Description of multifunction relay screw terminal block 41 OUTPUT 1 N C Normally closed terminal of multifunctional relay OUTPUT 1 C Common terminal of multi...

Page 94: ...to connect to the grid If the remote control function is on besides being dictated by the presence of the normal parameters that allow the inverter to connect to the grid switching on the inverter also depends on the state of REM terminals terminal 2 and terminal 4 on the communication and control signal terminal block 40 When terminal 2 is brought to the same potential as terminal 4 i e positioni...

Page 95: ...nitoringsystemtotheRS485LOGGERcommunication OLQH FRQVLVWV RI UVW FRQQHFWLQJ DOO WKH XQLWV LQ WKH FKDLQ LQ WKH GDLV FKDLQ LQ RXW FRQ JXUDWLRQ UHVSHFWLQJ FRUUHVSRQGLQJ VLJQDOV DQG then activating the communication line termination resistance in the last element in the chain by setting the RS485 LOGGER line termination switch 37 to the ON position 7KH FRPPXQLFDWLRQ OLQH PXVW DOVR EH WHUPLQDWHG RQ WKH...

Page 96: ... the inverter which previously was the last in the system Each inverter is supplied with one 1 preset RS485 address and with the RS485 LOGGER line termination switch 37 in the OFF position Connect the signals respecting the following positions Terminal name Terminal number Description RS485 LOGGER 13 14 T R of the RS485 LOGGER communication line 15 16 T R of the RS485 LOGGER communication line 17 ...

Page 97: ... FTP UV resistant if used outdoors Type of plug metallic shielded RJ45 The maximum length that can reach these cables is 100 meters and it is always advisable not to let them pass by the power cords to avoid interference with data transmission Maximum inverters number connected over one single daisy chain is 40 In order to avoid ground loop that could create communication issues the shield of any ...

Page 98: ...ROUTER Star configuration ROUTER 2Q HDFK FRQ JXUDWLRQ RI FRQQHFWLRQ WKH PD LPXP OHQJWK RI WKH FDEOH must be 100m maximum between inverter inverter and inverter switch For further information on the Ethernet connection refer to the Local Area Network standard IEEE802 3 Please refer to Aurora Vision documents available on ABB website for further information how to get an Aurora Vision account for re...

Page 99: ...ay Different types of devices light sound etc can be connected to the relay provided they comply with the following requirements Alternating current Maximum Voltage 240 V AC Maximum Current 1 A Direct current Maximum Voltage 30 V DC Maximum Current 0 8 A Cable requirements Conductor cross section from 0 14 to 1 5 mm2 7KLV FRQWDFW FDQ EH XVHG LQ GLIIHUHQW RSHUDWLQJ FRQ JXUDWLRQV WKDW FDQ EH VHOHFWH...

Page 100: ...o not use the equipment if RX GR QRW KDYH VXLWDEOH TXDOL FDWLRQV WR ZRUN RQ WKLV HTXLSPHQW RU VLPLODU SURGXFWV you are unable to understand how it works you are not sure what will happen when the buttons or switches are operated you notice any operating anomalies there are doubts or contradictions between your experience the manual and or other operators ABB cannot be held responsible for damage t...

Page 101: ...can signal multiple conditions other than the original single condition see the chapter 7 Synoptic icons behaviour Embedded Web User Interface FFHVVLEOH YLD L L E XVLQJ DQ 1 HQDEOHG VWDQGDUG GHYLFH PC smartphone tabled QDEOHV VLQJOH LQYHUWHU FRPPLVVLRQLQJ DQG SDUDPHWHUV VHWWLQJV 8SGDWLQJ WKH LQYHUWHU UPZDUH Aurora Vision Plant Management Platform Additional to any local user interfaces the inverte...

Page 102: ...allowing monitoring Health and Performance rate of photovoltaic and storage installations 1RWL FDWLRQ RI YHQWV ODUPV Possibility to update the FW of all components installed from remote Compatible with iOS version 8 x or greater and Android version 4 x or greater devices Energy Viewer is fully integrated withAurora Vision cloud platform and any owner of anAurora Vision account can use it Please as...

Page 103: ...ntation The interpretation or variation of some data is reserved exclusively for specialized and TXDOL HG staff The incoming voltage must not exceed the maximum values shown in the technical data section 2 in order to avoid damaging the equipment Consult the technical data for further details During operation check that the environmental and logistical conditions are correct see installation chapt...

Page 104: ...grid 6XSSO WKH LQYHUWHU ZLWK LQSXW YROWDJH IURP WKH SKRWRYROWDLF JHQHUDWRU and or via AC GRID voltage Where the system is powered by the photovoltaic generator DC make sure irradiation is sta ble and adequate for the REACT2 s commissioning procedure to be completed 6XSSO JULG YROWDJH WR WKH LQYHUWHU Pre commissionig phase 1 Connection to the local Wi Fi network DEVICE USED TABLET SMARTPHONE Once p...

Page 105: ...ari from V 10 2 1 DEVICE USED LAPTOP Open an internet browser page and insert http 192 168 117 1 on the address bar STEP 1 Administrator User login credentials Set the Administrator account user and password mini mum 8 character for password Administrator account can open and view the contents of photovoltaic site Additionally they can make changes to inverter settings User and password are CASE S...

Page 106: ...lect your own home wireless network from all WKRVH VKRZQ LQ WKH 66 HOG RX FDQ FDUU RXW D QHZ VHDUFK ofthenetworksthatcanbedetectedwiththeUpdatebutton 2QFH WKH QHWZRUN KDV EHHQ VHOHFWHG FRQ UP Password Wireless network password Enter the password for the destination network if necessary and start the connection attempt it will take a few seconds Click on Connect button to connect the inverter to th...

Page 107: ...k it is available accessing the Wi Fi network ZKHUH LV DQ KH DGHFLPDO QXPEHU RI WKH MAC Address The most common causes of losing connectivity might be different wireless network pas sword faulty or unreachable router replacement of router different SSID without the neces sary setting updates STEP 3 Date Time and Time zone Set the Date Time and Time zone The inver WHU ZLOO SURSRVH WKHVH HOGV ZKHQ D...

Page 108: ... after which the Country Select Set Std functionality is blocked and the remaining time will have to be reset in order to have the 24 hours of operation available again in which to select a new grid standard follow the procedure Resetting the remaining time for grid standard variation descri bed in the relevant section Input mode QRW DYDLODEOH LI FRXSOHG V VWHP FRQ JX ration was selected Indipende...

Page 109: ...ion All unused power from domestic loads will feed into the grid Custom The system automatically manages SRZHU ÀRZV LQ RUGHU WR DYRLG IHHGLQJ the grid with power greater than PDC x Plim where PDC is the power of the pho tovoltaic generator PV GENERA TOR POWER parameter and Plim is the output power limit with respect to PDC FEED IN POWER parame ter PV Generator Power Wp Insert the power value of th...

Page 110: ...parallel connection with the JULG WKH 3RZHU NHHSV ÀDVKLQJ WKH ODUP DQG V DUH RII If the outcome of the preliminary checks on the grid parallel is positive the inverter connects to the grid and starts to export power to the grid The 3RZHU UHPDLQV HG RQ ZKLOH WKH ODUP DQG V DUH RII To address any problems that may occur during the initial stages of operation of the system DQG WR HQVXUH WKH LQYHUWHU ...

Page 111: ...ters icon then click on Logger Q RJJHU VHFWLRQ FKHFN WKH QDEOH IUHH KRPH HOG DGGLWLRQDO part of menu will appear QWHU 8VHUQDPH DQG SDVVZRUG XVHG IRU WKH UHH RPH V VWHP F cess Point then click Save button If encounter in connection problem with ABB free home System Access Point check if Both systems REACT2 and System Access Point has been located in the same wireless QHWZRUN RPH URXWHU VXSSRUWV ERQ...

Page 112: ...SURJUDPPHG Night mode inverter automatically switches off The inverter is in night time switch off mode input voltage less than 70 of the set start up voltage Inverter initialisation 7KLV LV D WUDQVLWLRQDO VWDWH GXH WR WKH YHUL FDWLRQ RI WKH RSHUDWLQJ FRQGLWLRQV XULQJ WKLV VWDJH the inverter checks that the conditions for connecting to the grid are met The inverter is connected and feeds power int...

Page 113: ...ess networks 7U LQJ WR FRQQHFW WR D QHWZRUN ZL RU HWKHUQHW Wireless or Ethernet network is connected to the network Icon status Operating state 1R PHWHU KDV EHHQ FRQ JXUHG GXULQJ FRPPLVVLRQLQJ Meter is communicating 0HWHU FRQ JXUHG DQG LV QRW FRPPXQLFDWLQJ Icon status Operating state No battery has been commissioned Charging Discharging Idle sleep Fault End of battery life reached Red GFI LED When...

Page 114: ...me provided during the commissioning phase to access the login page In order to use the Host Name as an alternative to the dynamic IP address the Wi Fi router WR ZKLFK WKH ERDUG LV FRQQHFWHG ZKHQ RSHUDWLQJ LQ 6WDWLRQ 0RGH PXVW SURYLGH WKH RPDLQ Name System DNS service contact the network administrator for further information regar ding the presence or absence of the DNS service in the Wi Fi router...

Page 115: ...DWLRQ ODEHO SODFHG RQ WKH VLGH RI WKH LQ verter or applied during the commissioning phase to the plant documen tation KHQ UHTXLUHG GLJLW WKH PRODUCT KEY printed on the Communica WLRQ GHQWL FDWLRQ ODEHO DQG DSSOLHG GXULQJ WKH FRPPLVVLRQLQJ SKDVH WR the plant documentation as access point password Note that it s required to digit also the dash characters of the 3URGXFW H LQ WKH SDVVZRUG HOG In case ...

Page 116: ...SDVVZRUG DUH 6 6 16 7 9 I WKH 3DVVZRUG LV ORVW FOLFN RQ RUJRW RXU SDVVZRUG WR REWDLQ WKH DFFHVV WR WKH HE 8VHU QWHUIDFH DQG LW ZLOO EH SRVVLEOH WR FKDQJH WKH SDVVZRUG E HQWHULQJ WKH 352 8 7 SULQWHG RQ WKH RPPXQLFDWLRQ GHQWL FDWLRQ ODEHO DQG DSSOLHG GXULQJ WKH FRPPLVVLRQLQJ phase to the plant documentation 7KH ODQJXDJH RI WKH HE 8VHU QWHUIDFH FRXOG EH FKDQJHG LQ DQ PRPHQW E FOLFNLQJ RQ WKH right st...

Page 117: ... mary informations related the status and the production informations of the inverter and photovoltaic plant SETTING 6HFWLRQ GHGLFDWHG WR DQG OLQH SDUDPHWHUV FRQ JXUD tions INVERTER LOG Section dedicated to viewing Alarms and Warnings event log USER Section dedicated to User management CONNECTIVITY Section dedicated to inverter communication settings DQG FRQ JXUDWLRQV SERVICE TOOLS 6HFWLRQ GHGLFDW...

Page 118: ...e inverter and photovoltaic plant and alarm warning active events Status Summary In the Status Summary sub menu you can view the detailed informa tions related the status and the production informations of the system Meter Summary In the Meter Summary sub menu you can view the detailed informa tions related to the energy production of the system Batteries Summary In the Batteries Summary sub menu ...

Page 119: ...RXWSXW SRZHU limitation by changing the Maximum AC output power and the max imum apparent output power parameters Do not change these parameters if not requested by the grid operator 6HWWLQJV Only visible with Admin Plus privileges In the AC Settings sub menu you can setup the parameter related to the Output AC side Changing the above mentioned parameters may prevent disconnection from the grid if...

Page 120: ...tage only if really necessary and to set it to the correct value the photovoltaic generator sizing tool available on the ABB website will indicate whether Vstart needs to be changed and what value have to be set Input Mode Independ Parallel 7KLV VHWWLQJV DOORZV RX WR VHWV WKH LQSXW FRQ JXUDWLRQ PRGH UV Protection Time Value This section of the menu allows you to sets the time for which the in vert...

Page 121: ...ers using the following parameters groups Watt Cosphi Settings Cosphi P Q Set Cosphi Set Volt VAr Settings Q V Do not change these parameters if not requested by the grid operator Digital Outputs This section of the menu allows you to set the activation status of a relay DQG WR FRQ JXUH FXVWRPLVHG DODUP FRQGLWLRQV This contact can be used for example to activate a siren or a visual alarm control t...

Page 122: ...electable alarms for which the relay is activated E001 E002 E003 E004 E005 E006 E007 E010 E011 E013 E014 E015 E017 E018 E019 E020 E021 E022 E023 E025 E029 E031 E032 E033 E034 E036 E037 E053 E055 E075 E077 E078 E079 E080 E084 W002 W004 W005 W006 W007 W011 W015 W017 W046 W047 W048 In the presence of W003 W004 W005 W006 W007 signalling the alarm contact switches to then reset itself at the end of the...

Page 123: ...OLPLW RI RSHUDWLRQ the alarm contact switches to then reset itself at the end of the alarm signal This means that during the reduced input voltage display message Waiting Sun the alarm contact remains in its resting position In the presence of W003 W004 W005 W006 W007 signalling the alarm contact switches to then reset itself at the end of the alarm signal This means that during the absence of gri...

Page 124: ...selected from the list in the dedicated submenu Output Activation Filter of the inverter display see the table below When the inverter returns to the normal operating state and reconnects with the grid Selectable alarms for which the relay is activated E001 E002 E003 E004 E005 E006 E007 E010 E011 E013 E014 E015 E017 E018 E019 E020 E021 E022 E023 E025 E029 E031 E032 E033 E034 E036 E037 E053 E055 E0...

Page 125: ... Operation Inverter Log In the Inverter Log Section it s possible to view the Alarm and Warning HYHQWV OLVW WKDW LW FDQ EH FXVWRP OWHUHG E W SH RU E HQWHULQJ D PDWFK ing word Clicking on any event to view his details ...

Page 126: ...f the inverter after 24 hours while the in verter is operating so the Country Standard sub menu on TOOLS section is locked View and edit the AC Settings Reactive Power Control Ramp Control Active Power Control and Frequency Control P f View and edit the MPPT Noise amplitude HOG LQ DC Settings on SETUP section To access on the Web User Interface with the Admin Plus user priv ileges it s required to...

Page 127: ... to enable monitoring and control using ABB map ModbusSunspecServer Generalpurposecommunicationprotocolto be selected to enable monitoring and control using Sunspec standard Device Acquisition Communication protocol to be used in case of connection in Master mode to external devices like VSN800 wea ther station LAN In the LAN sub menu it s possible to view the status and change the GDLV FKDLQ FRQ ...

Page 128: ...ion there are different settings based on the type of external device connected to the inverter I WKH LQYHUWHU DFWV DV 17 DQG WKH H WHUQDO GHYLFH DV 6 59 5 type the Edit key and select the type of external device According to the device select the communication protocol type in the key and the added device is displayed change the STATE SLAVE ID NAME IP ADDRESS PORT DEVICE settings and save them I ...

Page 129: ...H 8SGDWH DWH 7LPH 5HVHW 0DQXIDFWXULQJ Only visible with Admin Plus privileges Connectivity Check In the Connectivity Check sub menu it s possible to carry out con nectivity tests of the wireless network connection ethernet connection FRQQHFWLRQ WR XURUD 9LVLRQ DQG UPZDUH XSJUDGH VHUYHUV At the end of the test it will be reported the detail of the results ...

Page 130: ...DUH 8SGDWH Perform the update during good irradiation conditions avoid the dawn and dusk hours An interruption of updating process could damage the inverter 5HPRWH UPZDUH 8SGDWH Q UHPRWH PRGH WKH UPZDUH ZLOO XSGDWH DXWRPDWLFDOO VHDUFKLQJ WKH ODVW DYDLODEOH UPZDUH RQ VHUYHUV E FOLFNLQJ WKH EXWWRQ IWHU WKH QLVK RI WKH FKHFNLQJ SURFHVV WKH DYDLODEOH UHOHDVH ZLOO EH QRWL HG RQ WKH ERWWRP SDUW RI WKH V...

Page 131: ...URSRVH WKHVH HOGV ZKHQ WKH WLPH SURWRFRO LV DYDLO able When it s not possible for the inverter to detect the time protocol these HOGV KDYH WR EH PDQXDOO HQWHUHG Reset Manufacturing Only visible with Admin Plus privileges In the Reset Manufacturing sub menu it s possible to reset country standard restore default and the connectivity reboot ...

Page 132: ... the INFORMATION Section it s possible to view the general inform ations about the embedded Web User Interface it s possible to access the following sub menus 3URGXFW QIR 3ULYDF 3ROLF 3URYLGHU QIRUPDWLRQ PSUHVVXP FNQRZOHGJPHQWV 5HOHDVH 1RWHV ...

Page 133: ...g regulations in the country of installation and in accordance of all safety rules for performing electrical works QYHUWHU RSHUDWLRQ DQG PDLQWHQDQFH E D SHUVRQ ZKR LV 127 TXDOL HG LV LQWR LFDWHG RU RQ narcotics is strictly forbidden 7KH FXVWRPHU KDV FLYLO OLDELOLW IRU WKH TXDOL FDWLRQ DQG PHQWDO RU SK VLFDO VWDWH RI WKH SHUVRQQHO who interact with the equipment They must always use the personal pr...

Page 134: ...External DC disconnect device go on the point 6 Operations on Internal DC and battery disconnect switch Disconnect any DC external sources I GHVLJQDWHG ORFN SUHYHQWLQJ RSHUDWLRQ RQWR DQ H WHUQDO GLVFRQQHFW GHYLFH DI LQJ GHVLJQDWHG WDJV 6 Operations on Internal DC and battery disconnect switch 07 Open DC and battery disconnect switch 07 I SDGORFNV DQG WDJV WR LQKLELW WKH UH FORVLQJ RSHUDWLRQ Check ...

Page 135: ... the operations mentioned in the procedure have been carried out The checklist below must be attached to the intervention report Check Status V or X Prepare for the work and identify the work location and equipment PPE and Equipment Check PPE wearing OPERATIONS AT PLANT LEVEL Check the absence of dangerous voltages on inverter chassis respect ground Operations in External AC switch Operations in E...

Page 136: ...ted unless otherwise indicated For FOHDQLQJ 2 127 XVH UDJV PDGH RI ODPHQWDU PDWHULDO RU FRUURVLYH SURGXFWV WKDW PD corrode the equipment or generate electrostatic charges Avoid temporary repairs All repairs should be carried out using only genuine spare parts The maintenance technician is to promptly report any anomalies DO NOT allow the equipment to be used if problems of any kind are found Alway...

Page 137: ...N WKH LQWHJULW RI WKH FDEOHV FRQQHFWRUV DQG H WHUQDO FDEOH JODQGV KHFN WKDW WKH HQYLURQPHQWDO FRQGLWLRQV KDYH QRW FKDQJHG GUDPDWLFDOO IURP those on installation Annual operations KHFN WKH WLJKWHQLQJ RI WKH FDEOH JODQGV DQG WKH VFUHZ WHUPLQDO EORFNV KHFN WKH IURQW FRYHUV DUH HG I WKHUH LV QR PRQLWRULQJ V VWHP FKHFN WKH DODUPV DQG HUURUV ORJ XVLQJ WKH LQIRUPDWLRQ SURYLGHG LQ WKH PDQXDO LQ RUGHU WR F...

Page 138: ...nce W001 Sun Low On QVXI FLHQW LUUDGLDWLRQ RZ input voltage on switching on the inverter QFRUUHFW FRQ JXUDWLRQ RI WKH PV generator or an on WKH OLPLW FRQ JXUDWLRQ IRU WKH LQYHUWHUV PLQLPXP input voltage KHFN WKH input voltage on the inverter If it does not exceed Vstart check for the presence of VXI FLHQW LUUDGLDWLRQ DQG WKH FRUUHFW FRPSRVLWLRQ RI WKH V VWHP If it exceeds Vstart contact customer a...

Page 139: ...rcuit UURU LQVLGH WKH LQYHUWHU DQG FDQQRW EH FKHFNHG H WHUQDOO If the alarm repeats persistently contact customer assistance W015 Island Detect On Disconnection due to Anti Islanding The inverter has been improperly connected to an island grid KHFN WKDW WKH JULG WR ZKLFK WKH LQYHUWHU LV FRQQHFWHG LV QRW an island grid If the grid to which the inverter is connected is an island grid switch the inve...

Page 140: ...WKH LQYHUWHU DQG FDQQRW EH FKHFNHG H WHUQDOO If the problem persists once the inverter has been switched off and back on again contact customer assistance W045 Sys disconnected On Disconnection of system from grid Warning of disconnection of system from electrical grid no DC input voltage because of dead battery unit or no demand from domestic loads KHFN WKDW ZKHQ WKH ZDUQLQJ RFFXUV WKH EDWWHU XQL...

Page 141: ...nnection of the battery did not occur Impossible to disconnect the battery unit via the system s internal devices following a command automatic or manual UURU LQVLGH WKH LQYHUWHU DQG FDQQRW EH FKHFNHG H WHUQDOO If the problem persists once the inverter has been switched off and back on again contact customer assistance W063 Force Grid Disconnection for Backup Request On Forced disconnection from g...

Page 142: ...gh irradiation and with LQSXW YROWDJH ZKLFK LV VLJQL FDQWO higher than the activation voltage contact customer assistance E011 Ramp Fail On Long wait for Booster regime to start Error internal to inverter relating to start up time for DC DC circuit regime Booster UURU LQVLGH WKH LQYHUWHU DQG FDQQRW EH FKHFNHG H WHUQDOO If the problem persists once the inverter has been switched off and back on aga...

Page 143: ...onnection to the grid If the problem persists once the inverter has been switched off and back on again contact customer assistance E020 Self Test Error 1 On Failure of the test on the relay of the Booster DC DC circuit Before connecting to the grid the inverter carries out some internal tests One of these tests concerns the correct operation of the booster relay The test is carried out by forcing...

Page 144: ...rter below 25 C DLW IRU WKH WHPSHUDWXUHV WR ZKLFK WKH LQYHUWHU LV H SRVHG WR return to the operating range If the problem persists contact customer assistance You must remember to wait for the time necessary to allow the inverter to warm up E034 Interlock fail On IGBT circuitry not ready Error inside the inverter UURU LQVLGH WKH LQYHUWHU DQG FDQQRW EH FKHFNHG H WHUQDOO If the problem persists once...

Page 145: ...e considered a problem but a SURWHFWLRQ LQWHUYHQWLRQ IRU WKH SKRWRYROWDLF HOG If the error occurs with good irradiation conditions switch the inverter off and back on again if the error persists contact customer assistance E086 Batt 1 F2 No Icon Error battery unit 1 unusable Indicates that the battery unit is unusable and must be replaced UURU LQVLGH EDWWHU XQLW DQG FDQQRW EH FKHFNHG H WHUQDOO If ...

Page 146: ... of the output nominal power KHFN WKH OLPLWDWLRQ YDOXH VHW LQ 6HWWLQJV Service Power OF Derating LIMxxx CODE 02 Power limitation due to over voltage The message indicates that the user has set a power limitation due to overvoltage parameter U 10 min in order to reduce the maximum output power of the inverter when the reading of the average grid voltage exceeds certain limits The sampling of readin...

Page 147: ... to the operating range and for the inverter to cool down If the problem persists once the ambient temperature has returned to within the range contact customer assistance LIMxxx CODE 06 Power limitation due to input overvoltage The message indicates that a power limitation is active since an input overvoltage DC has been recorded LIM xxx Power reduction percentage Examples LIM 100 no power limita...

Page 148: ...sation valve air with extremely high levels of humidity can lead to the creation of condensation inside the inverter As the inverter is almost completely insulated from the outside condensation can also form after maintenance interventions Never open the system parts in the case of humidity 95 Always carefully seal all unused openings To dismantling and disassemble the equipment refer to the chapt...

Page 149: ...f 6 digits the last 6 in models with a label giving a 10 digit S N WK Production week This information can be found on the label giving the identity details of the inverter or on the di VSOD E DFFHVVLQJ WKH 1 250 7 21 PHQXĺ6HULDO 1R 7KH SURGXFWLRQ ZHHN FRQVLVWV RI JXUHV LQGLFDWLQJ WKH ZHHN UVW digits and the year of production last 2 digits Stage 2 Registration on https registration abbsolarinvert...

Page 150: ...m Insert the Username corresponding to the email used during registra tion and the Password obtained at the end of Stage 2 Access the section dedicated to requesting the password Choose the inverter model from the drop down list and insert Serial Number and Week of Production of the inverter which were obtained previously Stage 1 ...

Page 151: ...er hand the data are correct the passwords will be shown in a new window and at the same time sent to the email address used for registration The password enables access to the Admin Plus privileges which allows the system s sensiti ve parameters to be changed Proceed to changing the aforementioned parameters only when requested by the grid operator or by customer assistance ...

Page 152: ... YROWDJH VXI FLHQW IRU WKH GLPHQVLRQV RI the photovoltaic generator Behaviour of a system without leakage Due to the capacitive effect of the 39 JHQHUDWRU GXULQJ WKH UVW PRPHQWV that the voltmeter is connected between one of the two poles and ground it will measure a voltage of about Voc 2 which will tend to stabilize to around 0V if there is no ground leakage as shown in the graph below The inter...

Page 153: ...e between positive pole and ground a voltage of 200V is measured This means that if the system is made up of 10 modules in series and each one supplies 50V the leakage can be located between the 4th and 5th PV module Va voltage measured between pole and 200V Vb voltage measured between pole and 300V In all measurements with the ground of the inverter is indicated V 200 V 300 V t 50 V 50 V 50 V 50 ...

Page 154: ...ed insulation resistance Riso is less than 1Mohm the inverter does not connect to the grid due to a low insulation of photovoltaic generator respect to ground I MODELS with high frequency transformer If the measured insu ODWLRQ UHVLVWDQFH 5LVR LQ FDVH RI LQSXW SROHV ÀRDWLQJ UHVSHFW WR JURXQG or QF 1 if the one of input poles is grounded is less than 0 2Mohm the inverter does not connect to the gri...

Page 155: ... bin where present indicates that the product must not be disposed of with domestic waste at the end of its useful life This product must be delivered to the waste collection point of the local community for recycling For further information refer to the public body responsible for waste disposal in the country Inappropriate disposal of waste can have a negative impact on the environment and human...

Page 156: ... changes on the Internet DNS required Out https 443 Tcp As an HTTP client the inverter uses SSL TLS protocol con nections to Aurora Vision servers for secure communica tion The inverter uses this port for all services including GDWD WUDQVPLVVLRQ UPZDUH XSJUDGH FRQ JXUDWLRQ PDQD gement and remote command transmission required Out dhcp 67 dhcp 68 Udp If DHCP service is not available static network i...

Page 157: ...rk configuration 7KH LQYHUWHU UHTXLUHV D YDOLG QHWZRUN FRQ JXUDWLRQ LQ RUGHU WR RSHUDWH This information can either be provided by a DHCP server provided by WKH FXVWRPHUV QHWZRUN WKH GHIDXOW RU WKH LQYHUWHU FDQ EH FRQ JXUHG ZLWK VWDWLF QHWZRUN LQIRUPDWLRQ 5HJDUGOHVV RI KRZ WKH LQYHUWHU LV FRQ gured the following information is required RQ JXUDWLRQ Purpose IP Address Allows the inverter to take par...

Page 158: ... 158 000339AG Further information For more information on ABB solar products and services visit www abb com solarinverters ...

Page 159: ...Contact us www abb com solarinverters ...

Reviews:

No comments

Brands by name

Popular brands

Load more brands