background image

24

EN

Important 

Information

Know Y

our 

Unit

Operating 

Instructions

Care and 

Maintenance

Te

chnical Data, 

W

arranty

, etc.

Technical Data

Notes:

‡6XEMHFWWRWHFKQLFDOPRGLILFDWLRQZLWKRXWSULRUQRWLFH
‡$ERXWPORIUHVLGXDOPHGLFDWLRQPD\UHPDLQLQWKHPHGLFDWLRQFXS7KHH[DFWDPRXQWYDULHVZLWKWKHPHGLFDWLRQXVHGDV

well as the air-flow volume and nebulization rate adjustment.

‡7KHQHEXOL]DWLRQFDSDFLW\YDULHVZLWKWKHW\SHRIPHGLFDWLRQWKHRSWLRQDODFFHVVRULHVXVHGDQGWKHSDWLHQW¶VEUHDWKLQJ
‡7KLV20521SURGXFWLVSURGXFHGXQGHUWKHVWULFWTXDOLW\V\VWHP($/7+&$5(&R/WG-DSDQ
‡7KHGHYLFHPD\QRWZRUNLIWKHWHPSHUDWXUHDQGYROWDJHFRQGLWLRQVDUHGLIIHUHQWWRWKRVHGHILQHGLQWKHVSHFLILFDWLRQV
‡7KHGHYLFHIXOILOVWKHSURYLVLRQVRIWKH(&GLUHFWLYH((&0HGLFDO'HYLFH'LUHFWLYHDQGWKH(XURSHDQ6WDQGDUG

EN13544-1:2007+A1:2009, Respiratory therapy equipment - Part1: Nebulizing systems and their components.

‡6HHZHEVLWH($/7+&$5((8523(WRXSGDWHWHFKQLFDOLQIRUPDWLRQ

 

URL: www.omron-healthcare.com

 7\SH%)DSSOLHGSDUW

Read the instruction
manual carefully

 3RZHURII

 $OWHUQDWLQJ&XUUHQW

 3RZHURQ

Important information regarding Electro Magnetic Compatibility (EMC)

With the increased number of electronic devices such as PC’s and mobile (cellular) telephones, medical devices in use may 
be susceptible to electromagnetic interference from other devices. 
Electromagnetic interference may result in incorrect operation of the medical device and create a potentially unsafe 
situation. 
Medical devices should also not interfere with other devices.

In order to regulate the requirements for EMC (Electro Magnetic Compatibility) with the aim to prevent unsafe product 
situations, the EN60601-1-2:2007 standard has been implemented. This standard defines the levels of immunity to 
electromagnetic interferences as well as maximum levels of electromagnetic emissions for medical devices.

This medical device manufactured by OMRON HEALTHCARE conforms to this EN60601-1-2:2007 standard for both 
immunity and emissions. 
Nevertheless, special precautions need to be observed:

‡'RQRWXVHPRELOHFHOOXODUWHOHSKRQHVDQGRWKHUGHYLFHVZKLFKJHQHUDWHVWURQJHOHFWULFDORUHOHFWURPDJQHWLFILHOGVQHDU

the medical device. This may result in incorrect operation of the unit and create a potentially unsafe situation. 
Verify correct operation of the device in case the distance is shorter.

Further documentation in accordance with EN60601-1-2:2007 is available at OMRON HEALTHCARE EUROPE at the 
address mentioned in this instruction manual. 
Documentation is also available at www.omron-healthcare.com.

Correct Disposal of This Product

(Waste Electrical & Electronic Equipment)

This marking shown on the product or its literature, indicates that it should not be disposed of, with other household wastes 
at the end of its working life. To prevent possible harm to the environment or human health from uncontrolled waste 
disposal, please separate this product from other types of wastes and recycle it responsibly to promote the sustainable 
reuse of material resources.

Household users should contact either the retailer where they purchased this product, or their local government office, for 
details of where and how they can return this item for environmentally safe recycling.

Business users should contact their supplier and check the terms and conditions of the purchase contract. This product 
should not be mixed with other commercial waste for disposal.

Содержание NE-U780

Страница 1: ...throat EN FR DE IT ES NL RU AR Table of Contents Important Information Intended Use 1 Important Safety Precautions 2 Exemptions 3 Important Information Know Your Unit Product Features 4 Packaging Cont...

Страница 2: ...of a medical expert Some hospitals clinics may rent out the devices Durable period Durable periods are as follows provided the product is used to nebulize 30 ml of saline solution at 26 C with 26 C w...

Страница 3: ...ain unit contact are not contaminated Make sure that the air filter is correctly attached To avoid the medication residue on the face be sure to wipe the face after removing the mask Do not get nebuli...

Страница 4: ...failure or damage or accidents involving the product resulting from a failure to adhere to the safety precautions and operating instructions described in this manual 5 Product failure or damage result...

Страница 5: ...E ZKLFK WKH medication becomes an aerosol 1HEXOL DWLRQ 7KH SURFHVV E ZKLFK WKH DWRPL HG medication is expelled by the product 1 Smooth shape for easy cleaning The main unit is easy to clean and disin...

Страница 6: ...hen using the timer Indicates the remaining nebulization time The time can be set from 1 to 30 min During continuous nebulization The digital portion of the display cycles through a simple animation P...

Страница 7: ...f main unit Top of main unit Fuse Electric power socket Power cord Display Handle Mouthpiece Inhalation hose Fan cover Fan Air filter case Air filter Vibrator Nebulization set Medication cup cover Sil...

Страница 8: ...acing your finger under the protrusion on the medication cup holder remove the nebulization set Protrusion 3 Fill the removable water tank with tap water Fill to the optimal water level taking care no...

Страница 9: ...to the medication cup Min 10 ml Max 150 ml Notes HIRUH DGGLQJ PHGLFDWLRQ PDNH VXUH WKH medication cup is clean not damaged or misshapen I XVLQJ D V ULQJH WDNH FDUH QRW WR GDPDJH WKH medication cup wit...

Страница 10: ...power cord 4 Turn on the power button and make sure all the Error LEDs on the error display light up and then turn back off If one or more of the Error LEDs remain lit see Troubleshooting Page 22 for...

Страница 11: ...ULIZATION VOLUME adjustment buttons set the air flow volume and nebulization volume You can check both settings with the level displays which change to reflect the current value of each The air flow v...

Страница 12: ...ion mask optional can be used instead of the mouthpiece During inhalation Do not bend the inhalation hose or block the mouthpiece It may cause medication to accumulate in the hose reducing the nebuliz...

Страница 13: ...mple display with the timer set to 10 min When operation stops After about 5 sec This prepares the time for the next patient To stop inhalation while using the timer Press the START STOP button to sto...

Страница 14: ...fan cover for bacterial filter Instead of the normal fan cover use the optional NEB BFC 78E Fan Cover for Bacterial Filter 2 Remove the air volume adjustment lever on the long time nebulization set an...

Страница 15: ...an be connected to the product Continuous nebulization of medication volumes in excess of 150 ml can be accomplished by using the optional NEB LMCC 78E Long time Nebulization set and U10 11 E Supply M...

Страница 16: ...is not bent Medication will not be supplied if the tube is bent If the tube is too long cut it to a suitable length For subsequent steps see No 2 under Step 3 in the Before Inhalation section Page 9 S...

Страница 17: ...mouthpiece and other accessories from the main unit 3 Remove the removable water tank from the main unit 4 Remove the nebulization set from the removable water tank and disassemble it 5 Dispose of an...

Страница 18: ...e air filter is not contaminated If the air filter is excessively contaminated replace it with a new air filter 4 5 Return the air filter case and fan cover to their original positions and align the m...

Страница 19: ...t clean 5 Reattach the fan air filter case and fan cover When reattaching the fan push it firmly all the way onto the fan installation axis 6 Align the medication cup cover so that it is once more con...

Страница 20: ...infectant see its instruction manual and precautionary information Some disinfectants may trigger an allergic reaction Although the amount of time for which parts should be immersed varies with the di...

Страница 21: ...diene styrene resin ABS Poly phenylene sulfide resin PPS Polyethylene resin PE Polycarbonate resin PC Polymethylpentene PMP Polypropylene resin PP Polystyrene resin PS Polyvinyl chloride resin PVC The...

Страница 22: ...icon rubber Silicon packing Washer Silicon rubber Bottle PP Silicon packing Washer Silicon rubber Tube Silicon rubber Hanger Stainless steel Long time Nebulization set Supply Medication set Do not dis...

Страница 23: ...the nebulization volume or air flow volume setting too low Increase the setting Page 10 Is the room temperature or water temperature too low Replace the water in the removable water tank with water w...

Страница 24: ...tank Medication cup cover Medication cup holder Inhalation hose M Mouthpiece Medication cup 2 pcs Power cord Instruction Manual including product warranty Classifications Class I Protection against e...

Страница 25: ...th the aim to prevent unsafe product situations the EN60601 1 2 2007 standard has been implemented This standard defines the levels of immunity to electromagnetic interferences as well as maximum leve...

Страница 26: ...aminants out of the airflow Bacterial Filter Materials PP PMP Model U17 2 E Remarks Includes adapter Used for inhalation when cleansing the respiratory tract etc Cannot be reused Fan cover for bacteri...

Страница 27: ...rt b Costs for repairs and or defects resulting from repairs done by unauthorised persons c Periodic check ups and maintenance d Failure or wear of accessories or other attachments other than the main...

Страница 28: ...EALTHCARE Co Ltd Matsusaka Factory 1855 370 Kubo cho Matsusaka shi Mie 515 8503 Japan Subsidiaries OMRON HEALTHCARE UK LTD Opal Drive Fox Milne Milton Keynes MK15 0DG UK www omron healthcare com OMRON...

Отзывы: