HP Jornada 520 Скачать руководство пользователя страница 85

Chapter 6

 | 

Microsoft Pocket Outlook 

|

 81 

 

 

=XL[NJ]NJWX]N

1. Tap 

New

2.  Create your note by writing, drawing, typing, and/or recording. For 

more information about using the Input panel, writing and drawing on 
the screen, and creating recordings, see “Entering information” in 
chapter 2. 

 

([FKDQJLQJDSSRLQWPHQWVFRQWDFWVWDVNVDQGQRWHV

ZLWKRWKHU3LQIRH[FKDQJH

HP info exchange allows you to send and receive PIM data to and from non–
Windows-powered PDA devices (for example, Palm devices) from within 
Calendar, Contacts, and Tasks via infrared. You can also receive (but not 
send) memos from a PDA device and store them as text files in the My 
Documents folder of your HP Jornada.  

When you receive an item from a PDA device, it does not matter which Pocket 
Outlook application is active when you select Recv(non-Windows). For 
example, you can have Contacts open and still receive a Calendar or Task 
item. (HP info exchange is not available in Pocket Outlook Inbox.) 

 

 

HP info exchange runs only on your HP Jornada. No additional software is 
required for IrDA-equipped PDA devices. 

 

 

=X\NWM926RWOX[VJ]RXWO[XVbX^[193X[WJMJ]XJW2[-*NZ^RYYNM

9-*MN_RLN

1.  In Contacts, Calendar, Tasks, tap to select the item you want to send. 

2.  Make sure the PDA device is powered on. Align the infrared port on 

your HP Jornada with the infrared port on the receiving device. 

3. Tap 

Send(non-Windows) on the Tools menu of a PIM application 

on your HP Jornada. The HP info exchange Send window will 
appear, indicating that your HP Jornada is looking for a receiving 
device.  

The PDA device will receive the transmitted items automatically. 

 

 

You cannot send notes from your HP Jornada to a non–Windows-powered 
device by infrared. 

 

 

Содержание Jornada 520

Страница 1: ... 3 RUQDGD 6HULHV 3RFNHW 3 8VHU V XLGH Printed in Singapore Edition 1 ...

Страница 2: ...thout the prior written consent of Hewlett Packard Co except as allowed under the copyright laws The programs that control this product are copyrighted and all rights are reserved Reproduction adaptation or translation of those programs without prior written permission of Hewlett Packard Co is also prohibited Microsoft ActiveSync Outlook Pocket Outlook Expedia AutoRoute Express MapPoint Windows Wi...

Страница 3: ... PC 30 Installing the HP Dynamic Voice audio codec 31 Connecting your HP Jornada 33 Establishing a partnership 36 Synchronizing data 37 Browsing your HP Jornada from your desktop 39 Transferring files between your HP Jornada and your desktop PC 40 Backing up and restoring data 40 4 Connecting to the Internet or to a network 45 Connecting your HP Jornada 46 Creating an ISP or network connection 48 ...

Страница 4: ...ket Word 84 Microsoft Pocket Excel 85 Microsoft Windows Media Player 86 Microsoft Reader 89 OmniSolve 90 8 Accessories 91 HP branded accessories 92 CompactFlash cards 93 9 Troubleshooting 95 Resetting your HP Jornada 96 Basic problems 98 Remote connections 101 Display problems 103 10 Support and service 105 Web site 105 Customer support 105 Service 105 Contacting Hewlett Packard worldwide 106 Warr...

Страница 5: ...s You will find that your HP Jornada is also the perfect companion to your desktop or notebook PC allowing you to take vital business data and documents with you and easily upload updated information upon returning to your desk HP Jornada offers you the highest quality in performance and power management as well as rich programs and utilities designed by Hewlett Packard making HP Jornada your powe...

Страница 6: ...ing your HP Jornada quickly and easily Although great care has been taken to ensure the accuracy of procedures and artwork some of the screens displayed on your HP Jornada may be different than the ones that appear in this User s Guide Detailed step by step instructions for using the programs on your HP Jornada are also included in online Help so you will always have access to them and you do not ...

Страница 7: ...ket PC software Microsoft Pocket Word Pocket Excel Microsoft Reader and the Windows Media Player and the OmniSolve calculator from Landware Chapter 8 Accessories Describes the HP accessories available for your Pocket PC and includes instructions on how to add functionality using a CompactFlash card Chapter 9 Troubleshooting Explains how to reset your Pocket PC and how to restore your Pocket PC to ...

Страница 8: ...ur valuable data even when you are away from your office by backing up your personal information manager PIM databases Contacts Calendar and Tasks or your entire Pocket PC to a CompactFlash card HP game buttons Run up the score in your favorite games on your Pocket PC Use the HP game buttons application to assign game actions to your Pocket PC hardware buttons HP home menu Quickly launch your favo...

Страница 9: ... and view channels and subscription content Microsoft Windows Media Player for Pocket PC Play songs and sound clips on your Pocket PC Windows Media Player lets you play songs or files that have been recorded in MP3 WMA or WAV format Microsoft Reader Read electronic books on your HP Jornada 7KLUG SDUW VRIWZDUH OmniSolve Perform complex mathematical and business calculations with this full featured ...

Страница 10: ...t sites that use wireless access protocol WAP to deliver content designed specifically for mobile devices Sample MP3 songs from EMusic com EMusic com is the premier site for your MP3 music Whether you are into rock jazz blues techno or hip hop EMusic com features thousands of tracks from the artists you are looking for HPC Notes 3 05 Lite Edition full and Professional Edition trial from PhatWare C...

Страница 11: ...ith Microsoft Reader KHUH WR ILQG LQIRUPDWLRQ The following table is a guide to additional information to help you use your HP Jornada For information on See this source Programs on your HP Jornada This User s Guide or online Help on your device Tap Help on the Start menu to view Help for the active program Additional programs that can be installed on your HP Jornada The HP Jornada CD ROM the Extr...

Страница 12: ...om jornada products product_tour You can download the User s Guide to your desktop PC and view it using the Adobe Acrobat Reader available from the Adobe Web site at www adobe com 8VLQJ RQOLQH HOS RQ RXU 3 RUQDGD You can get help for specific programs and for Windows for Pocket PC by tapping Help on the Start menu Help is displayed for the active program To display a menu of all Help files availab...

Страница 13: ... a brief introduction to the Windows for Pocket PC operating system When you finish this chapter you will have all the information you need to begin working with your HP Jornada This chapter includes step by step instructions to help you Identify hardware features Complete the Welcome Wizard Navigate in Windows for Pocket PC Enter information Find and organize information ...

Страница 14: ...ssory cover Note that once removed the rubber studs cannot be replaced 5 Microphone 6 Action button Press to select the high lighted item or rock to the button to scroll up or down in a document 7 Record button Hold while recording 8 HP hot keys Press to open an application 9 Serial port Connect to your desktop PC using a sync cable or cradle 10 DC jack 11 On Off button 12 Speaker 13 Touch screen ...

Страница 15: ...Tasks The HP hot keys DULQJ IRU RXU 3 RUQDGD When treated properly your HP Jornada will be a reliable desktop PC companion Follow these tips to ensure long and trouble free use Protect the screen Pressing too hard on the touch screen may damage the screen To protect the screen keep your HP Jornada in the carrying pouch while you are not using it You can also protect the screen with an optional scr...

Страница 16: ...iated interference Radiated interference from other electronic equipment may affect the appearance of the display of your HP Jornada Removing the source of the interference will return the display to normal Avoid high temperatures Your HP Jornada is designed to operate at temperatures between 0 to 40 ºC 32 to 104 ºF Subjecting the device to temperatures outside this range may damage the unit or re...

Страница 17: ...tation to Windows for Pocket PC helps you align the touch screen and prompts you to select your city and time zone 4 Adjust the display Before you begin you may need to adjust the contrast and brightness of the display to a comfortable level Press and hold the HP home menu hot key until HP settings appears and then move the sliders for each setting 5 Register your HP Jornada To ensure that you rec...

Страница 18: ...then tap the Power icon If you select Tap screen to power on your HP Jornada may accidentally turn on when you slide it into the carrying pouch 8VLQJ WKH KDUGZDUH EXWWRQV DQG The hardware buttons on your HP Jornada that is the buttons on the device itself rather than buttons or icons that appear on the display can be used to start a particular program and to turn on your HP Jornada The features as...

Страница 19: ...me menu hot key Contacts hot key Calendar hot key Tasks hot key Press the HP home menu hot key to launch the HP home menu Press the HP home menu hot key a second time to display the second page of buttons Press and hold the HP home menu hot key to launch HP settings Press the Calendar Contacts or Tasks hot key to launch that application In Calendar Contacts or Tasks press the associated hot key ag...

Страница 20: ...the screen and drag to select text and images Drag in a list to select multiple items Tap and hold Tap and hold the stylus on an item to see a list of actions available for that item For convenience the stylus is stored in the stylus slot on the carrying pouch of your HP Jornada OLJQLQJ WKH WRXFK VFUHHQ From time to time you might notice that the accuracy of your stylus taps diminishes When this h...

Страница 21: ...nt information about your day To customize the information that is displayed tap the Today screen header The Today screen 6ZLWFKLQJ SURJUDPV Use the HP home menu application or the Start menu to quickly launch your favorite programs or open frequently used documents You can also use HP task switcher to switch between running programs X J X R LQ Y XP JV RWP 19 QXVN VNW 1 Press the HP home menu hot ...

Страница 22: ...e name of the program you want to switch to or Tap one of the miniature icons at the top of the Start menu to switch to a recently used program You can customize both HP home menu and the Start menu to make it easier to access the programs you use most For more information see Configuring menus in chapter 5 X R LQ Y XP JV RWP 19 J T R LQN 1 On the Today screen tap the HP task switcher status icon ...

Страница 23: ...or Pocket PC Command bar 6WDWXV LFRQV When the Today screen is displayed you may see the following status icons on the Command bar In most cases you can tap a status icon to display the associated control panel or more information related to the item For example tap the active dial up connection icon to disconnect from a modem connection Icon Meaning Speaker is on Pocket PC is charging Less than 5...

Страница 24: ...u tap and hold the stylus on the item that you want to perform the action on When the menu appears lift the stylus and then tap the action you want to perform Tap anywhere outside the menu to close the menu without performing an action The pop up menu for Tasks QWHULQJ LQIRUPDWLRQ You have several options for entering information on your Pocket PC Use the soft keyboard on the Input panel to enter ...

Страница 25: ...elected tap the arrow to the right of the Input panel icon and then tap Keyboard To display a numeric keypad tap at the upper left corner of the soft keyboard To type accented characters tap at the lower left corner of the soft keyboard The display shows the available accented characters To type capital letters tap the V key To use keyboard shortcuts such as F9 for Paste or F for Undo tap the F ke...

Страница 26: ...ay look like either a keyboard or a pen depending on which input option you have selected If is displayed meaning that the soft keyboard is selected tap the arrow to the right of the Input panel icon and select Character Recognizer The Character Recognizer input screen To enter capital letters write in the area at the left of the Input panel under the ABC symbol To enter lowercase letters write in...

Страница 27: ...een you can edit and format what you have written or convert the information to text X R N XW QN L NNW 1 Tap to switch to writing mode 2 Write on the screen using the stylus as you would write on paper X LXW_N R RWP X Na 1 Next to the writing you want to convert tap and hold the stylus until the insertion point appears 2 Without lifting the stylus drag it to select the writing 3 On the Tools menu ...

Страница 28: ...ng a 3 to an 8 after you attempt to recognize the word the writing you added will not be included if you attempt to recognize the writing again X M J XW QN L NNW 1 Tap to switch to writing mode 2 Draw on the screen using the stylus being sure to cross three ruled lines on your first stroke The first stroke of your drawing must cross three horizontal rules 3 Continue drawing as you would draw on pa...

Страница 29: ... for recording presentations music or lectures Some static or electrical noise may be heard during playback X L NJ N J NLX MRWP 1 Press and hold the Record button until you hear a beep The LED glows amber 2 While holding the Record button speak into the microphone For best results limit the length of recordings to less than 3 minutes To create the highest quality recordings record in a location wi...

Страница 30: ...ic Voice audio codec in chapter 3 X NUNL J NLX MRWP OX VJ 1 On the Start menu tap Settings and then tap the Input icon 2 On the Options tab in the Input control panel select a voice recording format from the drop down list The table below lists the compatibility of various recording formats with other computers The list of recording formats on your HP Jornada indicates the sample rate whether the ...

Страница 31: ...iles and information on your Pocket PC in much the same way you do on your desktop PC by using the Find feature or by using File Explorer Use the Find feature to locate files that contain a specified text string or that match specific criteria X ORWM J ORUN 1 On the Start menu tap Find 2 In the Find box type the text you want to locate 3 If you want to narrow your search to files of a specific typ...

Страница 32: ...28 HP Jornada 520 Series User s Guide ...

Страница 33: ...ket PC and your desktop or any PC that has Microsoft ActiveSync installed In this chapter you will learn to Install Microsoft ActiveSync 3 1 on your desktop PC Connect your HP Jornada by sync cable cradle or infrared Establish a partnership between your HP Jornada and your desktop PC Synchronize data between your HP Jornada and desktop PC Browse files on your HP Jornada from your desktop PC Transf...

Страница 34: ...ements for installing and running Microsoft ActiveSync 3 1 are as follows Microsoft Windows 2000 Microsoft Windows NT Workstation 4 0 with Service Pack 3 or later Microsoft Windows Me or Microsoft Windows 95 98 Pentium processor for Windows NT or Windows 2000 166 MHz required for Windows 2000 150 MHz required for Windows Me 486 66 DX or higher processor Pentium P90 recommended for Windows 95 98 16...

Страница 35: ...lling the codec depends on your operating system Follow the appropriate instructions below for your version of Microsoft Windows X RW JUU 19 bWJVRL XRLN XW RWMX 6N 1 Insert the HP Jornada CD ROM into a drive on your desktop PC 2 In the HP Dynamic Voice folder on the HP Jornada CD ROM open the Win9x folder 3 Right click the hpdynv INF file and then click Install on the pop up menu 4 If you are prom...

Страница 36: ...e Add Remove Hardware Wizard screen click Next 4 On the Choose a Hardware Task screen click Add Troubleshoot a device and then click Next 5 In the list of devices select Add a new device then click Next 6 In the Find New Hardware dialog box select No I want to select the hardware from a list and then click Next 7 In the list of Hardware types select Sound video and game controller and then click N...

Страница 37: ...dows 98 and Windows 2000 Windows NT supports serial connection but does not support connection by infrared Serial connections require a 9 pin serial communications COM port on your desktop PC If the 9 pin serial port is in use by another device or if your desktop PC has no 9 pin serial port obtain an adapter from your computer s manufacturer RQQHFWLQJ E V QF FDEOH If a sync cable was not included ...

Страница 38: ...more information see the HP Jornada Accessories Guide X LXWWNL Kb L JMUN 1 Connect the dc plug from the ac adapter to the dc jack on the cradle cable and plug the ac adapter into a wall outlet 2 Connect the cable from the cradle to a serial port on your desktop PC 3 Slide your HP Jornada into the cradle Your HP Jornada should start automatically and establish a connection to the desktop PC ...

Страница 39: ...ared port on your HP Jornada provides a convenient way to connect to an IrDA equipped PC without using a cable or cradle Many notebook computers have built in infrared ports however you may need to install and configure an infrared port on a desktop PC To install the port follow the manufacturer s instructions More information about infrared drivers for Microsoft Windows is available on the Window...

Страница 40: ...e that important files contacts and appointments are always up to date and identical on all three computers Although you can establish partnerships with two desktop PCs you can synchronize e mail messages with only one desktop PC A single desktop PC can have partnerships with many Pocket PCs or other mobile devices This is useful if you have more than one Windows powered device or if several mobil...

Страница 41: ...a on your HP Jornada with the data on your desktop PC and updates both computers with the most recent information You can synchronize any of the files on your HP Jornada with the corresponding files on your desktop PC For example Keep Pocket Outlook data up to date by synchronizing your Calendar Contacts and Tasks databases with Microsoft Outlook on your desktop PC Synchronize Microsoft Word and M...

Страница 42: ...at the time of synchronization or you can resolve conflicts automatically by setting a default option for conflict resolution X N J MNOJ U XY RXW OX LXWOURL N XU RXW 1 In the ActiveSync window on your desktop PC click Options on the Tools menu 2 On the Rules tab choose one of the options under Conflict Resolution 6 QFKURQL LQJ IURP D UHPRWH ORFDWLRQ You can synchronize while connected to your desk...

Страница 43: ...n and be sure you logged on under the same user name that you used when you created the partnership Ensure your PIM program and e mail program Microsoft Outlook or Microsoft Exchange are running If you receive an error message on your HP Jornada that states that an information type needs attention or if unresolved items are reported after synchronization you need to synchronize directly with your ...

Страница 44: ... you can choose not to convert files or you can choose to specify the conversions for each type of file by changing options in ActiveSync X N ORUN LXW_N RXW XY RXW 1 Start ActiveSync on your desktop PC 2 On the Tools menu click Options 3 On the Rules tab click Conversion Settings 4 To turn off automatic conversion clear the Convert files when synchronized copied or moved check box DFNLQJ XS DQG UH...

Страница 45: ...ted information 4 Click Change to change the name of your backup file or to specify a location for your backup file 5 Click Back Up Now DFNLQJ XS GDWD ZLWK 3 EDFNXS The HP backup application gives you added flexibility in backing up your valuable data With HP backup you can back up all data or back up only your Calendar Contacts and Tasks databases PIM databases You can save the backup file to int...

Страница 46: ...e files from your HP Jornada to your desktop PC before restoring information You can restore data using ActiveSync or the HP backup application 5HVWRULQJ GDWD ZLWK FWLYH6 QF Restoring data from ActiveSync replaces all information stored on your HP Jornada Any data added after the backup file was created will be lost X N X N MJ J R Q L R_N bWL 1 Connect your HP Jornada to your desktop PC 2 Use HP t...

Страница 47: ...acts Calendar and Tasks databases PIM databases with data from an existing backup file Depending on the type of backup file the restore operation replaces all information stored in your PIM databases or all data stored on your Pocket PC Any data added after the backup file was created will be lost X N X N MJ J R Q 19 KJLT Y 1 Use HP task switcher to close all running applications In the Today scre...

Страница 48: ...44 HP Jornada 520 Series User s Guide ...

Страница 49: ... the road This chapter describes the several methods you can use to connect your HP Jornada to a modem cellular phone or network the process of configuring your HP Jornada to connect to an Internet service provider ISP or network browsing the Web or a corporate intranet from your HP Jornada using Microsoft Internet Explorer and Mobile Channels sending and receiving e mail messages with your HP Jor...

Страница 50: ...com jornada accessories Many NICs also require that you install a software driver The card manu facturer must provide a software driver for the HP Jornada Pocket PC Follow the card manufacturer s instructions for installing the card and configuring the driver for use with your HP Jornada The driver for the Socket Low Power Ethernet CF card NIC is preinstalled on your HP Jornada After you have inst...

Страница 51: ...ct the modem to a phone line according to the manu facturer s instructions and align the infrared port on your HP Jornada with the infrared port on the modem before dialing the call RQQHFWLQJ ZLWK D PRELOH SKRQH If your mobile phone service supports remote data connection you can use the mobile phone to connect your HP Jornada to the Internet or to a remote computer Depending on the make and model...

Страница 52: ...nfrared port on your HP Jornada with the infrared port on the mobile phone before dialing the call For detailed instructions on how to establish a wireless connection using a mobile phone check the HP Jornada Web site at www hp com jornada solutions hardware wireless_solutions UHDWLQJ DQ 63 RU QHWZRUN FRQQHFWLRQ To connect to a network or the Internet you need an account with an ISP an account on ...

Страница 53: ...cturer s instructions to be sure 7 Select the baud rate The selected rate must be supported by both your modem and the ISP or network computer you will connect to If you are not sure about the rate contact your account administrator 8 If your ISP or account administrator provided specific settings such as IP addresses DNS addresses or parity or flow control or if your connection uses SLIP tap Adva...

Страница 54: ...rnada 6 Tap OK to close the Dialing Options dialog box 7 Tap Connect 8 In the Connect To dialog box confirm that the proper phone number is displayed If the phone number is not displayed correctly adjust the settings in Dialing Options or Dialing Patterns After you have set up an e mail service you can also connect to your e mail server from within Inbox Select the appropriate service on the Servi...

Страница 55: ...b 4 On the Connections tab select a connection from the Type list 5 If your ISP requires you to connect to a proxy server select the Use proxy server check box and then enter the address of the proxy server For more information consult your account administrator 6 Tap OK to return to Internet Explorer and then on the Tools menu tap Connect 7 On the View menu tap Address Bar and then type an URL or...

Страница 56: ...o Channels are downloaded to your HP Jornada when you synchronize with your desktop PC or when you connect to the Internet For more information visit http avantgo com help X RPW Y OX _JW 0X 1 In ActiveSync on your desktop PC click Options on the Tools menu and then select the AvantGo information type 2 In Pocket Internet Explorer on your HP Jornada tap to display your list of favorites 3 Tap the A...

Страница 57: ...mmed and you must synchronize with your desktop PC or connect to the Internet before you can view the page 0RELOH IDYRULWHV When you install ActiveSync a subfolder called Mobile Favorites is created in the Favorites folder on your desktop PC You can synchronize the favorites in this subfolder with the favorites on your HP Jornada Unless you mark the favorite link as a mobile favorite only the link...

Страница 58: ...chedule in step 3 you must manually update the information on your HP Jornada Before you synchronize in Internet Explorer on your desktop PC click Tools and then Synchronize Check the last time content was downloaded and manually download content if needed You can add a button to the Internet Explorer toolbar for creating mobile favorites In Internet Explorer 5 on your desktop PC click View Toolba...

Страница 59: ...information see ActiveSync Help Limit the number of downloaded linked pages In Internet Explorer on the desktop PC right click the mobile favorite you want to change and then click Properties On the Download tab specify 0 or 1 for the number of linked pages you want to download 6HQGLQJ DQG UHFHLYLQJ H PDLO Your HP Jornada includes Inbox a full featured e mail program that is part of Microsoft Pock...

Страница 60: ...Outbox folder on your device are transferred to the Outbox in Microsoft Exchange or Outlook on your desktop PC The messages are sent the next time you send mail from your desktop PC You can only synchronize e mail messages with a single desktop PC If you have established partnerships between your HP Jornada and two desktop PCs you can synchronize your Inbox with only one of them 6HQGLQJ DQG UHFHLY...

Страница 61: ...nbox icon 2 On the Services menu tap New Service 3 Select a service type IMAP4 or POP3 and type a name for the service The name can be anything you choose If you are not sure what type of service is associated with your account consult your account administrator Tap Next 4 If you connect to your mail server using a modem select a dial up connection from the drop down list or If you connect to your...

Страница 62: ...he message list By default the most recently received messages appear first in the list Unread messages are displayed in bold The Inbox message list X NJM J VN JPN 1 In the message list tap the icon of the message you want to read To reply to or forward the message tap To read the next message tap the down arrow on the Command bar ...

Страница 63: ...with attachments you must mark the message in Inbox and then connect to the mail server or synchronize again X VJ T J VN JPN OX N RN_JU 1 In the message list tap and hold the message you want to retrieve 2 On the pop up menu tap Get Full Copy You specify your downloading preferences when you set up the service or select your synchronization options You can change them at any time Change options fo...

Страница 64: ...tems folder This folder is for messages deleted on the e mail server The behavior of the Deleted local and Sent folders depends on the options you have chosen In the message list tap Tools and then Options On the Message tab select your options If you want to organize messages into additional folders tap Tools and then New Folder to create new folders To move or copy a message to another folder ta...

Страница 65: ...hapter also offers important tips on safeguarding your data by managing power and memory and using the security settings In this chapter you will learn to Manage power effectively Manage the memory on your HP Jornada Adjust settings for the display and sounds Use security features to protect your data Configure hardware buttons for games Configure menus for easy access to programs and documents Ad...

Страница 66: ...he device shuts down automatically You will be unable to use your Pocket PC until you connect to external power for charging Data will be retained for up to 5 days Because your HP Jornada is charged automatically whenever it is connected to ac power simply connect the HP Jornada to ac power to recharge when the power is low While your HP Jornada is connected to ac power the Notification LED indica...

Страница 67: ...internal memory to the card For more information on CompactFlash cards see CompactFlash cards in chapter 8 Delete unnecessary files Remove Web pages stored for offline viewing in Internet Explorer folders Remove programs you no longer use See Adding or removing programs later in this chapter Clear program memory See Increasing program memory below QFUHDVLQJ SURJUDP PHPRU You can try any or all of ...

Страница 68: ...P settings application to quickly change settings such as screen brightness and contrast and speaker volume to display system information such as memory status and remaining power and to change display button and power driver settings X J 19 N RWP 1 On the Start menu tap HP settings or Press and hold the HP home menu hot key 7KH 6HWWLQJV WDE On the Settings tab you can adjust the screen brightness...

Страница 69: ...to fine tune the settings The remaining power is displayed on a status bar at the bottom of the Settings tab To switch to the Power control panel tap the battery icon next to the power status bar 7KH 0HPRU WDE The Memory tab displays total and available free Storage Program and Storage Card memory For information on allocating memory between storage and programs see Managing memory earlier in this...

Страница 70: ... security application to prevent unauthorized access to your HP Jornada and the data it holds You can set a password to protect your data set a reminder password and keep a record of when anyone attempts to access data on your HP Jornada If you enable password protection you must enter your password each time you turn on your Pocket PC Or you can set a short delay so you do not need to re enter yo...

Страница 71: ... MNUJb 1 Set your primary password 2 Select the Delay activation after suspend for check box 3 Using the input panel enter a number of minutes for the delay X LUNJ bX YJ X M 1 On the Primary tab tap CLR on the numeric keypad UHDWLQJ D VHFXULW ORJ You can also use the HP security application to record all attempts to access your HP Jornada and any attempts to modify the password settings You can vi...

Страница 72: ...can be assigned to different programs using the Buttons control panel and the HP game buttons application enables you to create hardware profiles for specific games 7KH XWWRQV FRQWURO SDQHO Use the Buttons control panel to assign any of the HP Jornada hardware buttons the HP hot keys and the Record button to any program You can also customize the Action button to control the speed at which you scr...

Страница 73: ...ttons select the Show status icon check box The HP game buttons status icon will appear in the Command bar of the Today screen Simply tap the status icon to enable or disable the gaming buttons NJ RWP J PJVN Y XORUN You can create a different profile for each of your favorite games by assigning the hardware buttons on your Pocket PC to the actions associated with each game X L NJ N J PJVN Y XORUN ...

Страница 74: ...NW 1 Press the HP home menu hot key to open HP home menu To display the second page of buttons press the hot key a second time or tap the HP home menu icon in the lower right corner of the HP home menu screen 2 Tap and hold the stylus on the button you want to modify 3 On the pop up menu tap Assign Rename or Delete Assign Tap Assign and then browse to select the program or document you want to ass...

Страница 75: ...tap Settings and then tap Menus 2 On the Start Menu tab select the check box for the program you want to add The Start Menu tab displays only the programs stored in the Start Menu folder on your HP Jornada If you do not see a particular program listed use File Explorer to move the program to the Start Menu folder 1HZ PHQX You can also add or remove programs from the New menu to make it easier to c...

Страница 76: ...eb The only programs that will run on your HP Jornada are those designed specifically to run on Windows for Pocket PC You cannot run programs designed for Windows 95 98 2000 Me or NT on your HP Jornada In addition you may need a version of the program designed specifically for the SH3 processor Install software to your HP Jornada by first loading the installation files onto your desktop PC and the...

Страница 77: ...Sync window 2 On the Tools menu in the ActiveSync window click Add Remove Programs 3 Select the check box for the program you want to add 5HPRYLQJ SURJUDPV To free storage memory on your HP Jornada you can remove programs you no longer use Only programs you have added can be removed that is only programs that are stored in RAM The preinstalled programs programs stored in ROM cannot be removed howe...

Страница 78: ...74 HP Jornada 520 Series User s Guide ...

Страница 79: ... or Microsoft Exchange on your desktop PC with information in Pocket Outlook on your HP Jornada Each time you synchronize ActiveSync compares the changes you made on your device and desktop PC and updates both computers with the latest information For information on using ActiveSync see ActiveSync Help on your desktop PC In this chapter you will learn to Schedule appointments and meetings using Ca...

Страница 80: ... views by using the View menu The Day view in Calendar When you tap an appointment in Calendar a summary screen of the information you entered is displayed Tap the top portion of the summary screen to change the appointment information You can customize the Calendar display for example changing the first day of the week by tapping Options on the Tools menu X L NJ N JW JYYXRW VNW 1 In Day or Week v...

Страница 81: ...automatically and sent either when you synchronize Inbox or when you connect to your e mail server Indicate how you want meeting requests sent by tapping Tools and then Options If you send and receive e mail messages through ActiveSync select ActiveSync X LQNM UN J VNN RWP 1 Create an appointment 2 In the appointment details hide the Input panel and then tap Attendees 3 From the list of e mail add...

Страница 82: ...el enter a name and other contact information You will need to scroll down to see all available fields 3 To assign the contact to a category scroll to and then tap Categories Select a category from the list In the Contact list you can display contacts by category 4 To add notes tap the Notes tab You can enter text draw or create a recording For more information on creating notes see Notes capturin...

Страница 83: ...st a summary screen of the information you entered is displayed The Task list To change the way information is displayed in the list tap Tools and then Options X L NJ N J J T 1 Tap New 2 Using the Input panel enter a subject 3 You can enter a start date and due date or enter other information by first tapping the field If the Input panel is open you will need to hide it to see all available fields...

Страница 84: ...tap OK to return to the Task list To quickly create a task with only a subject tap Entry Bar on the Tools menu Then tap Tap here to add a new task and enter your task information 1RWHV FDSWXULQJ WKRXJKWV DQG LGHDV Quickly capture thoughts reminders ideas drawings and phone numbers with Notes You can create a written note or a recording You can also include a recording within a note If a note is op...

Страница 85: ...ch Pocket Outlook application is active when you select Recv non Windows For example you can have Contacts open and still receive a Calendar or Task item HP info exchange is not available in Pocket Outlook Inbox HP info exchange runs only on your HP Jornada No additional software is required for IrDA equipped PDA devices X NWM 926 RWOX VJ RXW O XV bX 19 3X WJMJ X JW 2 NZ RYYNM 9 MN_RLN 1 In Contac...

Страница 86: ... for exchanged data are listed below HP info exchange supports sending and receiving multiple contacts appointments and tasks A number of Pocket Outlook fields are not used e g Children Spouse because they are not used by other PDA devices or are not supported by the v card standard If the number of entries of important field types e g phone numbers received exceeds the number of Pocket Outlook fi...

Страница 87: ...er Third party programs include OmniSolve from Landware This section provides an overview of these programs and enough information to get you started For complete instructions on using a program refer to online Help for that program In this chapter you will learn about Microsoft Pocket Word Microsoft Pocket Excel Microsoft Windows Media Player for Pocket PC MusicMatch Jukebox and Windows Media Man...

Страница 88: ... when you open a second document you will be asked to save the first You can save a document you create or edit in a variety of formats including Pocket Word psw Rich Text Format rtf and Plain Text txt You can enter information in Pocket Word in four modes writing drawing typing and recording Use the View menu to switch between modes Each mode has its own toolbar which you can show and hide by tap...

Страница 89: ...reated on a desktop PC select Wrap to Window on the View menu so that you can see the entire document 0LFURVRIW 3RFNHW FHO Microsoft Pocket Excel works with Microsoft Excel on your desktop PC to give you easy access to copies of your workbooks You can create new workbooks on your device or you can copy workbooks from your desktop PC to your device Synchronize workbooks between your desktop PC and ...

Страница 90: ...You might want to freeze the top and leftmost panes in a worksheet to keep row and column labels visible as you scroll through a sheet Split panes to view different areas of a large worksheet Tap View and then Split Then drag the split bar to where you want it To remove the split tap View and then Remove Split Show and hide rows and columns To hide a row or column select a cell in the row or colum...

Страница 91: ...opy music files to enjoy on your HP Jornada by converting or ripping files from your favorite audio CDs or by downloading songs from a Web site such as EMusic com When you have saved the audio file on your desktop PC use the Microsoft Windows Media Manager for Pocket PC to convert the file to the appropriate format and copy it to your HP Jornada XYbRWP XWP O XV J MRX Use the MusicMatch Jukebox app...

Страница 92: ...iles saved in Windows Media use very little storage memory compared to some other recording formats Windows Media Manager is included in the Extras folder on the ActiveSync CD ROM You must install Windows Media Manager on your desktop PC to copy and convert digital audio files Some vendors distribute audio files as packaged content that is digital music that has been encrypted to protect the copyr...

Страница 93: ...s eBooks on your HP Jornada Download books to your desktop PC from eBook Web sites Then use ActiveSync to copy the book files to your Pocket PC The books appear in the Reader Library An eBook includes many features not available with a paper book These features are available from any book page You can add notes or bookmarks highlight text search for words or phrases and copy text to use in other d...

Страница 94: ...or real estate retail and business professionals who use Pocket PCs to make financial decisions quickly and accurately OmniSolve employs a form filling metaphor to provide a rich problem solving environment that is unparalleled in ease of use power and flexibility X J 8VWR XU_N 1 On the Start menu tap Programs and then tap the OmniSolve icon For detailed help and procedures about using OmniSolve r...

Страница 95: ...d protect your Pocket PC from accidental damage HP makes a variety of accessories designed specifically to enhance your HP Jornada Pocket PC In addition you can purchase CompactFlash card accessories from many vendors This chapter describes accessories available from HP how to install and use CompactFlash cards ...

Страница 96: ...the world with this worldwide voltage adapter Executive Leather Case F1829A Protect your HP Jornada in style with this slim executive design leather case with stylus holder Flip top design allows for maximum ergonomic fit and functionality Executive Bi Fold Leather Case F1826A Protect your HP Jornada with this elegantly designed bifold leather case for classical look and functionality Leather Clip...

Страница 97: ...ftware drivers as you would install any other software or program For more information see Adding or removing programs in chapter 5 X RW JUU J XVYJL UJ Q LJ M 1 Open the door to the CompactFlash slot 2 Insert the CompactFlash card into the slot If you are using a CompactFlash memory card or another card that does not require a cable you can close the door to the CompactFlash slot while the card is...

Страница 98: ...94 HP Jornada 520 Series User s Guide The Type I CompactFlash card slot ...

Страница 99: ...n about troubleshooting ActiveSync click Microsoft ActiveSync Help on the Help menu in ActiveSync The information in this chapter will help you Reset your HP Jornada Restore your HP Jornada to the factory default settings Troubleshoot basic problems Troubleshoot problems with remote connections Troubleshoot problems with the display and touch screen ...

Страница 100: ...et your HP Jornada Reset after restoring data from a backup file or when the HP Jornada appears to be frozen or locked up When you reset you lose unsaved data in all open documents or programs Use HP task switcher to close all open documents and programs In the Today screen tap the HP task switcher icon and then tap Close Window and Close All on the pop up menu X N N 1 Disconnect the sync cable or...

Страница 101: ...o ensure the safety of your information should it be necessary to restore the factory defaults you should regularly back up your data to your desktop PC using ActiveSync or to a CompactFlash card using the HP backup application For more information on backing up data see Backing up and restoring data in chapter 3 Restoring the factory default settings erases all files programs and data you have en...

Страница 102: ...HPV If you have a specific problem review the information below to see if you can quickly find the answer Or visit the HP Web site at www hp com jornada for more information about common difficulties Problem Diagnosis Remedy HP Jornada does not turn on when not connected to ac power Power is too low to run your Pocket PC Connect to ac power and then turn on your HP Jornada Charge the battery regul...

Страница 103: ...ng HP Jornada locks up when running applications or it runs slowly HP Jornada is locked up Connect to ac power and reset See Resetting your HP Jornada in this chapter Note Check to ensure that the device is not running low on power and avoid running several applications at the same time Use HP task switcher to close applications that are not in use HP Jornada does not turn on or display appears to...

Страница 104: ...Difficult to install or run software from previous HP handheld on HP Jornada 520 Series Software that runs on previous HP handheld devices may not run on your HP Jornada 520 Series Pocket PC Because the HP Jornada 520 Series Pocket PC uses a newer operating system software built for previous generation Windows CE for palm sized PCs such as HP Jornada 430 420 may not run on your HP Jornada 520 Seri...

Страница 105: ... FRQQHFWLRQV This section offers troubleshooting help for connecting your HP Jornada to other computers For problems communicating with your desktop PC see ActiveSync Help EOH WR GLDO RXW EXW XQDEOH WR PDNH SURSHU FRQQHFWLRQ Make sure the network to which you are trying to connect supports Point to Point Protocol PPP Your ISP or network administrator can verify this Verify that the dialing locatio...

Страница 106: ...IC is compatible with the HP Jornada 520 Series Pocket PC Verify that you have added necessary server information On the Start menu tap Settings On the Connections tab tap Network Tap your installed adapter usually your Ethernet card s name and enter any necessary information Most networks use DHCP so you should not have to change these settings unless your network administrator instructs you to d...

Страница 107: ... then tap Disconnect Ensure the cable is securely plugged into the COM port on the back of your desktop PC Use the cable that came with the device without any extra cables or extenders attached Plug the other end of the cable securely into the correct port on your device If you are using a cradle push your device securely into the cradle LVSOD SUREOHPV If you are having trouble viewing data on you...

Страница 108: ...ofile In a dark room you may also need to ensure that the backlight is on and or position a lamp so that the light shines directly on the screen 6FUHHQ LV KDUG WR UHDG If you are having a hard time viewing a document in Notes try changing the size of the view To do this tap a zoom percentage on the Tools menu In Pocket Word and Pocket Excel tap Zoom on the View menu and then select a zoom percenta...

Страница 109: ...equires service contact Hewlett Packard for service information shipping instructions and out of warranty service charges before you send your device to HP for repair In countries not listed in the table contact the Hewlett Packard authorized dealer or sales office 6HUYLFH For diagnostic instructions and other service information contact one of the technical support numbers listed Please do not sh...

Страница 110: ...ldwide customer support network is available to give you personal telephone service should you need it Telephone Buenos Aires Rest of the country 54 11 4778 8380 0810 555 5520 ext 4778 8380 Australia 61 3 88778000 Austria 43 711 4201080 Belgium Dutch 32 2 6268806 Belgium French 32 2 6268807 Brazil Sao Paulo Rest of the country 11 3747 7799 0800 157751 Canada 1 905 2064663 Chile 56 800 360999 China...

Страница 111: ...Mexico City Rest of the country 52 58 9922 01 800 4720684 Netherlands 31 20 6068751 New Zealand 64 9 3566640 Norway 47 22 116299 Philippines 63 2 8673551 Poland 48 22 8659999 Portugal 351 13180065 Russia 7 095 9169821 Singapore 65 2725300 South Africa 27 11 8061030 Spain 34 91 7820109 Sweden 46 8 6192170 Switzerland German 41 1 4332728 Switzerland French 41 1 4332729 Taiwan 886 2 27170055 Thailand...

Страница 112: ... toll call Venezuela Caracas Rest of the country 207 8488 800 47 777 Vietnam 84 0 88234530 All Customer Care Centers are available during office hours Pre sales Information in the USA is available 24 hours per day 7 days per week Support Service in the USA can be contacted from 5 am to 5 pm Pacific Time Monday through Friday Pre sales Information 44 870 6083003 Country Region ...

Страница 113: ...dy shall be a refund of the purchase price upon return of the product LPLWDWLRQ RI ZDUUDQW The above warranty shall not apply to defects resulting from misuse dropping the unit unauthorized modification opening for any reason except to perform an official upgrade using an HP Upgrade Kit operation or storage outside the environmental specifications for the product in transit damage improper mainten...

Страница 114: ...mer transactions in Australia New Zealand and the United Kingdom and shall not affect the statutory rights of consumers RU FRQVXPHUV LQ XVWUDOLD The above warranty terms and any other warranty statement enclosed with this product except to the extent lawfully permitted do not exclude restrict or modify and are in addition to the statutory rights implied by the Trade Practices Act 1974 or any corre...

Страница 115: ...ment shall govern the use of all software that is provided to you the customer as part of this HP product with the exception of Microsoft Software Microsoft Products are licensed to you under the Microsoft End User License Agreement EULA contained in the Microsoft documentation Any third party software supplier s warranty terms that may be found online or in any documentation or other materials co...

Страница 116: ...to be bound by the terms of this License Agreement Upon such a transfer you agree that your rights to the software are terminated and that you will either destroy all your copies and adaptations or deliver them to the third party Transfer to a U S government department or agency or to a prime or lower tier contractor in connection with a U S government contract shall be made only upon prior writte...

Страница 117: ... regard to that third party software 7RWN b Jb 5RVR NM XO J N J JW b HP warrants for a period of NINETY 90 DAYS from the date of purchase that the software product will execute its programming instructions when all files are properly installed HP does not warrant that the software will be uninterrupted or error free In the event that this software product fails to execute its programming instructi...

Страница 118: ...ate to state province to province or country to country 5RVR J RXW XO URJKRUR b JWM NVNMRN THE REMEDIES PROVIDED ABOVE ARE YOUR SOLE AND EXCLUSIVE REMEDIES IN NO EVENT SHALL HP BE LIABLE FOR ANY DIRECT INDIRECT SPECIAL INCIDENTAL OR CONSEQUENTIAL DAMAGES INCLUDING LOST PROFIT WHETHER BASED ON WARRANTY CONTRACT TORT OR ANY OTHER LEGAL THEORY Some states provinces or countries do not allow the exclu...

Страница 119: ...ct connection A connection between your HP Jornada and another computer by means of the sync cable or IR port DNS Domain Name System An Internet service that translates domain names into IP addresses For example the domain name www jornada com might translate as 198 125 247 4 Driver A control program that enables a computer to work with a specific device or peripheral IMAP4 Internet Messaging Acce...

Страница 120: ...set of applications that organizes information such as addresses appointments and notes POP3 Post Office Protocol v3 A protocol that enables a computer to retrieve messages from a mail server PPP Point to Point Protocol The default method your HP Jornada uses to communicate with an ISP network server Proxy server A server that sits between a client computer or Web browser and the Internet A proxy ...

Страница 121: ...ail Transport Protocol A protocol for sending e mail messages between computers on the Internet Stylus A pen like utensil designed for navigating on a touch screen Synchronization The process of comparing the files or data on two computers to ensure that they contain the exact same information Touch screen A touch sensitive screen that allows you to open files launch programs and select text by to...

Страница 122: ...118 HP Jornada 520 Series User s Guide ...

Страница 123: ...s of how to write characters in lowercase mode You can also choose to write in uppercase Graffiti compatible mode In this mode you write characters in uppercase If you prefer to write in uppercase mode tap Uppercase Mode in Options on the input method menu Whether a letter appears in uppercase or lowercase when it is converted to typed text depends on where in the Input panel you write it not on t...

Страница 124: ... in lowercase mode the dot on each character is the starting point for writing Remember that even though you write a letter in its lowercase form the case of the text that is displayed depends on where you write the letter For example if you write a lowercase a in the ABC area an uppercase A is displayed on the screen ...

Страница 125: ...Appendix A Character recognition 121 For more information on using Character Recognizer and for demos of all characters tap on the Character Recognizer Input panel ...

Страница 126: ...122 HP Jornada 520 Series User s Guide ...

Страница 127: ...top PC so that the information on your desktop PC is current 3 If you have files on your device that you want to transfer such as Note Taker notes and recordings turn file conversion off in ActiveSync options so that the files stay in device format and use ActiveSync Explorer to copy the files to your desktop PC For specific instructions see ActiveSync Help on the desktop PC 4 Synchronize your Poc...

Страница 128: ...sktop PC and then click Windows CE Inbox Transfer on the Outlook Tools menu 8 Select Copy selected messages to your mobile device and then click the Browse button 9 Select the offline folder on your device that you want to transfer the messages to and then click OK 10 Click the Transfer button The selected messages are moved to your HP Jornada 0LJUDWLQJ GDWD IURP 3DOP GHYLFHV 0LJUDWLQJ IURP 3DOP D...

Страница 129: ...OP RUJDQL HUV If you would like to use PocketMirror to synchronize your PalmPilot or Pilot organizer with Microsoft Outlook you will need to purchase the commercial version of the software from Chapura the maker of PocketMirror Check with Chapura directly ...

Страница 130: ...126 HP Jornada 520 Series User s Guide ...

Страница 131: ...ocket Internet Explorer browsing files and folders 27 39 the Web 51 52 calculator See OmniSolve Calendar 3 4 5 15 23 25 37 40 41 43 75 76 77 81 82 104 Calendar hot key 15 cellular phone See mobile phone channels See also Mobile Favorites AvantGo 52 53 mobile 31 45 52 53 synchronizing 53 viewing 53 Character Recognizer 20 21 22 23 84 119 121 charging See power clock 18 Command bar 19 CompactFlash c...

Страница 132: ...ee profiles HP game buttons GSM files 26 hardware buttons 4 14 61 68 69 configuring 68 headphone jack 11 HP backup 4 40 43 97 100 HP Dynamic Voice 26 installing 31 HP game buttons 4 19 68 69 HP home menu 4 13 15 17 18 64 70 71 HP home menu hot key 15 HP hot keys 10 11 15 68 HP info exchange 4 81 82 HP Jornada CD ROM 2 6 7 87 88 HP security See security HP settings 4 13 14 15 62 64 65 99 103 104 HP...

Страница 133: ... 83 90 owner information 68 3 Palm devices migrating data 124 Palm devices migrating data 124 125 partnership establishing 36 multiple 36 New Partnership Wizard 36 passwords clearing 67 for a network 49 50 102 for backup files 40 for e mail 49 57 for HP Jornada 4 66 67 delay 67 primary 66 67 reminder 67 for notes 6 for Pocket Excel workbooks 86 for the Internet 49 50 forgetting 67 97 PCM files 26 ...

Страница 134: ... 18 71 status icons 19 stopping programs 63 storage memory 18 26 27 55 63 73 88 89 stylus 92 calibrating 16 using 16 switching programs 17 switching views 15 sync cable 33 synchronization 7 36 37 55 56 116 channels 53 conflicts 38 Inbox 56 remote 38 39 system requirements ActiveSync 30 7 Tasks 3 5 15 20 23 25 37 40 41 43 75 79 81 82 104 Tasks hot key 15 87 technical support 3 13 105 temperature 12...

Отзывы: