background image

Messages and How to React to Them

The following messages may be displayed by your Car Navigation System.

• There are occasions when you may see error messages other than those shown here. In such a case, 

follow the instructions given on the display.

 ³<RXFDQQRWXVHWKLVIXQFWLRQZKLOVWGULYLQJ´

When:

while trying to make a menu selection.

What to do:

Pull over and come safely to a halt, apply the handbrake, and then try again.

 ³7KLVLVQRWWKHDSSURSULDWHGLVF3OHDVHLQVHUWWKHDSSURSULDWHGLVF´

When:

1. If you try to use a disc which is not compatible with   this system.

2. If you insert a disc upside down.

3. If the disc is dirty.

4. If the disc is cracked or otherwise damaged.

What to do:

1. Insert a suitable disc.

2. Insert the disc with the label upward.

3. Clean the disc.

4. Consult your dealer.

 ³$QHUURUKDVRFFXUUHG3OHDVHSRZHURIIDQGRQDJDLQ´

When:

if there is an internal problem.

What to do:

Turn off the power and then switch the system on again.

 ³7KHROGHUYHUVLRQGLVFFDQQRWEHXVHG´RU³6RPHIXQFWLRQVPD\QRWZRUNZLWK

WKLVQHZYHUVLRQ´

When:

if the map disc you insert is an older version or a newer version.

What to do:

eject the disc and insert a suitable one.

 ³7KHVHOHFWHGORFDWLRQLVQRWFRQWDLQHGRQWKHGLVF´

When:

if you attempt to use the destination history to display a destination not covered 
by the current map disc.

What to do:

insert the map disc that covers your destination.

 ³6HDUFKLQJIRUWKHPDSQRZ´

When:

if reading from the map disk takes excessive time.

What to do:

wait for the map to appear.

Содержание AVIC-505

Страница 1: ...Mobile Navigation System Manual AVIC 505 ...

Страница 2: ...olling the map display Viewing detailed information Changing the map scale Your First Destination 44 Setting a Route to Your Destination 45 Setting a Route Using the Destination History 46 Using the Destination history Working with the Destination history Setting a Route Home or to the Stored Location 50 Setting a route home Setting a route to the stored location Registering locations Finding a De...

Страница 3: ...destination Wide normal display Volume control Demonstration Operating the System by Voice 117 Voice Operation 117 Successful Voice Recognition 118 Using Voice Operation 119 Setting a Route and Displaying Points of Interest by Voice 120 Activating voice recognition Routing home or to the stored location Routing to personal destinations Overlaying points of interest on the map Using Voice Recogniti...

Страница 4: ... business only on such Pioneer products You shall not copy reverse engineer translate port modify or make derivative works of the Software You shall not loan rent disclose publish sell assign lease sublicense market or otherwise transfer the Software or use it in any manner not expressly authorised by this agreement You shall not derive or attempt to derive the source code or structure of all or a...

Страница 5: ... reliability or otherwise LPLWDWLRQ RI OLDELOLW IN NO EVENT SHALL PIONEER BE LIABLE FOR ANY DAMAGES CLAIM OR LOSS INCURRED BY YOU INCLUDING WITHOUT LIMITATION COMPENSATORY INCIDENTAL INDIRECT SPECIAL CONSEQUENTIAL OR EXEMPLARY DAMAGES LOST PROFITS LOST SALES OR BUSINESS EXPENDITURES INVESTMENTS OR COMMITMENTS IN CONNECTION WITH ANY BUSINESS LOSS OF ANY GOODWILL OR DAMAGES RESULTING FROM THE USE OF...

Страница 6: ...oduct thereof except as permitted by the laws and regulations of the Government and the laws and regulations of the jurisdiction in which you obtained the Software 7HUPLQDWLRQ This Agreement is effective until terminated You may terminate it at any time by destroying the Software The Agreement also will terminate if you do not comply with any terms or conditions of this Agreement Upon such termina...

Страница 7: ...his manual and keep this manual handy for future reference Should this product fail to operate properly contact your dealer or the nearest authorised Pioneer service facility A CLASS 1 LASER PRODUCT label is affixed to the bottom of this device This product complies with the EMC Directives 89 336 EEC 92 31 EEC and CE Marking Directive 93 68 EEC ...

Страница 8: ...e latest permissible routes road conditions or traffic restrictions Traffic restrictions and advisories currently in force should always take precedence over guidance given by this product Always obey current traffic restrictions even if this product provides contrary advice Failure to input correct information about your vehicle type or the local time may result in the product providing improper ...

Страница 9: ...combination of technology is what we call a Mobile Navigation System How does it work This Pioneer Mobile Navigation System relies on detailed map information stored on a CD ROM Before you begin a journey the system helps you provide information about your destination A suggested route is then automatically calculated and then displayed At the same time using a state of the art global positioning ...

Страница 10: ...s manual for details of each function Operation Guidance Voice guidance for operation is provided On screen help Descriptions of each item on the menu are available Remote control The Navigation commander makes operation simple Map matching for increased accuracy A processing technique known as map matching increases the accuracy with which your current location is shown on the map Operate using v...

Страница 11: ... Navigation System and takes you through the initial setup process You should read this chapter first 2 Basic Operation Read this chapter after going through the setup process It explains what you see on the display and how to use the menus You will then be ready to navigate to your first destination 3 Setting a Route to Your Destination This chapter describes a number of ways to choose a destinat...

Страница 12: ...y Before moving on take a few minutes to read the following information about the conventions used in this manual Familiarity with these conventions will help you greatly as you learn how to use your new equipment Buttons on your Navigation commander are referred to as N NAVI button K button Options in various menus are referred to like this DESTINATION HISTORY and SETTINGS Actions that you are to...

Страница 13: ...ittle time reading and understanding the text that follows as an introduction to handling both the hardware and software components of your new system Hardware Components There are three main parts to the hardware the main unit the display and a remote control unit called a Navigation commander The main unit and display should be properly installed in your vehicle before you attempt to follow the ...

Страница 14: ...s in Its use is described in more detail in the relevant sections of this manual RETURN button While using a menu this button will cancel the present operation and take you back to the previously displayed menu or list button This button is used to enlarge the scale of the displayed map and also to cycle through multiple items of information on the display button This button is used to reduce the ...

Страница 15: ...m on page 140 CAUTION Take care to insert the batteries in the correct orientation as shown by the and marks in the diagram Do not mix new batteries with old Do not mix different types of batteries Even batteries of the same size may have different voltages Remove the batteries from the Navigation commander if it will be out of use for a long period If a battery leaks completely clean any liquid o...

Страница 16: ...to drive straight forward for about 100 yards 100 m Please choose a quiet location with no obstacles for this purpose 1RWH The explanation that follows assumes that the system has been properly installed according to the accompanying Installation Manual Inserting the programme disc The programme disc holds the basic software needed by your system In order to install the software you must first ins...

Страница 17: ...gramme disc designed for use with this system For example music CDs and other CD ROMs cannot be used Do not attempt to use discs which are cracked scratched bent or otherwise damaged ORVH WKH FRYHU E SXVKLQJ LW JHQWO XSZDUG The screen indicates that you can now install the programme see next section Your CD ROM discs should be treated with care See Handling and Care of CD ROM Discs on page 139 for...

Страница 18: ... SKIP by clicking the button with the joystick while it is highlighted installation is aborted If the programme has already been installed the message PLEASE EJECT THE DISC is displayed If the programme has not yet been installed SKIP has no effect OLFN WKH EXWWRQ ZLWK WKH MR VWLFN WR LQSXW WKH FKRLFH DQG EHJLQ LQVWDOOLQJ WKH SURJUDPPH The programme is now installed automatically Progress is indic...

Страница 19: ...RW E SXVKLQJ GRZQ DW WKH SRLQW PDUNHG 7 The disc is automatically ejected You are asked to insert the appropriate disc see next section Take care to return the programme disc to its holder and store it in a safe place in case you need it again for changing the language for example ...

Страница 20: ... appears Read thoroughly the message on this screen Do not attempt to use discs other than a map disc designed for use with this system For example music CDs and other CD ROMs cannot be used Do not attempt to use discs which are cracked scratched bent or otherwise damaged ORVH WKH FRYHU E SXVKLQJ LW JHQWO XSZDUG IWHU UHDGLQJ WKH FDXWLRQ FOLFN WKH EXWWRQ WR GLVPLVV LW You are asked whether you want...

Страница 21: ...LRQ QRZ XVH WKH MR VWLFN WR FOLFN GRZQ DQG KLJKOLJKW 12 LW VKRXOG WXUQ HOORZ DQG WKHQ FOLFN WKH EXWWRQ The text palette appears If you want to register your home location later highlight LATER and click the button You will be presented with this display again next time you start up If you never want to register your home location choose IGNORE If you choose IGNORE you can register your home locati...

Страница 22: ...t of matching cities towns or villages appears If you need further help with entering text using the text palette see The Text Palette on page 38 0RYH WKH MR VWLFN GRZQ WR KLJKOLJKW RXU FLW WRZQ RU YLOODJH DQG FOLFN WKH EXWWRQ The text palette appears again this time for entry of your street name If you need further help making a selection from this list see Selecting from a menu or list on page 3...

Страница 23: ...WWRQ The text palette appears again this time for entry of your house number If the map disc has no house number information a list of intersecting streets is displayed for details of entering intersecting street information see Entering intersecting street information on page 61 QWHU RXU KRXVH QXPEHU KLJKOLJKW 2 DQG FOLFN WKH EXWWRQ A map showing the selected location is displayed OLFN WKH EXWWRQ...

Страница 24: ...a house number range on page 60 is displayed on the map to mark your home only at the map scales of 25 m to 500 m 0 02 mile to 0 5 mile You can also search for your home location on the map by moving the joystick to the right before inputting a house number Scroll the map if the necessary to place 5 exactly on your home location and click the button See Scrolling the map display on page 41 for det...

Страница 25: ... a form unlikely to be recognised If you lose your password you will not be able to use the system You are next asked if you want to register a password 7R UHJLVWHU D SDVVZRUG QRZ XVH WKH MR VWLFN WR FOLFN GRZQ DQG KLJKOLJKW 12 OLFN WKH EXWWRQ The new password display is shown If you want to register a password later choose LATER You can choose to register or change a password at any time in the f...

Страница 26: ...r see page 113 LJKOLJKW 6 DQG FOLFN WKH EXWWRQ LI WKH SURQXQFLDWLRQ ZDV FRUUHFW The password is registered and the Destination menu is displayed If you wish to hear the pronunciation again select REPEAT instead If the pronunciation is incorrect select NO and the text palette will appear once again for you to enter a new password Be sure to input a different password which is easy to pronounce You ...

Страница 27: ...is shown instead of C red or M and the map does not reflect your current location proceed as follows Wait for C red or M to appear If C red or M fails to appear after five minutes then it is likely that the GPS is unable to pick up signals Move to more open surroundings and stop your vehicle The most probable reason for C red or M failing to appear is that your vehicle is surrounded by thick folia...

Страница 28: ...EXWWRQ The Destination menu is displayed 8VLQJ WKH MR VWLFN VFUROO GRZQ XQWLO 6 77 1 6 LV KLJKOLJKWHG WKHQ FOLFN WKH EXWWRQ The Settings menu is displayed LJKOLJKW 2 7 21 67 786 DQG FOLFN WKH EXWWRQ The location status display is shown ...

Страница 29: ...on about use of memories 3UHVV WKH N 1 9 EXWWRQ KHQ C UHG DSSHDUV GULYH IRUZDUG RQ D OHYHO URDG DW NP SHU KRXU PSK RU PRUH IRU DERXW VHFRQGV Make sure you have chosen a level stretch of road and drive straight ahead If C black is still displayed you must go through the calibration process again Before doing so check that a vehicle speed pulse is being received by checking the LOCATION STATUS displ...

Страница 30: ...plete Registering your Mobile Navigation System with Pioneer We recommend that you register your Mobile Navigation System with Pioneer Registration information can be obtained on screen To see the information select SYSTEM REGISTRATION from the Destination menu and click the button ...

Страница 31: ...dbrake Day and night map backgrounds To prevent the normal display from appearing too bright and distracting you when driving after dark or in dull conditions the map background changes automatically to a darker colour when you switch on your vehicle lights You can however turn off this automatic switching see Auto day night background on page 112 The examples in this manual are illustrated using ...

Страница 32: ...HG What Next This completes the setup of your Mobile Navigation System It is now ready for use We suggest you now switch it off and read Basic Operation that follows before attempting to use the system while driving ...

Страница 33: ...Q WKH EDVLFV VR RX FDQ TXLFNO URXWH IURP WR LW LV LPSRUWDQW WKDW RX ILUVW IDPLOLDULVH RXUVHOI ZLWK FRPPRQ VFUHHQ RSHUDWLRQV DQG WKH W SHV RI LQIRUPDWLRQ GLVSOD HG RQ WKH VFUHHQ Q WKLV FKDSWHU RX ZLOO OHDUQ KRZ WR LQWHUSUHW WKH LQIRUPDWLRQ SUHVHQWHG WR RX KRZ WR PRYH EHWZHHQ WKH YDULRXV W SHV RI GLVSOD DQG KRZ WR HQWHU WH W DQG RWKHU LQIRUPDWLRQ The information in this section assumes that you are ...

Страница 34: ...e Destination menu appears once you have dismissed the opening screen and entered your password You are presented with a list of options that help you find or specify a destination in order to obtain guidance to it If you have used the system before and you were being guided to a destination when you last switched it off or turned off the ignition then guidance to your destination will resume as s...

Страница 35: ...t left off and give you onward guidance toward your destination If you press the K MENU button on the Navigation commander while in guidance mode the Guidance menu is displayed This gives access to the various functions and features you need while under guidance You can also gain access to the various system settings from this menu Full details of Guidance menu usage are given in Guidance to Your ...

Страница 36: ...ng from a menu or list below explains how to choose an item from a menu Selecting from a menu or list Selecting from a menu is a two step procedure in which you first highlight an option and then actually select it by clicking the button The same procedure is also used to select from any lists or submenus which appear as a result of making choices from these main menus You may already have some ex...

Страница 37: ...ates that a help text or other information is available about that item View this information as follows I LV GLVSOD HG WR WKH OHIW ZKHQ D PHQX LWHP LV KLJKOLJKWHG FOLFN OHIW ZLWK WKH MR VWLFN WR YLHZ WKH LQIRUPDWLRQ The help information is displayed 7R UHWXUQ WR WKH PHQX FOLFN WKH EXWWRQ ...

Страница 38: ...ntry box and a palette of letters numbers and other icons that you can select A cursor a small underscore in the text entry box marks the position at which the next character will be input The icons that appear in the text palette vary according to the type of information you are expected to input Delete backward deletes the previous character Space moves the cursor forward D Lists recent results ...

Страница 39: ... D VLPLODU ZD XQWLO RX KDYH HQWHUHG WKH FRPSOHWH WH W You will notice that your choice of characters is limited at each point to those matching locations on the map This helps to speed up the entry of text RX FDQ GHOHWH D FKDUDFWHU XVLQJ Depending on the situation other icons may appear in the text palette and these can be selected in a similar way with the joystick KHQ WKH WH W LV FRPSOHWH VHOHFW...

Страница 40: ...nt location is shown on the map The meaning of the various icons on the map display is as follows M The current location of your vehicle The arrow indicates your heading and the display moves automatically as you drive Map scale indicator The figure gives the distance represented by the red bar A Radius mark Circle around your current location with a radius equal to the red bar on the map scale in...

Страница 41: ... while scrolling the map minor roads will be suppressed from the display This increases the scrolling speed To stop scrolling release the joystick and allow it to return to the centre position Scrolling will stop immediately To return the map to a display of your current location again press the N NAVI button on your Navigation commander Scrolled map showing cross hairs 5 Scroll location The cross...

Страница 42: ...etailed information The detailed information may include the following Detailed street names Detailed city town or village names House number ranges The name of personal destination Information about points of interest overlaid on the map See Working with points of interest on page 69 OLFN WKH EXWWRQ DESTINATION and related information are displayed if available If 5 is positioned over a road the ...

Страница 43: ...is indicated by the map scale indicator toward the bottom right of the map You can easily increase or decrease the map scale zoom in or zoom out using the and buttonsontheNavigationcommander Eachclickstepsthescaleupordowninthefollowing order 25 m 50 m 100 m 200 m 500 m 1 km 2 km 5 km 10 km 20 km 50 km 100 km 200 km 500 km 0 02 mi 0 05 mi 0 1 mi 0 25 mi 0 5 mi 0 75 mi 1 mi 2 5 mi 5 mi 10 mi 25 mi 5...

Страница 44: ... destination manually once a map of the nearest city town or village is displayed on the screen Read section Finding a Destination by Specific Post Code on page 62 if You know only the post code of your destination You want to view a particular post code area on the map and then manually choose a nearby destination You know the post code street name and house number of your destination Read sectio...

Страница 45: ... chosen from a list a specified point on the map Some roads and streets have restrictions that limit access to certain types of vehicle In order to set a correct route your Mobile Navigation System must know what type of vehicle you are driving Make sure you correctly select your vehicle type before attempting to set a route see Vehicle type on page 107 The GO TO registered location name item appe...

Страница 46: ...hown at top right Listings that have been ticked see Working with the Destination history on page 48 appear at the top of the list in alphabetical order followed by the listings that have not been ticked Destinations that have been renamed also display the 7 voice operation icon and may be selected by voice command see Routing to personal destinations on page 122 If the list is too long to show on...

Страница 47: ...ay may not be used in a route that is set even though MOTORWAY PRIORITISED is selected By default routes are set via motorways if appropriate Various criteria are taken into consideration in setting a route and it may take your system a short time to find the suggested route I RX ZDQW WR DYRLG XVLQJ PRWRUZD V WKHQ FOLFN WKH EXWWRQ ZKLOH WKH DERYH PHVVDJH LV GLVSOD HG The screen displays AVOID MOTO...

Страница 48: ...ll be shown and the route will not be set When this happens set the destination to a location close to the present location and divide the route in to multiple parts Working with the Destination history Whenever you set a route your destination is automatically added to the Destination history up to a total of 98 However you are free to make changes to any listing in the Destination history at a l...

Страница 49: ...f you choose a ticked listing from the Destination history the name of this menu changes to RENAME THIS DESTINATION and you will be asked to rename the destination If you choose to rename the destination click the button If the Destination history exceeds the limit 98 listings are deleted beginning with the oldest However ticked listings will not be automatically deleted DELETE FROM PRIORITY LIST ...

Страница 50: ...ou are asked to confirm that you want to delete Choose YES to delete the listing s After making a selection the Destination history is displayed again Setting a Route Home or to the Stored Location Use these functions to quickly set a route back home or to a particular stored location from wherever you are You can register a single stored location for easy and quick routing from any current locati...

Страница 51: ...ays MOTORWAY PRIORITISED See step 3 to 5 of Using the Destination history on page 46 for details of how to proceed If you have not registered a location you will then be given the choice of registering one For details of how to register the stored location see Registering locations below Before a stored location is registered this menu item reads ROUTE TO When you register a location it becomes GO...

Страница 52: ...287 72 IURP WKH HVWLQDWLRQ PHQX XVLQJ WKH MR VWLFN OLFN OHIW ZLWK WKH MR VWLFN If a home address or stored location has already been registered you can remove it by highlighting DELETE with the joystick and clicking the button In this case you will be asked to confirm that you want to delete the location Highlight YES and click the button to delete The registered address or stored location is dele...

Страница 53: ... showing the selected location is displayed OLFN WKH EXWWRQ Your home address or the address you have entered for the stored location is displayed I UHJLVWHULQJ WKH VWRUHG ORFDWLRQ FOLFN WKH EXWWRQ WR GLVSOD WKH WH W SDOHWWH If you are registering your home address simply click the button to complete the process and return to the Destination menu ...

Страница 54: ...EXWWRQ LI WKH SURQXQFLDWLRQ ZDV FRUUHFW The stored location is registered and the Destination menu is displayed You can now proceed to set a route home or to the stored location If you wish to hear the pronunciation again select REPEAT If the pronunciation is incorrect select NO and the text palette will appear once again for you to enter a new name Be sure to input a different name which is easy ...

Страница 55: ...r uses of this function are to route to any city or town centre or to find a route to a particular road or motorway Entering city town and street information The first step in using this function is to tell the system which city town or village your destination is in and the name of the street or road 6HOHFW 675 7 7 6 5 IURP WKH HVWLQDWLRQ PHQX XVLQJ WKH MR VWLFN DQG FOLFN WKH EXWWRQ The city town...

Страница 56: ...ternative you can obtain a list of recently searched cities towns and villages by selecting D OLFN WKH MR VWLFN GRZQ WR HQWHU WKH OLVW DQG WKHQ KLJKOLJKW RXU FKRLFH LQ HOORZ Scroll quickly up and down using the and buttons You can also click to the left toward to get more information about the highlighted city town or village OLFN WKH EXWWRQ The street input display appears You can continue enteri...

Страница 57: ... GHVWLQDWLRQ VXFK DV D KRXVH RU EXLOGLQJ QXPEHU LQ WKH FDVH RI DQ XUEDQ VWUHHW RU DQ LQWHUVHFWLRQ You can also click to the left toward to get more information about the highlighted road or street If you clicked the button above the next step depends on what information you entered If you did not enter the name of a city town or village and if there is more than one street matching the name you ha...

Страница 58: ...obtain more information about the highlighted city town or village If you input a city town or village street at the street input display and now choose NEAREST CITY you are asked if you want to route using motorways or not Route setting then begins to the closest point on the selected street see steps 3 to 5 in Using the Destination history on page 46 If you selected a motorway at the street inpu...

Страница 59: ...whether to route using motorways or not then a route will be set to the location corresponding to the selected house number as in steps 3 to 5 in Using the Destination history on page 46 Use of the text palette is described in The Text Palette on page 38 You can highlight E to route to the closest point on the street You can highlight B to choose an intersecting street as your destination see Ente...

Страница 60: ...GRZQ WKH OLVW ZLWK WKH MR VWLFN DQG FOLFNLQJ WKH EXWWRQ RX ZLOO EH DVNHG ZKHWKHU WR URXWH XVLQJ PRWRUZD V RU QRW WKHQ D URXWH ZLOO EH VHW DV LQ VWHSV WR LQ 8VLQJ WKH HVWLQDWLRQ KLVWRU RQ SDJH As an alternative you can view the chosen section of road on the map and immediately set a route to it To do this highlight it click right with the joystick and follow the instructions in Finding a Destinatio...

Страница 61: ...WR KLJKOLJKW DQ LQWHUVHFWLRQ OLFN WKH EXWWRQ WR VHW D URXWH WR WKH KLJKOLJKWHG LQWHUVHFWLRQ You will be asked whether to use motorways or not as described in steps 3 to 5 of Using the Destination history on page 46 You can obtain more information about the intersection by clicking left on a highlighted entry As an alternative you can view the intersection on the map and immediately set a route to ...

Страница 62: ...st way to locate it for route setting 8VH WKH MR VWLFN WR VHOHFW 3267 2 6 5 IURP WKH HVWLQDWLRQ PHQX DQG FOLFN WKH EXWWRQ The post code text palette appears 8VH WKH WH W SDOHWWH WR HQWHU WKH SRVW FRGH KHQ RX KDYH ILQLVKHG KLJKOLJKW 2 DQG WKHQ FOLFN WKH EXWWRQ A list of matching post codes is displayed Use of the text palette is described in The Text Palette on page 38 Select the D icon to display ...

Страница 63: ...nd 5 of Entering city town and street information on page 55 A right click with the joystick will display a map view of the post code area Click the button to route to the 5 mark in the centre of the map or reposition the 5 mark to a desired location in the post code area then press to set the 5 mark as your destination ...

Страница 64: ...terest on the maps so you might for example choose to always show hotels offering a particular chain Choosing a point of interest 8VH WKH MR VWLFN WR VHOHFW 6 5 32 176 2 17 5 67 IURP WKH HVWLQDWLRQ PHQX DQG FOLFN WKH EXWWRQ A list of point of interest categories appears in alphabetical order Each is illustrated with an icon this icon will appear on the map if you choose to display a particular typ...

Страница 65: ... are interested in You are then given the choice of listing all points of interest of the chosen type searching for one by name or searching the list for those within a particular city town or village or within a certain distance of your present location If you wish to search for all categories at once select CATEGORY TYPE UNKNOWN from the bottom of the list If you select CATEGORY TYPE UNKNOWN fro...

Страница 66: ...A list of matching points of interest is displayed Use of the text palette is described in The Text Palette on page 38 LJKOLJKW D SRLQW RI LQWHUHVW DQG FOLFN WKH EXWWRQ WR VHW D URXWH WR LW You will be asked whether to avoid motorways or not as described in steps 3 to 5 of Using the Destination history on page 47 You may highlight a point of interest then click right with the joystick to view it o...

Страница 67: ...est from the current location is shown by an arrow Up to 30 points of interest in order of distance from your present location are displayed If you wish to modify the chosen distance range simply highlight a different one and click the button the list will change to reflect your new selection LJKOLJKW D SRLQW RI LQWHUHVW IURP WKH OLVW DQG FOLFN WKH EXWWRQ WR VHW D URXWH WR LW You will be asked whe...

Страница 68: ...ies towns or villages matching your input is displayed LJKOLJKW D QDPH RQ WKH OLVW DQG FOLFN WKH EXWWRQ You are presented with another text palette where you enter the name of the point of interest you wish to route to List all A list of all points of interest in the selected category appears See Search by name You may highlight a city town or village then click right with the joystick to view it ...

Страница 69: ...gory on the list Specific chain The category is marked with a tick and a display allowing selection of a chain type appears Select a chain type and click the button to show the map view of the category selected You can select only one chain type Eliminate this category The tick to the left of the category is deleted and the icons representing points of interest in the category are removed from the...

Страница 70: ...arching for a destination on the map KRRVH 0 3 6 5 IURP WKH HVWLQDWLRQ PHQX The map appears The map displayed is the one shown when it was last used Go to step 2 of Finding a Destination on the Map below If the map was left in scroll mode when it was last used it appears again in scroll mode If the N NAVI button was used to display your current position when the map was last used your current posi...

Страница 71: ...n or village then 5 indicates the centre of the city town village I RX ZDQW WR URXWH WR D ORFDWLRQ QHDUE VFUROO WKH PDS XVLQJ WKH MR VWLFN You can also use the and buttons to increase or decrease the scale of the map KHQ RX DUH VDWLVILHG ZLWK WKH ORFDWLRQ DQG ZDQW WR VHW D URXWH WR LW FOLFN WKH EXWWRQ DESTINATION and related information are displayed if available If you press the N NAVI button the...

Страница 72: ...hen using this function AREAS TO BE AVOIDED Allows you to specify areas that will be avoided when setting a route to your destination This feature allows you to avoid congestion prone areas VEHICLE TYPE Allows you to specify the type of vehicle you are driving This is important since accurate route setting depends on the system knowing your vehicle type The default setting is SALOON CAR HOME LOCAT...

Страница 73: ...DQFH IXQFWLRQV RIIHUHG E WKH V VWHP About Screen Guidance and Voice Guidance Your Mobile Navigation System provides you with directions as you drive toward your destination As well as screen instructions you will hear voice directions CAUTION This Mobile Navigation System is intended solely as an aid to you in the operation of your vehicle It is not a substitute for your attentiveness judgment and...

Страница 74: ... been set Once route setting is completed the map appears on the display and your current location is shown by M The suggested route appears as a bold bright green line leading away from your vehicle s position as marked by M HJLQ GULYLQJ LQ WKH GLUHFWLRQ LQGLFDWHG E M As you drive the M mark showing your vehicle s position moves accordingly ...

Страница 75: ...dance simply press the N NAVI button on the Navigation commander You will hear the directions for the upcoming turn once again What do you hear As you drive in guidance mode the system will provide you with a range of information about upcoming turns and the streets you are passing It also warns you when you are nearing your destination You will hear Distance to the next turn or other instruction ...

Страница 76: ...orms or modes Map mode indicates your progress on the map with M Arrow mode displays a simple representation of upcoming intersections indicating which way you should turn Split Screen mode combines both methods of guidance on the display Map mode This is the mode that is displayed when guidance begins In this mode the position of your vehicle is superimposed on the map It provides an easily under...

Страница 77: ... Remaining distance to your destination Name or designation of current road or street Way point icon Compass icon Origin icon if your origin is on the map As you approach a intersection an enlarged map of the intersection is displayed This makes it much easier to navigate your way around complex intersections If you scroll the map while in this enlarged view the normal map reappears With AUTO ROAD...

Страница 78: ...rway junction If the information is too long to display in full it is truncated with Distance to the next way point Your route in bright green Your present position and direction displayed by M as you approach an intersection only Name or designation of current road or street Compass icon Points of interest in the vicinity of you current location as selected for overlay on the map see Working with...

Страница 79: ...left the set route a map is displayed Displaying upcoming intersections In Arrow mode you can also view upcoming intersections KLOH LQ UURZ PRGH FOLFN XS ZLWK WKH MR VWLFN The display divides into two sections The usual information about the next intersection is shown to the left On the right is information about intersections beyond the next one 7R UHWXUQ WR WKH QRUPDO UURZ PRGH GLVSOD SUHVV WKH ...

Страница 80: ...arding upcoming turns while also allowing you to see your progress on the map Switching between on screen guidance modes You can switch between the three guidance modes at any time without interrupting the flow of directions OLFN WKH EXWWRQ As you click the button the mode cycles through the sequence Map mode Arrow mode Split Screen mode Map mode You can also set the guidance mode from the Guidanc...

Страница 81: ...on can be turned off in the Settings menu see page 102 If the AUTO REROUTE function is OFF and you are in Arrow mode or Split Screen mode the display automatically changes to Map mode If you return to the set route the display will return to Arrow mode or Split Screen mode If you fail to follow a route immediately after it has been first set such as if you leave in the wrong direction when exiting...

Страница 82: ...emember the destination you have chosen When you start your car up again it will come on and resume guidance where it left off when you stopped When you start the engine after a break the system may rebuild the route data This may take a few moments Route guidance will begin when the process is finished When you start the engine after a break route guidance will begin in the same mode as displayed...

Страница 83: ...ned below AUTO REROUTE Allows you to choose how the system behaves if you stray off the suggested route Auto rerouting is on by default GUIDANCE VOICE Allows you to specify whether one of the recorded voices female or male or the synthesised voice is used to give guidance The female recorded voice is the default setting AUTO ROAD HIDING Allows you to choose whether minor roads and streets are disp...

Страница 84: ...ed route to your destination RESUME ORIGINAL ROUTE set a new route that returns to your original route after a certain distance DETOUR find a detour around a certain length of the road ahead Guidance mode switch between Map mode Arrow mode Split Screen mode Set FURTHER destination choose an onward destination to route to after your present destination LOCAL POINTS OF INTEREST locate and route to p...

Страница 85: ...uidance menu can be displayed at any time while under guidance by pressing the K MENU button on the Navigation commander 3UHVV WKH K 0 18 EXWWRQ The Guidance menu is displayed You can return to guidance mode by pressing the N NAVI button ...

Страница 86: ... display gives you a choice of rerouting by the shortest possible route to your destination or by a route using fewer turns 0DNH RXU VHOHFWLRQ ZLWK WKH MR VWLFN DQG FOLFN WKH EXWWRQ 7KHQ XVH WKH MR VWLFN WR KLJKOLJKW 21 DQG FOLFN WKH EXWWRQ The Guidance menu is displayed again SHORTEST ROUTE means that reducing the route distance is a priority when you reroute FEWER TURNS will set a route with the...

Страница 87: ...cted a reroute parameter use the Guidance menu to actually reroute to your destination from your present location URP WKH XLGDQFH PHQX KLJKOLJKW 5 5287 DQG FOLFN WKH EXWWRQ The new route is calculated using the parameters selected in the REROUTE menu ...

Страница 88: ...quickest way back to the original route RESUME ORIGINAL ROUTE allows you to do this URP WKH XLGDQFH PHQX KLJKOLJKW 5 680 25 1 5287 DQG FOLFN WKH EXWWRQ The shortest route back to the original route is calculated Such settings as TIME TURN RESTRICTION and AREAS TO BE AVOIDED are ignored in finding the way back to your original route ...

Страница 89: ...egin a detour immediately Choosing the length of the detour Before telling the system to plan a detour you must decide how much of the route ahead to detour There are three options 2 km 5 km or 10 km 1 miles 3 miles or 6 miles URP XLGDQFH PHQX KLJKOLJKW 7285 DQG FOLFN OHIW ZLWK WKH MR VWLFN WRZDUG WKH LFRQ The display gives you a choice of distance settings 0DNH RXU VHOHFWLRQ DQG FOLFN WKH EXWWRQ ...

Страница 90: ...ed that returns you to the original route at the distance selected in the DETOUR menu Depending on the road layout the actually length of the calculated detour may differ somewhat from the specified distance Also the calculated detour may be longer than the original route Depending on the road layout and road conditions the DETOUR function may fail to find an alternative route In some cases the de...

Страница 91: ... or Arrow mode KRRVH WKH XLGDQFH PRGH RX ZDQW WR EH GLVSOD HG DQG FOLFN WKH EXWWRQ WR VHOHFW LW 7KHQ XVH WKH MR VWLFN WR KLJKOLJKW 21 DQG FOLFN WKH EXWWRQ See Guidance modes on page 76 for details of these guidance modes CAUTION For safety reasons this function is not available while your vehicle is in motion Before choosing the length of diversion pull over when it is safe to do so and apply the ...

Страница 92: ...of interest chosen from a list a specified point on the map The GO TO registered location name item reflects the stored location only if one has been registered If no stored location has yet been registered it reads ROUTE TO you can register a stored location by selec ting ROUTE TO For an explanation of these various choices see Settng a Route to Your Destination After choosing a method proceed to...

Страница 93: ...k the system to set a route to one for you Overlaying points of interest on the Map or Arrow mode display You can choose to permanently display certain categories of point of interest on the map URP WKH XLGDQFH PHQX KLJKOLJKW 2 32 176 2 17 5 67 DQG FOLFN WKH EXWWRQ A list of point of interest categories is displayed The point of interest categories shown on the list being displayed will vary depen...

Страница 94: ... to it URP WKH XLGDQFH PHQX KLJKOLJKW 2 32 176 2 17 5 67 DQG FOLFN WKH EXWWRQ A list of point of interest categories is displayed The point of interest categories shown on the list being displayed will vary depending on the Map Disc in use LJKOLJKW D FDWHJRU DQG FOLFN WKH EXWWRQ If you have chosen a chain type of point of interest meaning a point of interest category characterised by chain establi...

Страница 95: ...of interest is treated as an additional destination on the way to your destination You are asked whether to route to the selected point of interest using motorways or not see steps 3 to 5 of Using the Destination history on page 46 The system then works out a suitable route Guidance to the point of interest then begins ...

Страница 96: ...r route is not highlighted on the map in this mode If the map was left in scroll mode when it was last used it appears again in scroll mode If the N NAVI button was used to display your current position when the map was last used your current position is displayed You can return to the Guidance menu at any time by pressing the K MENU button You can return to Guidance mode by pressing the N NAVI bu...

Страница 97: ...ut fail to cancel the route your Mobile Navigation System will continue to give guidance Choose CANCEL ROUTE NEW ROUTE to avoid this URP WKH XLGDQFH PHQX KLJKOLJKW DQFHO URXWH 1HZ URXWH DQG FOLFN WKH EXWWRQ The route is cancelled and no further guidance is given The Destination menu is displayed You can now set a new route as explained in Settng a Route to Your Destination ...

Страница 98: ...le Navigation System Display the Settings menu by selecting SETTINGS in the Guidance menu Full details of the various settings are given in Customising the System There is one setting that relates particularly to use of the Guidance menu SHORT MENUS Allows you to reduce the menus to a short list of the most used items ...

Страница 99: ... either the Destination menu or the Guidance menu To illustrate the process of changing settings an example is given here in which MAP ORIENTATION is changed from HEADING UP the factory setting to NORTH UP This refers to the orientation of the map HEADING UP causes the map to rotate on the display such that your driving direction is always toward the top of the display whereas NORTH UP puts north ...

Страница 100: ... HVWLQDWLRQ PHQX RU WKH XLGDQFH PHQX If a route has been set and you are under guidance the Guidance menu will appear If no route has been set the Destination menu will be displayed LJKOLJKW 6 77 1 6 LQ HLWKHU WKH HVWLQDWLRQ PHQX RU XLGDQFH PHQX DQG FOLFN WKH EXWWRQ The Settings menu is displayed ...

Страница 101: ...d 8VH WKH MR VWLFN WR KLJKOLJKW 1257 83 DQG FOLFN WKH EXWWRQ NORTH UP is selected and DONE is highlighted OLFN WKH EXWWRQ WR UHJLVWHU RXU QHZ VHWWLQJ The new setting is registered and the Settings menu is again displayed The procedure for changing other settings is similar Details are given in User Settings on page 102 ...

Страница 102: ...t setting is OFF ON Roads and intersections with time restrictions may be considered in the route OFF Roads and intersections with time restrictions are not considered from the route The TIME TURN RESTRICTION setting will not be used if you set a route while in a car park or in any other off road location The route will be set as if TIME TURN RESTRICTION is set to OFF Selecting ON The cursor moves...

Страница 103: ...eets along the route exceeds the limit the top 20 are shown as ranked by importance and distance travelled Selecting ON When a new route is set a list of roads and streets is displayed before guidance begins Only major roads and streets on route to the destination are listed By selecting a road or street on the list and moving the joystick to the right its location can be confirmed on the map Clic...

Страница 104: ... avoid in your driving Up to nine such areas can be defined Defining an area to be avoided LJKOLJKW 5 72 92 LQ WKH 6HWWLQJV PHQX DQG FOLFN WKH EXWWRQ A list of nine areas to be avoided is displayed No areas are defined by default Areas not yet defined are labelled New area 1 etc LJKOLJKW WKH ILUVW XQGHILQHG DUHD 1HZ DUHD DQG FOLFN WKH EXWWRQ You are presented with a list of possibilities for selec...

Страница 105: ...ded GMXVW WKH DUHD WR EH DYRLGHG E HQODUJLQJ UHGXFLQJ RU VFUROOLQJ WKH PDS The and buttonsincreaseandreducethemapscale consequentlyenlargingorreducing the shaded area For example pressing the button will increase the map scale so the actual area represented by the shaded portion becomes smaller The map scale cannot be increased beyond 25 m 0 02 miles further use of the button results in the red sh...

Страница 106: ...can also be displayed Highlight an item on the list and click left with the joystick to view this information Return to the list by clicking the button Before clicking the button you can view the area on the map by clicking right with the joystick Return to the list by clicking the button 6HOHFW 7 DQG FOLFN WKH EXWWRQ A delete confirmation message appears LJKOLJKW 6 DQG FOLFN WKH EXWWRQ The area i...

Страница 107: ...oad The default setting is ON ON Minor roads are not displayed OFF All roads and streets are displayed Vehicle type Since some roads restrict access to certain vehicle types the accuracy of route setting and guidance depends on the system knowing what type of vehicle you are driving Choose your vehicle type here The default setting is SALOON CAR SALOON CAR TRUCK DELIVERY VEHICLE Map orientation Al...

Страница 108: ... LQ WKH 6HWWLQJV PHQX DQG FOLFN WKH EXWWRQ A list of four options is displayed along with the following location status information 1 Present longitude and latitude 2 GPS positioning mode 2D or 3D For 2D and 3D definitions please refer to What is GPS on page 130 3 Speed pulse rate Number of pulses per second allows verification that pulses are being properly picked up 3UHVV WKH K 0 18 EXWWRQ WR UH...

Страница 109: ...he map you can correct this Your vehicle must be stationary LJKOLJKW 02 855 17 2 7 21 DQG FOLFN WKH EXWWRQ The map is displayed 8VH WKH MR VWLFN WR PRYH 5 WR RXU FRUUHFW SRVLWLRQ DQG FOLFN WKH EXWWRQ 0RYH WKH MR VWLFN ULJKW RU OHIW WR WXUQ M WR WKH FRUUHFW RULHQWDWLRQ RXU YHKLFOH V FXUUHQW KHDGLQJ DQG FOLFN WKH EXWWRQ ...

Страница 110: ...at the signal strength is a maximum 2 Your present longitude and latitude calculated by the GPS 3 GPS positioning mode 2D or 3D For 2D and 3D definitions please refer to What is GPS on page 130 4 Coloured satellite icons representing the approximate position of the GPS satellites in the directions of the compass The colour of the icons indicates the signal reception status Gray is a known satellit...

Страница 111: ...Calibrating the built in gyrosensor on page 27 Resetting the calibration memory Resetting the calibration memory clears all gyrosensor learning data from the memory Memory 1 or Memory 2 currently in use See Calibrating the built in gyrosensor on page 27 for details Tracking display You can set the system to display tracking dots that show the route you have driven You can choose to show these dots...

Страница 112: ...by the menus is not available on the map disc currently in use the map disc s default language which differs according to the map disc is used for text on the map instead Choosing a language from the list will cause the map text to display in that language However if the language used by the menus is not available on the map disc currently in use the map disc s default language which differs accor...

Страница 113: ...oose not to register one at that time or if you want to change the password later follow the directions in Registering a password on page 25 In order to register a new password you must first enter the old password Use one of the memo pages at the end of this manual to note down your password then remove the page and keep it in a safe place Do not keep a note of your password in the vehicle Km mil...

Страница 114: ...and voice recognition LJKOLJKW 1 8 DQG FOLFN WKH EXWWRQ You are instructed to eject the map disc and insert the appropriate programme disc MHFW WKH PDS GLVF DQG LQVHUW D SURJUDPPH GLVF See Inserting the programme disc on page 16 6HOHFW RXU FKRLFH RI ODQJXDJH See Installing the programme on page 18 ...

Страница 115: ... home location on page 21 Preferred Destination You can register the location of one particular location for quick and easy routing Details of how to register a location are given in Registering locations on page 52 If you have already registered a stored location then upon selecting PREFERRED DESTINATION you will be given a choice of DELETE or REGISTER If you choose DELETE you will be asked to co...

Страница 116: ...ME CONTROL to level 9 the maximum and use the volume control on the display to obtain the volume you desire Demonstration This setting allows the system to be demonstrated If DEMONSTRATION is turned on the drive to your destination will be simulated as soon as a route has been set This is particularly useful for dealers who can set up demonstrations to run in their stores it should always be set t...

Страница 117: ...vehicle Combined with voice guidance it means that while actually driving there is little need to use the Navigation commander nor to continuously monitor the display The result is greatly enhanced safety Most of the functions that you need while driving can be activated with voice commands Routing to a previously visited location using the Destination history Routing home or to the stored locatio...

Страница 118: ... Make sure that you do not need to alter your position when giving voice commands not only is this awkward but it can also compromise driving safety Bear this in mind when choosing where to attach the microphone 3DXVH EHIRUH JLYLQJ D FRPPDQG After pressing the H TALK button on the Navigation commander pause for a moment after the confirmation beep before giving a voice command Speaking too soon ma...

Страница 119: ... a command before all the countdown lamps have changed colour your command will not be accepted You must press the H TALK button again before attempting to give another voice command I WKH FRPPDQG GLVSOD HG LV QRW WKH RQH LQWHQGHG SUHVV WKH 1 7 237 21 EXWWRQ Pressing the NEXT OPTION button before all the countdown lamps have changed colour cycles through commands with a similar pronunciation Repea...

Страница 120: ...QGHU The Voice Recognition menu appears countdown lamps light and change colour one by one giving a list of the available options The commands that can be given are the following RETURN HOME Find a route home from your current location This appears only if a home location has been registered see Registering your home location on page 27 GO TO registered location name Find a route to the stored loc...

Страница 121: ... the countdown lamps have changed colour you will be asked if you want to use motorways or not and then a route will be set Guidance begins automatically see steps 3 to 5 of Using the Destination history on page 46 If the command displayed is not the one you gave press the NEXT OPTION button repeatedly until the desired command is shown see Using Voice Operation above If you have not yet registere...

Страница 122: ...ions available here are as follows Name of location Find a route to the named listing in the Destination history NEXT Select the next listing PREVIOUS Select the previous listing If you already know the name of your destination simply say it while the Voice Recognition menu is displayed If accepted the command appears on the display and routing starts immediately KLOH WKH OLVW LV GLVSOD HG SUHVV W...

Страница 123: ...nt of interest category If you already know the category you want to overlay say it while the Voice Recognition menu is displayed If accepted the command appears on the display Switch to the map to see the specified point of interest category overlaid on the map KLOH WKH OLVW LV GLVSOD HG SUHVV WKH H 7 EXWWRQ DQG VD WKH SRLQW RI LQWHUHVW FDWHJRU RI RXU FKRLFH EHIRUH DOO WKH FRXQWGRZQ ODPSV KDYH FK...

Страница 124: ...ur destination RESUME ORIGINAL ROUTE Set a new route retuens to your original route after a certain distance FEWER TURNS Search for a new route to your destination with fewer turns SHORTEST ROUTE Search for the shortest route from the current location to your destination DETOUR Avoid a length of road see DETOUR Avoid the Road Ahead on page 89 and return to the original route POINTS OF INTEREST Sto...

Страница 125: ...e see Resume Original Route Returning to the Original Route on page 88 FWLYDWH YRLFH UHFRJQLWLRQ DV GHVFULEHG LQ FWLYDWLQJ YRLFH UHFRJQLWLRQ DQG VD 5HVXPH RULJLQDO URXWH If accepted the command appears on the display After all the countdown lamps have changed colour a route will be set Guidance begins automatically If the command displayed is not the one you gave press the NEXT OPTION button repea...

Страница 126: ...isplayed is not the one you gave press the NEXT OPTION button repeatedly until the desired command is shown see Using Voice Operation above After all the countdown lamps have changed colour a list of the most useful point of interest categories appears You are asked Please request a point of interest name If you already know the category you want to overlay say it while the Voice Recognition menu ...

Страница 127: ...stance from your current location to the point of interest in question Do you want to stop there The options available here are as follows YES The system sets a route to the point of interest while under guidance NO The category is ticked and icons indicating the location of points of interest in this category are overlaid on the map NEXT Information is given about the second nearest point of inte...

Страница 128: ...nd is shown see Using Voice Operation above If your response is Yes the point of interest is treated as an additional destination on the way to your first destination After all the countdown lamps have changed colour you will be asked if you want to use motorways or not and then a route will be set Guidance begins automatically see steps 3 to 5 of Using the Destination history on page 46 If your r...

Страница 129: ...GGLWLRQDO LQIRUPDWLRQ WKDW PD KHOS RXU XQGHUVWDQGLQJ DV RX OHDUQ DERXW WKH V VWHP Q SDUWLFXODU RX PD ILQG WKH ORVVDU DQG 7URXEOHVKRRWLQJ VHFWLRQV RI LQWHUHVW Positioning Technology Recent advances in communications computer technology and engineering have made it possible to determine a location on earth with remarkable accuracy This Mobile Navigation System brings together a number of these techn...

Страница 130: ...signal processing is easily fitted into aircraft boats and now even navigation systems for vehicles How is it used GPS is used by this system to determine the absolute location of your vehicle This enables it to display your location accurately on a map The accuracy of the information obtained with GPS depends on how good the reception is When the signals are strong and reception is good it is pos...

Страница 131: ...from GPS satellites may not reach your vehicle In this case it is not possible for the system to use GPS positioning GPS reception may be lost temporarily if a car phone or cellular phone is used near the GPS aerial Care of the GPS aerial Do not obstruct the GPS aerial with spray paint or car wax as this may block the reception of GPS signals Snow buildup may also degrade the signals so keep the a...

Страница 132: ...ally compares GPS data with your estimated position as calculated from the gyroscopic data However if nothing but gyroscopic data is available for a long period positioning errors are gradually compounded until the estimate of your location becomes unreliable For this reason whenever GPS signals are available they are matched with the gyroscopic data and used to correct it for improved accuracy Le...

Страница 133: ... mark on the map may diverge considerably Once GPS reception is restored accuracy will be recovered within about two hours There are two learning memories so the system can learn about and compensate for two different tyre sets such as summer and winter tyres See Selecting a calibration memory on page 111 for details Map matching As mentioned the GPS and dead reckoning systems used by this Mobile ...

Страница 134: ...use discrepancies between your actual position and the location shown on the map display If you make a slight turn If there is a parallel road If there is another road very nearby such as in the case of an elevated motorway If you take a recently opened road that is not on the map If you drive in zig zags ...

Страница 135: ...onnected hairpin bends If there is a loop or similar road configuration If you take a ferry If you are driving on a long straight road or a gently curving road If you are on a steep mountain road with many height changes ...

Страница 136: ...iral junction If your vehicle is turned on a turntable or similar If your vehicle s wheels spin such as on a rough track or in snow If you put on chains or change your tyres for some of a different size If trees or other obstacles block the GPS signals for a considerable period ...

Страница 137: ... If you drive very slowly or in a start and stop manner as in a traffic jam If you join the road after driving around a large car park When you pass around a roundabout ...

Страница 138: ...RELOH 1DYLJDWLRQ 6 VWHP RQ A display similar to this is shown for a few seconds 1RWH GRZQ WKH YHUVLRQ QXPEHUV IRU WKH SURJUDPPH These are the SDAL and APL numbers on the display SDAL V 1 and APL KNRNLA in the example shown The SDAL standard on the CD ROM must match this SDAL standard In the case of a CD ROM meeting the specified version of the SDAL standards but covering an area not authorised by ...

Страница 139: ...ur CD ROMs Keep your CD ROMs away from direct sunlight sources of heat and sources of dust Store the discs in their protective cases to provide greater protection against warping Ambient conditions can affect the behaviour of discs and the operation of the system Vibrations caused by driving may sometimes interrupt the reading of map data from the CD ROM causing slow screen changes In cold weather...

Страница 140: ...eration of the system If there are problems with the display Using the reset button The reset button is recessed on the front of the main unit to prevent accidental use Find it in the bottom left corner of the front panel QVHUW D SRLQWHG LPSOHPHQW VXFK DV D EDOO SRLQW SHQ LQWR WKH VPDOO KROH DQG SXVK The system switches off If the CD ROM cover is open when you press the reset button the disc is ej...

Страница 141: ...tion Obstacles are blocking signals from the satellites The position of satellites relative to your vehicle is bad Signals from the GPS satellites have been modified to reduce accuracy GPS satellites are operated by the US Department of Defence and the US government reserves the right to distort positioning data for military reasons This may lead to greater positioning errors 6LJQDOV IURP WKH FDU ...

Страница 142: ...ck the TRACKING DISPLAY settings page 111 and make sure ON PERMANENTLY or ON CURRENT JOURNEY is selected The daylight display is used even when the car lights are on Probable cause 7KH 872 1 7 5281 VHWWLQJ LV WXUQHG RII Solution Check the AUTO DAY NIGHT BACKGROUND setting page 112 and make sure ON is selected The system will not switch on will not operate Probable cause QVWDOODWLRQ RU FRQQHFWLRQ K...

Страница 143: ...UND setting page 112 and select OFF if desired A liquid crystal display is used and such displays tend to darken when cold Wait for the vehicle to warm up There is no voice guidance or the volume is low Probable cause 7KH YROXPH VHWWLQJ LV ORZ Solution Check the volume setting on the display or turn the volume up according to VOLUME CONTROL page 118 and or turn up the volume on the display ...

Страница 144: ...Change the batteries Check that the batteries are properly inserted according to the and markings Ensure that the Navigation commander has a clear line of sight to the display unit Move the Navigation commander closer to the receiver on the display unit Errors have increased Probable cause 7KH EXLOW LQ J URVHQVRU V OHDUQLQJ IXQFWLRQ LV QRW RSHUDWLQJ FRUUHFWO Solution Reset the gyrosensor to begin ...

Страница 145: ...r otherwise damaged What to do 1 Insert a suitable disc 2 Insert the disc with the label upward 3 Clean the disc 4 Consult your dealer Q HUURU KDV RFFXUUHG 3OHDVH SRZHU RII DQG RQ DJDLQ When if there is an internal problem What to do Turn off the power and then switch the system on again 7KH ROGHU YHUVLRQ GLVF FDQQRW EH XVHG RU 6RPH IXQFWLRQV PD QRW ZRUN ZLWK WKLV QHZ YHUVLRQ When if the map disc ...

Страница 146: ...ute using or avoiding motorways What to do change the conditions and try setting the route again RX FDQQRW VHW PRUH GHVWLQDWLRQV When if you try to set more than two destinations What to do add the next destination after arriving at your first destination 7KH URXWH FRXOG QRW DYRLG WKH VSHFLILHG DUHD R RX ZLVK WR WU DJDLQ ZLWK WKH JLYHQ FRQGLWLRQV When if route setting cannot avoid a specified area...

Страница 147: ...ry to overlay more than two point of interest categories on the map What to do remove another category from the map 7KH GHVWLQDWLRQ LV QRW FRQWDLQHG RQ WKH GLVF When the destination is not available on the map disc you are using What to do insert a disc that covers your choice of destination URQJ SDVVZRUG 3OHDVH VD RU W SH WKH FRUUHFW SDVVZRUG When if you enter or speak the wrong password What to ...

Страница 148: ...on a location on a nearby road such as below the motorway may be chosen instead During voice guidance turns and junction from motorway are automatically announced However if you pass junctions turns and other guide points in quick succession some may not be announced Incorrect guidance may be given at motorway junctions if the exit lane is particularly long If you choose a destination at a great d...

Страница 149: ...ting or parameter may be ignored If your destination is a motorway junction voice guidance may not announce the junction There may be instances when the starting point and the destination point are not on the highlighted route When performing a RESUME ORIGINAL ROUTE the shortest way back to the original route is found It may take you along winding roads narrow city streets and other non optimal ro...

Страница 150: ... your current location may be shown incorrectly If the vehicle has just been started or you turn on the Mobile Navigation System while already in motion When driving through tunnels under motorways among high rise buildings or wherever reception of GPS signals is poor or multi pass noise is present Near a DAB Digital Audio Broadcasting station When there is a road parallel to your route such as an...

Страница 151: ... is handy when you want to check a route travelled without guidance or if returning along a complex route A maximum of about 200 km 124 miles is marked and as you travel beyond this limit tracking marks are erased in order from the most distant Tracking can also be set for automatic erasing whenever the Navigation System is switched off TRACKING DISPLAY on page 111 ...

Страница 152: ...n CD ROMs RPPRQ Maximum current consumption 1 0 A Power source 14 4 V DC 10 8 15 1 V allowed Earthing system Negative earth Dimensions 277 W x 52 H x 175 D mm Weight 1 9kg GPS aerial Aerial Microstrip flat aerial right handed helical polarisation Dimensions 51 W x 53 H x 16 D mm Weight 0 13 kg Commander Dimensions 38 W x 153 H x 33 D mm Weight 0 08 kg 1RWH The specifications and design are subject...

Страница 153: ...tion that you choose to route to after your destination a journey can be built up from multiple destinations 36 Global positioning system a network of satellites that provide navigation signals for a variety of purposes XLGDQFH PRGH The mode in which guidance is given as you drive to your destination the system automatically switches to this mode as soon as a route has been set URVHQVRU The built ...

Страница 154: ...DUH The basic software needed by the system it must be installed from CD ROM before inserting a map disc 5RXWH VHWWLQJ The process of determining the ideal route to a specific location route setting is done automatically by the system as soon as you specify a destination 6HW URXWH The route marked out by the system to your destination It is highlighted in bright green on the map 6WRUHG ORFDWLRQ On...

Страница 155: ...n page 50 on page 51 on page 55 on page 62 on page 64 on page 70 on page 99 on page 30 on page 86 on page 88 on page 89 on page 91 on page 92 on page 93 on page 96 on page 98 on page 97 on page 102 on page 102 on page 103 on page 104 on page 107 on page 107 on page 107 on page 107 ...

Страница 156: ...Setting menu 2 Setting menu 3 on page 107 on page 108 on page 111 on page 112 on page 112 on page 112 on page 112 on page 113 on page 113 on page 114 on page 115 on page 115 on page 115 on page 116 on page 116 ...

Страница 157: ... ...

Страница 158: ... by name When you select SEARCH BY NAME DISTANCE you enter the name then choose the distance range For further details please see Search by name Page 66 and Search by distance Page 67 MEMO ULWH RXU UHJLVWHUHG SDVVZRUG KHUH UHPRYH WKH SDJH IURP WKLV PDQXDO DQG VWRUH LW LQ D VDIH SODFH 87 21 QHYHU OHDYH DQ QRWH RI RXU SDVVZRUG LQ WKH FDU 7KH VFUHHQ VKRZQ LQ WKH H DPSOH PD GLIIHU IURP WKH DFWXDO VFUH...

Страница 159: ... ...

Страница 160: ...Y LTD 178 184 Boundary Road Braeside Victoria 3195 Australia TEL 03 580 9911 PIONEER ELECTRONICS OF CANADA INC 300 Allstate Parkway Markham Ontario L3R 0P2 Canada TEL 905 479 4411 PIONEER ELECTRONICS DE MEXICO S A de C V San Lorenzo Num 1009 3er piso Desp 302 Col Del Valle Mexico D F C P 03100 TEL 5 688 52 90 Published by Pioneer Electronic Corporation Copyright 1999 by Pioneer Electronic Corporat...

Отзывы: