Riverstone Networks RS 8000 Скачать руководство пользователя страница 8

Страница: 8 / 158

viii Riverstone Networks RS 8000/8600 Switch Router Getting Started Guide

%HIRUHLQVWDOOLQJWKLVHTXLSPHQWXVHUVVKRXOGHQVXUHWKDWLWLVSHUPLVVLEOHWREHFRQQHFWHGWRWKHIDFLOLWLHV

RIWKHORFDOWHOHFRPPXQLFDWLRQVFRPSDQ\7KHHTXLSPHQWPXVWDOVREHLQVWDOOHGXVLQJDQDFFHSWDEOH

PHWKRGRIFRQQHFWLRQ7KHFXVWRPHUVKRXOGEHDZDUHWKDWWKHFRPSOLDQFHZLWKWKHDERYHFRQGLWLRQVPD\

QRWSUHYHQWGHJUDGDWLRQRIVHUYLFHLQVRPHVLWXDWLRQV

5HSDLUVWRFHUWLILHGHTXLSPHQWVKRXOGEHFRRUGLQDWHGE\DUHSUHVHQWDWLYHGHVLJQDWHGE\WKHVXSSOLHU$Q\

UHSDLUVRUDOWHUDWLRQVPDGHE\WKHXVHUWRWKLVHTXLSPHQWRUHTXLSPHQWPDOIXQFWLRQVPD\JLYHWKH

WHOHFRPPXQLFDWLRQVFRPSDQ\FDXVHWRUHTXHVWWKHXVHUWRGLVFRQQHFWWKHHTXLSPHQW

8VHUVVKRXOGHQVXUHIRUWKHLURZQSURWHFWLRQWKDWWKHHOHFWULFDOJURXQGFRQQHFWLRQVRIWKHSRZHUXWLOLW\

WHOHSKRQHOLQHVDQGLQWHUQDOPHWDOOLFZDWHUSLSHV\VWHPLISUHVHQWDUHFRQQHFWHGWRJHWKHU7KLVSUHFDXWLRQ

PD\EHSDUWLFXODUO\LPSRUWDQWLQUXUDODUHDV

&DXWLRQ8VHUVVKRXOGQRWDWWHPSWWRPDNHFRQQHFWLRQVWKHPVHOYHVEXWVKRXOGFRQWDFWWKHDSSURSULDWH

HOHFWULFLQVSHFWLRQDXWKRULW\RUHOHFWULFLDQDVDSSURSULDWH

127,&(7KH5LQJHU(TXLYDOHQFH1XPEHU5(1DVVLJQHGWRHDFKWHUPLQDOGHYLFHSURYLGHVDQLQGLFDWLRQ

RIPD[LPXPQXPEHURIWHUPLQDOVDOORZHGWREHFRQQHFWHGWRDWHOHSKRQHLQWHUIDFH7KHWHUPLQDWLRQRQDQ

LQWHUIDFHPD\FRQVLVWRIDQ\FRPELQDWLRQRIGHYLFHVVXEMHFWRQO\WRWKHUHTXLUHPHQWWKDWWKHVXPRIWKH

5LQJHU(TXLYDOHQFH1XPEHUVRIDOOWKHGHYLFHVGRHVQRWH[FHHG

Содержание RS 8000

Страница 1: ...36 005 15 Rev 0A RS 8000 8600 Switch Router Getting Started Guide Release 9 3...

Страница 2: ...WV GHULYHG IURP WKLV VRIWZDUH ZLWKRXW VSHFLILF SULRU ZULWWHQ SHUPLVVLRQ 7 6 62 7 5 6 3529 7 5 176 1 2175 87256 6 6 1 1 35 66 25 03 55 17 6 1 8 1 87 127 0 7 72 7 03 55 17 6 2 0 5 17 7 1 71 66 25 3 57 8...

Страница 3: ...FH DQG WKLV GHYLFH PXVW DFFHSW DQ LQWHUIHUHQFH UHFHLYHG LQFOXGLQJ LQWHUIHUHQFH WKDW PD FDXVH XQGHVLUHG RSHUDWLRQ Note This equipment has been tested and found to comply with the limits for a Class A d...

Страница 4: ...W LV SHUPLVVLEOH WR EH FRQQHFWHG WR WKH IDFLOLWLHV RI WKH ORFDO WHOHFRPPXQLFDWLRQV FRPSDQ 7KH HTXLSPHQW PXVW DOVR EH LQVWDOOHG XVLQJ DQ DFFHSWDEOH PHWKRG RI FRQQHFWLRQ 7KH FXVWRPHU VKRXOG EH DZDUH WKD...

Страница 5: ...QFH FKHFNV RU DGMXVWPHQWV 7KH RXWSXW LV IDFWRU VHW DQG GRHV QRW DOORZ DQ XVHU DGMXVWPHQW ODVV ODVHU WUDQVFHLYHUV FRPSO ZLWK WKH IROORZLQJ VDIHW VWDQGDUGV 21 CFR 1040 10 and 1040 11 U S Department of H...

Страница 6: ...KH RSWLFDO FRQQHFWRU IURP WKH WUDQVFHLYHU DOORZV ODVHU UDGLDWLRQ WR HPLW GLUHFWO IURP WKH RSWLFDO SRUW 7KH PD LPXP UDGLDQFH IURP WKH RSWLFDO SRUW XQGHU ZRUVW FDVH FRQGLWLRQV LV FP RU P VU R QRW XVH RS...

Страница 7: ...possible they will notify you in advance But if advance notice isn t practical you will be notified as soon as possible You will be advised of your right to file a complaint with the FCC 4 Your telep...

Страница 8: ...LFDWLRQV FRPSDQ FDXVH WR UHTXHVW WKH XVHU WR GLVFRQQHFW WKH HTXLSPHQW 8VHUV VKRXOG HQVXUH IRU WKHLU RZQ SURWHFWLRQ WKDW WKH HOHFWULFDO JURXQG FRQQHFWLRQV RI WKH SRZHU XWLOLW WHOHSKRQH OLQHV DQG LQWHUQ...

Страница 9: ...propriate records of the location of the original media and all copies of the Licensed Software in whole or in part made by You b not to use copy or modify the Licensed Materials in whole or in part e...

Страница 10: ...N ANY IMPLIED WARRANTIES OR CONDITIONS OF MERCHANTABILITY FITNESS FOR A PARTICULAR PURPOSE SATISFACTORY QUALITY NONINFRINGEMENT OR ARISING FROM A COURSE OF DEALING USAGE OR TRADE PRACTICE ARE HEREBY E...

Страница 11: ...orization num ber the location to which PURCHASER must return the shipment claimed to be defective and the method of trans portation In no event will RIVERSTONE accept any returned part or Product whi...

Страница 12: ...R PURPOSES FOR WHICH THE LICENSED MATERIALS PRODUCTS OR PARTS MAY BE ACQUIRED BY PURCHASER IN NO EVENT SHALL RIVERSTONE OR ITS AFFILIATES BE LIABLE TO PURCHASER FOR ANY INDIRECT INCIDENTAL OR CONSEQUE...

Страница 13: ...DENDUM SSOLFDWLRQ RI RXQFLO LUHFWLYH V 0DQXIDFWXUHU V 1DPH 5LYHUVWRQH 1HWZRUNV QF 0DQXIDFWXUHU V GGUHVV UHDW PHULFD 3DUNZD 6DQWD ODUD RQIRUPDQFH WR LUHFWLYH V 3URGXFW 6WDQGDUGV LUHFWLYH LUHFWLYH 1 1 1...

Страница 14: ...xiv Riverstone Networks RS 8000 8600 Switch Router Getting Started Guide...

Страница 15: ...agement Platforms 2 8 2 4 Hardware Overview 2 9 2 4 1 Chassis 2 9 2 4 2 Backplane 2 11 2 4 3 Fan Module 2 11 2 4 4 Control Module 2 11 2 4 5 AC Power Supply 2 14 2 4 6 DC Power Supply 2 16 2 4 7 Switc...

Страница 16: ...4 Setting the Basic System Information 4 9 4 5 Setting Up Passwords 4 12 4 5 1 If You Forget Your Passwords 4 13 4 6 Setting Up SNMP 4 15 4 6 1 Setting the Community string 4 15 4 6 2 Improving SNMP S...

Страница 17: ...Riverstone Networks RS 8000 8600 Switch Router Getting Started Guide xvii B 1 CONSIDERACIONES DE SEGURIDAD B 1 B 1 1 Prevenci n de Lesiones B 1 Index Index 1...

Страница 18: ...xviii Riverstone Networks RS 8000 8600 Switch Router Getting Started Guide...

Страница 19: ...ure 2 15 Front panel of 1000Base SX line card 2 26 Figure 2 16 Front panel of 1000Base LX line card 2 28 Figure 2 17 Front panel of 1000Base LLX line card 2 30 Figure 2 18 Front panel of 1000Base T li...

Страница 20: ...equipment rack 3 3 Figure 3 2 Installing an AC power supply 3 5 Figure 3 3 Front view of an RS 8600 DC power supply 3 7 Figure 3 4 Relationship of wiring lugs on RS 8600 DC power supply 3 8 Figure 3...

Страница 21: ...iption for 10 100Base TX line card 2 22 Table 2 16 Connector specifications for 100Base FX line card 2 23 Table 2 17 LED description for 100Base FX line card 2 23 Table 2 18 SFP transceiver media spec...

Страница 22: ...LED description for CMTS line card 2 53 Table 2 51 Specifications for T1 WIC card 2 54 Table 2 52 Specifications for E1 WIC card 2 54 Table 2 53 Specifications for Clear Channel T3 WIC card 2 54 Table...

Страница 23: ...ese other documents to learn more about your product If You Want To See Get an overview of the RS 8000 and RS 8600 software and hardware features Chapter 2 Introduction Install the RS 8000 or RS 8600...

Страница 24: ...1 2 Riverstone Networks RS 8000 8600 Switch Router Getting Started Guide Related Documentation About This Guide...

Страница 25: ...ng software and user documentation check the Riverstone Networks web site at www riverstonenet com 2 1 FUNCTIONAL LAYER TERMINOLOGY This guide and other RS documentation refers to layer 2 L2 layer 3 L...

Страница 26: ...000 000 layer 4 application flows RS 8600 400 000 layer 2 MAC addresses RS 8000 800 000 layer 2 MAC addresses RS 8600 4 096 Virtual LANs VLANs 20 000 layer 2 security and access control filters 3 MB i...

Страница 27: ...pid Spanning Tree Protocol RSTP Per VLAN Spanning Tree PVST RMON RMON v1 v2 for each port Management SNMP v1 v2 Emacs like Command Line Interface CLI Port mirroring Traffic from specific ports Traffic...

Страница 28: ...be configured to perform flow based bridging on a per port basis A port cannot be configured to perform both types of bridging at the same time 2 3 2 Port and Protocol VLANs The RS supports the follow...

Страница 29: ...When you add an interface to a set of ports you are adding a VLAN to those ports Ports that contain IP and IPX interfaces can still perform layer 2 bridging IP Routing The RS supports the following IP...

Страница 30: ...ough software and through hardware on the G8M GBCMM 02 Gigabit Ethernet line card G8M PO3MM 02 2 port OC 3 line card and G8M PO3MM 02 2 port OC 12 line card The following MPLS capabilities are support...

Страница 31: ...nfigure the RS to apply Quality of Service QoS policies during peak periods to guarantee service to specific hosts applications and flows source destination pairs This is especially useful in networks...

Страница 32: ...tion IP port address SSL persistence a binding is determined by matching the source IP address and the virtual destination IP port address Note that requests from any source socket with the client IP...

Страница 33: ...rner Figure 2 1 Front view of a fully loaded RS 8000 chassis Figure 2 2 shows the front view of a fully loaded RS 8600 chassis The RS 8600 chassis is similar to the RS 8000 chassis except for the foll...

Страница 34: ...g throughput regardless of the software features you are using Therefore you do not need to load balance line cards by placing them in certain relationships to balance the load on the backplane Regard...

Страница 35: ...le contains six fans The fan module is installed at the factory but you can replace the module yourself if necessary Note To ensure that the fan module can provide adequate cooling always provide a mi...

Страница 36: ...e current status of the RS 8000 8600 Table 2 3 describes the meaning of the Control Module LEDs PC flash card slots These slots are used to connect the PC card to the Control Module The RS 8000 8600 s...

Страница 37: ...port for network in band connection to a management terminal The port is configured as a Media Data Interface MDI Use this port to establish a management connection to the RS over a local or bridged E...

Страница 38: ...ts own internal cooling fan The vent on the front of the power supply is the inlet vent for the cooling fan Figure 2 4 shows the front view of an RS 8000 AC power supply Figure 2 4 Front view of an RS...

Страница 39: ...vering approximately 50 percent of the current needed Moreover if one of the power supplies fails the other power supply immediately assumes the entire load thus preventing any system outage The AC po...

Страница 40: ...Volt DC source Use 12 gauge to 14 gauge wire to connect the 48 Volt source to the RS 8600 DC power supply Use 12 gauge to 14 gauge wire for the safety ground Figure 2 7 shows the front view of an RS...

Страница 41: ...c module and the module in the slot labelled Fabric 2 serves as a redundant switching fabric module Figure 2 8 shows the front panel of the RS 8600 Switching Fabric module Figure 2 8 Front panel of RS...

Страница 42: ...9 shows the front panel of the 10 100Base TX line card Figure 2 9 Front panel of 10 100Base TX line card The following table lists the media specifications for the 10 100Base TX line card Table 2 9 L...

Страница 43: ...ignments EIA Category 3 4 or 5 unshielded twisted pair cabling Maximum 100 meters 328 feet segment length 100Base TX 802 3u standard RJ 45 connector wired as Media Data Interface Crossed MDIX see Tabl...

Страница 44: ...lit briefly during a reboot or reset of the RS and goes out as soon as the Control Module discovers and properly initializes the line card Online When lit this green LED indicates that the line card i...

Страница 45: ...RJ 45 connector on the network side of the segment cable Table 2 13 Connector specifications for 10 100Base TX line card Port type Specification 10Base T 802 3 standard RJ 45 connector wired as Media...

Страница 46: ...t briefly during a reboot or reset of the RS and goes out as soon as the Control Module discovers and properly initializes the line card Online When lit this green LED indicates that the line card is...

Страница 47: ...3u standard SC style Media Interface Connector MIC either connection pin in the MIC can be used for transmit or receive 62 5 micron multi mode fiber optic cable Maximum 412 meters 1352 feet segment l...

Страница 48: ...e Gigabit Ethernet line card has the following external controls indicators and connections Use the Hot Swap switch HOT SWP to deactivate the module prior to hot swapping See the Riverstone Networks R...

Страница 49: ...two independent Gigabit 1000 Mbps Ethernet ports The ports connect to multi mode fiber MMF cables Figure 2 15 shows the front panel of the 1000Base SX line card Table 2 18 SFP transceiver media speci...

Страница 50: ...275 meters 722 or 902 feet segment length for 62 5 micron fiber optic cable based on installed fiber bandwidth Maximum 500 or 550 meters 1640 or 1804 feet segment length for 50 micron fiber optic cabl...

Страница 51: ...icates when the port s transceiver receives flow control packets Per port Tx Green indicates when the port s transceiver transmits packets Orange indicates when the port s transceiver transmits flow c...

Страница 52: ...specifications for 1000Base LX line card Port type Specification 1000Base LX 802 3z standard also uses 802 3x for flow control SC style Media Interface Connector MIC either connection pin in the MIC...

Страница 53: ...ttent indicates that the port received an error during operation Red solid indicates that the port hardware detects a cable plugged into the port however a bad link is established Off indicates that n...

Страница 54: ...standard also uses 802 3x for flow control SC style Media Interface Connector MIC either connection pin in the MIC can be used for transmit or receive see 9 5 micron single mode fiber optic cable Maxi...

Страница 55: ...s Per port Rx Green indicates when the port s transceiver receives packets Orange indicates when the port s transceiver receives flow control packets Per port Tx Green indicates when the port s transc...

Страница 56: ...Connector specifications for 1000Base T line card Port type Specification 1000Base T 802 3ab standard RJ 45 connector wired as Media Data Interface Crossed MDIX see Table 2 26 for pin assignments EIA...

Страница 57: ...lugged into the port and a good link is established Red intermittent indicates that the port received an error during operation Red solid indicates that the port hardware detects a cable plugged into...

Страница 58: ...zation and control for each GBIC module Any combination of GBICs can be used on a single MPLS GBIC line card Figure 2 21 GBIC modules The MPLS Gigabit Ethernet GBIC line cards accept the GBIC modules...

Страница 59: ...The Offline LED also is lit briefly during a reboot or reset of the RS and goes out as soon as the Control Module discovers and properly initializes the line card Per GBIC RX Green indicates when the...

Страница 60: ...Gigabit GBIC line cards provide the power initialization and control for each GBIC module Any combination of GBICs can be used on a single Gigabit GBIC line card Figure 2 23 GBIC modules Per GBIC LINK...

Страница 61: ...8 or 9 125 mm single mode fiber cable terminated with SC connectors Maximum of 70 km of cable Table 2 31 Gigabit GBIC line card LEDs LED Description Online When lit this green LED indicates that the...

Страница 62: ...to negotiation failure This fault may occur if the link partner does not support full duplex Off indicates that auto negotiation has been disabled or the link is down Per GBIC LINK Green indicates tha...

Страница 63: ...alling PHYs into the ATM Multi rate line card The ATM Multi rate line card has two available slots Each slot accepts the following PHY interface modules Table 2 32 PHY modules for ATM Multi rate line...

Страница 64: ...F line card Table 2 33 LED description for ATM Multi rate line card LED Description PHY Green indicates that the PHY is operating properly and a link is established Amber indicates that the PHY is ina...

Страница 65: ...PS port Link 2 Protecting APS port 62 5 micron or 50 micron multi mode fiber optic cable 9 5 micron single mode fiber optic cable Maximum 1 kilometers for multi mode fiber optic cable Maximum 13 kilom...

Страница 66: ...a cable plugged into the port and a good link is established Red intermittent indicates that the port received an error during operation Red solid indicates that the port hardware detects a cable plug...

Страница 67: ...he line card indicates that the line card is offline powered off but is ready for hot swap The Offline LED also is lit briefly during a reboot or reset of the RS but goes out as soon as the Control Mo...

Страница 68: ...el of POS OC 12c SMF line card The following table lists the media specifications for the POS OC 12c MMF and POS OC 12c SMF line cards Table 2 38 Connector specifications for POS OC 12c line card Port...

Страница 69: ...ut is ready for hot swap The Offline LED also is lit briefly during a reboot or reset of the RS but goes out as soon as the Control Module discovers the line card Online When lit this green LED indica...

Страница 70: ...ansceiver Multi Source Agreement Table 2 41 LED description for MPLS POS OC 3c OC 12c line card LED Description Offline When lit this amber LED on the left side of the line card indicates that the lin...

Страница 71: ...rds Per port Rx Blinking Green indicates when the port s transceiver receives good packets Blinking Red indicates when the port s transceiver receives corrupt packets OFF no receive activity Per port...

Страница 72: ...21 Table 2 44 Pin assignments for quad serial line cards Pin Signal Pin Signal Pin Signal Pin Signal 1 P1_GND 16 P2_TXC_A 31 P1_GND 46 P2_TXD_A 2 P1_MODE 2 17 P2_TXC_B 32 P1_MODE 0 47 P2_TXD_B 3 P1_CT...

Страница 73: ...LED Description Offline When lit this amber LED on the left side of the line card indicates that the line card is offline powered off but is ready for hot swap The Offline LED also is lit briefly dur...

Страница 74: ...Port Type Specification HSSI HSSI rev 2 11 50 pin High Speed Serial Interface HSSI connector see Table 2 47 for pin assignments Recommended 3 meters 10 feet segment length for standard WAN line card...

Страница 75: ...ption for Dual HSSI line card LED Description Offline When lit this amber LED on the left side of the line card indicates that the line card is offline powered off but is ready for hot swap The Offlin...

Страница 76: ...ream headend cable to the laser receiver Adjust the upstream input level to the RS 8000 8600 CMTS module using the Riverstone software running on your router so the output of the laser receiver is the...

Страница 77: ...ve port that provide one WAN interfaces per WIC module Table 2 50 LED description for CMTS line card LED Description Link Each upstream port has a Link LED When this LED is green it indicates that a l...

Страница 78: ...Channelized T1 Two RJ 48c connectors ANSI T1 102 T1 107 T1 403 compliant Supports SF ESF Supports AMI B8ZS Table 2 52 Specifications for E1 WIC card Port type Specification Channelized E1 Two RJ 45 co...

Страница 79: ...nd all WICs use the following LEDs Table 2 54 Specifications for Clear Channel E3 WIC card Port type Specification Clear Channel E3 75 ohm coaxial BNC connectors G 703 G 704 and 732 compliant G 704 fr...

Страница 80: ...cal loopback Tx is looped back into Rx before leaving this device Amber the network has placed this port in loopback Rx is looped back out to Tx within this device Blinking Amber the Alarm Indication...

Страница 81: ...ess and send packets if configured to do so Offline When lit this amber LED indicates that the line card is offline powered off and is ready for hot swap The Offline LED also is lit briefly during a r...

Страница 82: ...Together the two line cards create an SRP node The SRP node is designed to connect to a dual SONET SDH ring running at OC 48c bit rates Figure 2 43 SRP line card Per port Link Alarm Green indicates th...

Страница 83: ...X G8M HTXA2 08 1000BASE LX G8M GLXA9 02 1000BASE SX G8M GSXA1 02 100BASE FX G8M HFXA1 08 G80 PAC 100 125 5A 200 240 3A 50 60 Hz PWR G80 PAC 100 125 5A 200 240 3A 50 60 Hz PWR 6 4 2 7 5 3 CM 1 PS2 PS1...

Страница 84: ...km 1550nm Table 2 60 LED description for SRP line card LED Description Online When lit this green LED indicates that the line card is online and is ready to receive process and send packets if configu...

Страница 85: ...with mate bridge position e g mate bridge connects slots 3 and 5 and user entered srp hw module base slot 5 config dual srp Rx This LED is intended to show receive activity to the line card Any packe...

Страница 86: ...c will not cause the LED to flash Wrap Off No wrap anywhere in ring or not part of ring Green solid Not wrapped but a wrap exists elsewhere in the ring overall performance is degraded Green blinking W...

Страница 87: ...the chassis out of the shipping box Never attempt to rack mount the RS chassis unaided Ask an assistant to help you hold the chassis Never operate the RS with exposed power supply bays or module slot...

Страница 88: ...eived the following equipment RS 8000 or RS 8600 chassis containing backplane fan module console cable RS 8000 or RS 8600 power supply One country specific power cable per power supply AC only One Con...

Страница 89: ...ntrol Module Redundant Switching Fabric Module RS 8600 only Specific line cards ordered 3 3 2 Installing the Chassis Install the RS 8000 8600 in a standard 19 inch equipment rack The RS chassis is equ...

Страница 90: ...ases the chassis If you accidentally leave the screws loose the chassis can slip and fall possibly becoming damaged 3 3 3 Installing an AC Power Supply The primary AC power supply is shipped separatel...

Страница 91: ...e 3 2 Physical Specifications for AC Power Supply Specification RS 8000 RS 8600 Dimensions 11 00 L x 7 70 W x 2 55 H 12 15 L x 7 70 W x 5 05 H Weight 6 5 lb 2 95 kg 12 0 lb 5 45 kg Power Output 300 W...

Страница 92: ...e power supply s front panel then pull the supply out of the chassis 3 Slide the DC power supply all the way into the slot firmly but gently pressing to ensure that the pins on the back of the power s...

Страница 93: ...ng block and the internal supplies Because of this internal arrangement it is necessary to connect both positive screws and both negative screws to the 48 Volt source This section describes a few opti...

Страница 94: ...and both 12 gauge negative wires are connected to the RS 8600 DC power supply wiring block See Figure 3 5 Figure 3 5 Splitting each source wire to two 12 gauge wires An alternate method of wiring the...

Страница 95: ...ch Router Getting Started Guide 3 9 Hardware Installation Installing the Hardware Figure 3 6 Tying RS 8600 DC supply lugs together Both positive and both negative lugs are tied together To True Ground...

Страница 96: ...over the Control Module slot use the 2 Phillips head screwdriver to remove it 2 Slide the Control Module all the way into the slot firmly but gently pressing to ensure that the pins on the back of th...

Страница 97: ...al support Connecting to the Control Module s Serial Port To attach the supplied console cable to the Control Module DB 9 port 1 Locate the console cable included with the RS 8000 8600 chassis The con...

Страница 98: ...8 Check both the upper and lower tracks 3 Lock down the left and right metal tabs to secure the switching fabric module to the chassis 4 Use the 2 Phillips head screwdriver to tighten the captive scr...

Страница 99: ...the pins on the back of the line card are completely seated in the backplane Note Make sure the circuit board and not the metal plate is between the card guides as shown in Figure 3 9 Check both the u...

Страница 100: ...facing away from the line card and position the GBIC module so that it is parallel with the slot door The 20 pin connector should be facing toward the empty GBIC slot of the line card see Figure 3 11...

Страница 101: ...l guides engage the alignment slots on the sides of the GBIC module Warning If the GBIC module does not go in easily do not force it If the GBIC is not oriented properly it will stop about one quarter...

Страница 102: ...e two captive screws that hold the option slot cover plate in place 2 Save the option slot cover plate 3 Insert the PHY card through the opening of the slot and align the sides of the PHY card with th...

Страница 103: ...3 13 To ground the shielding on the Rx cable Remove the jumper block on JP4 and place it on the pins of JP3 Note The industry standard for E3 is both Tx and Rx cable shielding grounded To be E3 indus...

Страница 104: ...t hold the option slot cover plate in place 2 Save the option slot cover plate 3 Hold the WIC card by the edges and position it so that it is parallel with the slot opening 4 Insert the WIC card throu...

Страница 105: ...s from two vertically adjacent slots 2 Insert one SRP line card into the lower slot and tighten its screws using the 2 Phillips head screwdriver 3 Insert the other SRP line card into the upper slots a...

Страница 106: ...rners of the bridge board Installation is now complete SFP laser interfaces can now be installed into the ports on the SRP line cards See Table 2 59 for a list of qualified SFPs 3 3 12 Installing SFP...

Страница 107: ...cs will not work properly when obstructed with dust or contaminants 3 3 13 Attaching the Network Cables to Line Cards With your RS 8000 8600 installed and connected to a management console you are now...

Страница 108: ...3 22 Riverstone Networks RS 8000 8600 Switch Router Getting Started Guide Installing the Hardware Hardware Installation...

Страница 109: ...covered with blanks 2 Check the power supplies to make sure they are attached to your power source 3 Make sure that the RS s DB 9 console port is connected to an active terminal or a PC running termi...

Страница 110: ...sh boot ros80 Loaded version file Loading kernel base 0x80001000 size 50592 base 0x8000d5a0 size 2803976 100 Image checksum validated RS 8000 System Software Version 8 0 0 0 Copyright c 2000 Riverston...

Страница 111: ...ring on the RS 8000 8600 Note If the message SYS E NOFLASHCARD appears while booting the RS the system has not detected a PC card If this occurs ensure that the PC card is properly inserted then reboo...

Страница 112: ...s you to display basic information and use basic utilities such as ping but does not allow you to display SNMP filter and access control list information or make other configuration changes You are in...

Страница 113: ...Interface Reference Manual Table 4 2 Common CLI line editing commands Key sequence Command Ctrl a Move cursor to beginning of line Ctrl b Move cursor back one character Ctrl d Delete character Ctrl e...

Страница 114: ...nfigure command in the CLI 3 Enter the following command The CLI displays the following message 4 Enter y to activate the changes Table 4 3 Configuration file contents File Descriptions Scratchpad The...

Страница 115: ...tware 1 Enter the following command from Configure mode 2 When the CLI displays the following message enter y to save the changes Alternately to save the Active configuration to the Startup configurat...

Страница 116: ...onfiguration file with the following possible annotations Commands without errors are displayed without any annotation Commands with errors are annotated with an E If a particular command has been app...

Страница 117: ...ation marks for example string with internal blanks 1 Enter the enable command to get to Enable mode in the CLI 2 Enter the following commands to set the system time and date and to verify your settin...

Страница 118: ...ered in the previous steps use the following command The CLI displays the following message 7 Enter y to activate the changes 8 To display the Active configuration exit the Configuration mode then ent...

Страница 119: ...Save the Active configuration to the Startup configuration file using the following command 10 When the CLI displays the following message enter y to save the changes to the Startup configuration file...

Страница 120: ...ype the following command for each password you want to set 4 Use the show command to examine the commands you just entered 5 Use the save active command to activate the commands 6 Exit the Configurat...

Страница 121: ...d directly to the RS through its DB 9 console port 1 Power cycle the RS 8000 8600 2 Enter Boot mode by interrupting the normal boot cycle by pressing the Esc key 3 From the boot prompt enter the set c...

Страница 122: ...yes rs boot boot pc flash boot ros80 skipconfig yes rs enable rs copy startup to scratchpad rs config rs config system set password login none rs config system set password enable none rs config syste...

Страница 123: ...arget is more than one hop away from the RS 8000 8600 configure the RS with a static route to the target If the RS is rebooted the static route allows a cold start trap to be sent to the trap target W...

Страница 124: ...ss and route your SNMP traffic through trusted networks only Here are the basic configuration commands to apply an ACL to the RS s SNMP agent allowing access to the RS 8000 8600 by only one management...

Страница 125: ...FORWARD MIB RFC 2096 DS1 MIB RFC 2495 P BRIDGE MIB RFC 2674 OSPF TRAP MIB RFC 1850 ENTITY MIB RFC2737 RIVERSTONE RS AGENT CAP MIB IF MIB RFC 2233 DS3 MIB RFC 2496 PPP LCP MIB RFC 1471 RMON2 MIB RFC 2...

Страница 126: ...0 8600 Switch Router Getting Started Guide Setting Up SNMP Initial Configuration RIVERSTONE INVENTORY MIB 6 19 01 RIVERSTONE CONFIG MIB RIVERSTONE DHCP MIB RIVERSTONE MPLS MIB RIVERSTONE QUEUE MIB Tab...

Страница 127: ...ng the configure command in the CLI 4 Enter the following command to specify the domain name for which the DNS server s have authority For example domain name riverstone com 5 Enter the following comm...

Страница 128: ...ere is an example 8 Use the ping command to verify that the RS can resolve the DNS server name into its IP address Here is an example rs system show dns DNS domain mrb com DNS server s 16 50 11 12 rs...

Страница 129: ...he SYSLOG server 3 Ensure that you are in Configure mode by entering the configure command in the CLI 4 Enter the following commands to add the SYSLOG server to the RS 8000 8600 set the message level...

Страница 130: ...purpose of the backup CM is to take over as the primary CM in the event that the primary CM fails In normal operation whenever changes are made to the primary CM s Configuration file the changes are...

Страница 131: ...for the CMs within the RS 8000 8600 chassis have now changed the primary CM now resides in slot CM 1 and the backup CM resides in slot CM As configuration changes are saved on the new primary CM in s...

Страница 132: ...llar sign This indicates that the display belongs to the backup CM The dollar sign also appears if you connect to the backup CM through its console port When connected to the backup CM either through...

Страница 133: ...e taken into account when using redundant Control Modules Booting the RS 8000 8600 From the Network If you have set the RS 8000 8600 to obtain its image software from a TFTP server see Section 5 3 Loa...

Страница 134: ...on the RS the default relationship between the primary and backup CM is reestablished In other words the Control Module in slot CM whatever its role becomes the primary CM and the Control Module in s...

Страница 135: ...ot settings by using the system show version command Note the current Image Boot Location Here is an example In the example above the location pc flash indicates that the RS is set to use the factory...

Страница 136: ...will use when rebooted Here is an example system image add IPaddr of TFTP host image file name rs system image add 134 152 178 5 tftpboot ros81 Downloading image tftpboot ros81 from host 134 152 178...

Страница 137: ...nt boot settings by entering the system show version command Note the current Boot Prom Image version Here is an example 2 Copy the upgrade boot PROM image software onto a TFTP server that the RS can...

Страница 138: ...Networks RS 8000 8600 Switch Router Getting Started Guide Upgrading Boot PROM Software Managing Software Note The image file name is the full directory path and filename to the bootPROM image file on...

Страница 139: ...M software is in the internal memory of the RS s Control Module rs system promimage upgrade 134 152 178 5 tftpboot prom 211 Downloading image tftpboot prom 211 from host 134 152 178 5 image is a prom...

Страница 140: ...the normal boot process 3 At the Boot prompt enter the set command to view the current bootPROM variable values Here is an example 4 Notice in the example above that netaddr netmask and gateway have t...

Страница 141: ...et netaddr IPaddr rs boot set netmask subnet mask rs boot set gateway IPaddr rs boot set bootsource dir filename rs root set bootaddr IPaddr rs boot set netaddr 134 152 179 132 rs boot set netmask 255...

Страница 142: ...g the normal startup sequence by pressing the Esc key 3 Use the set command to obtain the RS s MAC address Make sure to add one to the address to get the MAC address of the CPU Here is an example 4 Us...

Страница 143: ...e code for these specific line cards checksum has changed The basic process of performing a hitless upgrade is outlined below New software is placed on a reachable TFTP server Software is downloaded t...

Страница 144: ...onto the backup CM rs system image add 134 141 178 5 tftpboot rod12 backup cm Warning Be sure to also add this image to the Primary Control Module so that the same images exist on the Control Modules...

Страница 145: ...Primary Control Module so that the same images are chosen for next reboot on the Control Modules Failure to do so may prevent hot failover from working correctly Choosing image on Backup CM Making ima...

Страница 146: ...upgrade process is being performed 5 5 1 Upgrading FPGA Code from a TFTP Server Follow these steps to upgrade a line card s FPGA code using a TFTP server In this example the TFTP server address is 10...

Страница 147: ...sh RAM card the upgrade is performed using the image on the flash RAM card in slot0 verifying programming successful Programming complete upgrading POSITRON_FLSH_1_3 in slot 6 with pos13_oc12_mpls bin...

Страница 148: ...path to the FPGA files on the flash RAM card As with the previous example the line card is hot swapped out and then back in as part of the upgrade process rs system linecard upgrade 10 50 89 88 posre...

Страница 149: ...lugged into a power source and the power source is active Also check to see whether the switch on the power supply is in the ON position The power supply is installed but is not operating Check the po...

Страница 150: ...n Commands in the Scratchpad to activate the changes Configuration changes are not reinstated after a reboot Use the procedure in Section 4 3 2 Saving the Active Configuration to the Startup Configura...

Страница 151: ...uenta las siguientes advertencias de seguridad para prevenir una posible lesi n accidental al manipular el hardware del Riverstone RS Switch Router RS Para evitar una posible lesi n tenga cuidado al s...

Страница 152: ...B 2 Riverstone Networks RS 8000 8600 Switch Router Getting Started Guide CONSIDERACIONES DE SEGURIDAD...

Страница 153: ...BGP 2 3 4 Boot mode boot PROM boot sequence boot source bootp BootP client autoboot reboot set autoboot bootp set command BootP TFTP server configuring bootsource bridging address based flow based L2...

Страница 154: ...DB 9 port default baud rate default name DNS DNS domain name Dual HSSI line card overview dual serial port DVMRP E E3 WIC setting jumpers en0 Ethernet interface Enable mode exit command F fail over fa...

Страница 155: ...ootP TFTP server loading software from the network M management CLI SNMP traps management platforms managing software MIB II MIB II statistics MIBs MPLS features G8M GBCMM 02 line card MPLS activated...

Страница 156: ...0 bridging and VLAN protocols default name routing protocols security RST switch RTAC 408 844 0010 support riverstonenet com www riverstonenet com support S SAP save active save startup saving active...

Страница 157: ...pes SYSLOG parameters syslog conf file system image add system image choose system image list system information system messages system promimage upgrade system set backup cm timeout system set contac...

Страница 158: ...User access mode V verifying your shipment viewing active configuration viewing current configuration VLANs port based protocol based secondary IP addresses VPN persistence W web caching web hosting...

Результаты поиска

Содержание RS 8000

Отзывы:

Бренды по названию

Популярные бренды

Riverstone Networks RS 8000, Руководство по началу работы

Результаты поиска

Содержание RS 8000

Отзывы:

Бренды по названию

Популярные бренды