background image

16

49-5000295   Rev. 1

CONFIGURACIÓN WIFI

Configuración WiFi

INFORMACIÓN REGULATORIA

Declaración de Cumplimiento con FCC/
IC:

1. Este dispositivo no podrá causar interferencias perjudiciales.

2.  Este dispositivo debe aceptar cualquier interferencia 

recibida, incluidas las interferencias que puedan provocar un 
funcionamiento no deseado.

Este equipo fue probado y cumple con los límites establecidos 

SDUDXQGLVSRVLWLYRGLJLWDOGHFODVH%VHJ~QODSDUWHGH
OD1RUPDWLYDGHOD)&&(VWRVOtPLWHVIXHURQGLVHxDGRVSDUD

brindar una protección razonable contra interferencias nocivas 
en una instalación residencial. Este equipo genera, usa y 
puede emitir energía de radiofrecuencia y, si no se instala 
y utiliza de acuerdo con las instrucciones, puede ocasionar 
interferencias perjudiciales sobre las comunicaciones 
radiales. Sin embargo, no se garantiza que no se presenten 
interferencias en una instalación en particular. Si este equipo 
provoca interferencias perjudiciales para la recepción de radio 
o televisión, lo que puede comprobar encendiendo y apagando 
el equipo, se aconseja al usuario que intente corregir la 

LQWHUIHUHQFLDDWUDYpVGHXQDRPiVGHODVVLJXLHQWHVPHGLGDV

• Reoriente o reubique la antena receptora.

• Aumente la separación entre el equipo y el receptor.

• Conecte el equipo a un tomacorriente de un circuito diferente 
al tomacorriente al cual se encuentra conectado el receptor.

• Para solicitar ayuda, consulte al comerciante minorista o a un 
técnico experimentado de radio/ televisión.

Etiqueta: 

Las modificaciones sobre esta unidad no aprobadas 

expresamente por parte del fabricante podrían anular la 
autoridad del usuario para utilizar el equipo.

*Modelos Selectos Únicamente

(VWHSURGXFWRWLHQHFDSDFLGDG:L)L\UHTXLHUHFRQHFWLYLGDGD,QWHUQHW

y un enrutador inalámbrico para permitir la interconexión con un 
Sistema de administración de energía y / o con otros dispositivos, 
sistemas o aplicaciones externos. 

(OXVRGH:RUNVFRQHOORJRWLSRGH$SSOH+RPH.LWŒVLJQLILFD

que un accesorio electrónico se ha diseñado para conectarse 
específicamente con iPod touch®, iPhone® o iPad®, respectivamente, 
y el desarrollador ha certificado que cumple con los estándares de 
rendimiento de Apple®. Apple no es responsable del funcionamiento 
de este dispositivo ni de su cumplimiento de las normas de seguridad 
y reglamentarias.

Puesta en marcha

A fin de conectar su acondicionador de aire para sala, 

necesitará la Aplicación de GE Appliances. La aplicación 

ORJXLDUiDWUDYpVGHOSURFHVRGHFRQH[LyQ'HVFDUJXHOD

aplicación de iTunes o Google Play. 

Los datos  de todos los electrodomésticos 

conectados son guardados en estricto cumplimiento 

con la Política de Privacidad de Datos de Conexión 

de GE Appliances. Para acceder a esta política, visite 

geappliances.com/privacy/privacy_policy_connected.

Preguntas acerca de WiFi Connect

Acceda a respuestas necesarias sobre la configuración 
de electrodomésticos con WiFi y la conexión a su red 
hogareña a través de nuestros artículos de soporte.  

3DUDDFFHGHUDORVDUWtFXORVGHVRSRUWHODFRQH[LyQZLIL

del acondicionador de aire para sala, visite products.

JHDSSOLDQFHVFRPDSSOLDQFHJHDVXSSRUWVHDUFKFRQWHQW

Respuesta a la Demanda

(VWHSURGXFWRFXHQWDFRQFDSDFLGDGGH5HVSXHVWDDOD'HPDQGDORFXDOSHUPLWHTXHSDUWLFLSHHQHYHQWRVGHUHGXFFLyQGHFDUJD

iniciados por las utilidades. Estos eventos apagarán de forma temporal el Acondicionador de Aire a fin de realizar leves ajustes de 

WHPSHUDWXUD/RVXVXDULRVSRGUiQDQXODUGHIRUPDDFWLYDHVWRVHYHQWRVPDQWHQLHQGRSUHVLRQDGRHOERWyQ0RGH0RGRGXUDQWH

segundos. La unidad regresará al mismo estado al cual fue configurada antes de recibir la señal de respuesta a la demanda.   

$QWHVGHOXVRGHVFDUJXHOD$SOLFDFLyQ*($SSOLDQFHV&RPIRUW\DFWXDOLFHVXVRIWZDUHFRQHFWDGRVLDVtVHLQGLFD

(VWH SURGXFWR FXHQWD FRQ FDSDFLGDG :L)L \ UHTXLHUH GH FRQHFWLYLGDG D ,QWHUQHW \ XQ HQUXWDGRU LQDOiPEULFR D ILQ GH SHUPLWLU OD

interconexión con un Sistema de Manejo de Energía, y/o con otros dispositivos, sistemas o aplicaciones externas.t

Содержание Profile ENERGY STAR PHC06 Series

Страница 1: ...ER S MANUAL AIR CONDITIONER ROOM 49 5000295 Rev 1 02 19 GEA SAFETY INFORMATION 3 USING THE AIR CONDITIONER Controls 4 CARE AND CLEANING 8 INSTALLATION INSTRUCTIONS Before you begin 9 Electrical Requirements 9 Parts Included 10 Window Requirements 11 Prepare the Air Conditioner 11 Install the Air Conditioner 12 TROUBLESHOOTING TIPS 14 Normal Operating Sounds 15 WiFi SETUP 15 CONSUMER SUPPORT Limite...

Страница 2: ...es into every GE Appliances product and we think you will too Among other things registration of your appliance ensures that we can deliver important product information and warranty details when you need them Register your GE appliance now online Helpful websites and phone numbers are available in the Consumer Support section of this Owner s Manual You may also mail in the pre printed registratio...

Страница 3: ...of flammable refrigerants Ŷ GE Appliances does not support any servicing of the air conditioner Ŷ Dispose of air conditioner in accordance with Federal and Local Regulations Flammable refrigerants require special disposal procedures Contact your local authorities for the environmentally safe disposal of your air conditioner WARNING Risk of Fire or Explosion This unit contains flammable refrigerant...

Страница 4: ...ode per the EPA requirements You can select any other mode to satisfy your needs Features and appearance will vary Controls 1 MODE 1 Press MODE until you see the indicator light come on next to the desired setting 2 Choose Fan Cool Energy save E Save or Dehum Fan Only the fan runs Press FAN SPEED to select High Med or Quiet fan speed The display shows the current room temperature NOTE in fan mode ...

Страница 5: ...the set time is zero After 3 seconds the light on the Delay 1 24 hour pad goes off 4 TEMP TIME 1 Press the TEMP TIME button to raise the temperature Each time you press the TEMP TIME button the temperature will go up by 1 F until it reaches 86 F 30 C 2 Press the TEMP TIME button to lower the temperature Each time you press the TEMP TIME button the temperature will go down by 1 F until it reaches 6...

Страница 6: ...untdown will initiate To clear TIMER Program NOTE Air conditioner can be either on or off Press TIMER ON OFF button until Timer indicator light turns off 5 TEMP UP TEMP DOWN 3UHVV WKH 7 03 83 EXWWRQ WR UDLVH WKH WHPSHUDWXUH DFK WLPH RX SUHVV WKH 7 03 83 EXWWRQ WKH temperature will go up 1 F until it reaches 86 F 30 C Press the TEMP DOWN button to lower the temperature Each time you press the TEMP ...

Страница 7: ...educe cooling capacity point air directional louvers up COOL MAX To maximize cooling capacity point air directional louvers down Changing the Air Direction 2 Way Air Flow The air directional louvers let you control the direction of the airflow The airflow can be directed up to down ...

Страница 8: ...ery dirty wash it in warm water with mild detergent Do not wash the air filter in a dishwasher or clothes washer or use any chemical cleaners Do not use a cloth dryer or microwave oven to dry it Air dry the air filter completely before placing it back in the unit 4 Place the air filter back in the air conditioner The bottom of the black filter should nest behind three white tabs in the base of the...

Страница 9: ...nder any circumstances cut or remove the third ground prong from the power cord Do not change the plug on the power cord of this air conditioner Aluminum house wiring may present special problems consult a qualified electrician Power cord includes a current interrupter device A test and reset button is provided on the plug case The device should be tested on a periodic basis by first pressing the ...

Страница 10: ...RESET TEMP DOWN QUIET HIGH MED AUTO COOL FAN ENERGY SAVE TEMP UP Side Curtain Frame Type B 9 1 wood screw Weather Seal 3 Side Curtain 2 Top mounting rail Air conditioner Window locking bracket 1 Side Brackets 2 PARTS INCLUDED Appearance may vary Left Right Type A 4 3 8 self tapping screw Foam Seal Remote Control Side Curtain Foam 2 ...

Страница 11: ...opening dimensions All supporting parts must be secured to firm wood masonry or metal The electrical outlet must be within reach of the power cord Follow the dimensions in the table and illustration for your model 2 STORM WINDOW REQUIREMENTS A storm window frame will not allow the air conditioner to tilt toward the outside and will keep it from draining properly To adjust for this attach a piece o...

Страница 12: ...at the air conditioner is level or tilting slightly to the outside Width of window opening Center line 4 INSTALL THE AIR CONDITIONER IN THE WINDOW continues C Install the side bracket into the unit and into the window sill using two 1 wood screws provided Repeat on other side D Extend the curtain panels until they fill the window Mark the location of the holes in each corner of WKH FXUWDLQ 8VH WKH...

Страница 13: ...th one Type B screw B Cut the foam top window gasket to the window width C Stuff the foam between the glass and the window to prevent air and insects from getting into the room NOTE If the gasket supplied does not fit your window obtain appropriate material locally to provide a proper installation seal Wood Vinyl 5 INSTALL WINDOW LOCKING BRACKET AND FOAM TOP WINDOW GASKET continues D For additiona...

Страница 14: ... batteries are inserted in the correct position Air conditioner does not cool as it should Indoor airflow is restricted Make sure there are not curtains blinds or furniture blocking the front of the air conditioner The temp control may not be set properly Turn the temperature control to a higher number The air filter is dirty Clean the filter at least every 30 days See Care and Cleaning section Th...

Страница 15: ... customers in the United States GE Appliances WiFi Connect Enabled If your Air Conditioner AC has a Connected Appliance Information label located on the outside as shown below your AC is GE Appliances WiFi Connect Enabled A WiFi communication card is built into the product allowing it to communicate with your smart phone for remote monitoring control and notifications Please visit www GEAppliances...

Страница 16: ...outer to enable interconnection with an Energy Management System and or with other external devices systems or applications 8VH RI WKH RUNV ZLWK SSOH RPH LW ORJR PHDQV that an electronic accessory has been designed to connect specifically to iPod touch iPhone or iPad respectively and has been certified by the developer to meet Apple performance standards Apple is not responsible for the operation ...

Страница 17: ...failure to provide reasonable and necessary maintenance Ŷ 5HSODFHPHQW RI KRXVH IXVHV RU UHVHWWLQJ RI FLUFXLW breakers Ŷ DLOXUH GXH WR FRUURVLRQ RQ PRGHOV QRW FRUURVLRQ protected Ŷ DPDJH WR WKH SURGXFW FDXVHG E LPSURSHU SRZHU supply voltage accident fire floods or acts of God Ŷ QFLGHQWDO RU FRQVHTXHQWLDO GDPDJH FDXVHG E possible defects with this air conditioner Ŷ DPDJH FDXVHG DIWHU GHOLYHU What Wi...

Страница 18: ... are available while your warranty is still in effect You can purchase it on line anytime GE Appliances Services will still be there after your ZDUUDQW H SLUHV Q WKH 86 GEAppliances com extended warranty or call 800 626 2224 during normal business hours Remote Connectivity For assistance with wireless network connectivity for models with remote enable visit our website at GEAppliances com connect ...

Страница 19: ...cionador de aire INFORMACIÓN DE SEGURIDAD 3 USO DEL ACONDICIONADOR DE AIRE Controles 4 CUIDADO Y LIMPIEZA 8 INSTRUCCIONES DE INSTALACIÓN Antes de comenzar 9 Requisitos Eléctricos 9 Piezas Incluidas 10 Requisitos de la Ventana 11 Preparación del Acondicionador de Aire 11 Instalación del Acondicionador de Aire 12 CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS 14 Sonidos de Funcionamiento Normal 15 CONFIGURA...

Страница 20: ...s y creemos que usted también Entre otras cosas el registro de su electrodoméstico asegura que podamos entregarle información importante del producto y detalles de la garantía cuando los necesite Registre su electrodoméstico GE ahora a través de Internet Sitios Web y números telefónicos útiles están disponibles en la sección de Soporte para el Consumidor de este Manual del Propietario También pued...

Страница 21: ...pVWLFR GH DFXHUGR FRQ ODV 5HJXODFLRQHV Federales y Locales Los refrigerantes inflamables requieren procedimientos de descarte específicos A fin de descartar su acondicionador de aire de forma ambientalmente segura comuníquese con las autoridades locales Riesgo de Incendio o Explosión Esta unidad contiene refrigerante inflamable Se deben seguir las precauciones adicionales de seguridad ADVERTENCIA ...

Страница 22: ...XH OD OX LQGLFDGRUD pasa a la siguiente configuración deseada OLMD DQ YHQWLODFLyQ RRO HQIULDPLHQWR QHUJ 6DYH 6DYH DKRUUR GH HQHUJtD R HKXP GHVKXPLGLILFDU Fan 6ROR IXQFLRQD HO YHQWLODGRU 2SULPD 1 63 SDUD VHOHFFLRQDU OD YHORFLGDG GHO YHQWLODGRU LJK 0HG R 4XLHW DOWD EDMD R VLOHQFLRVD D SDQWDOOD PXHVWUD OD temperatura actual de la habitación NOTA En el modo Fan la temperatura no puede ajustarse E Save...

Страница 23: ...tiempo nuevo si así lo desea Para cancelar el temporizador presione la tecla reducir en la unidad o en el control remoto hasta que el tiempo configurado sea cero Luego de 3 segundos la luz de la tecla Delay 1 24 hour Retraso de 1 a 24 horas se apaga 4 TIEMPO TEMPERATURA 2SULPD HO ERWyQ 7 03 7 0 SDUD VXELU OD temperatura Cada vez que oprima el botón TEMP TIME OD WHPSHUDWXUD DXPHQWDUi KDVWD que OOHJ...

Страница 24: ...ión de apagado del temporizador 2 SULPD HO ERWyQ GH IOHFKD 7 0 5 83 DXPHQWDU WHPSRUL DGRU R 7 0 5 2 1 GLVPLQXLU WHPSRUL DGRU para cambiar el tiempo de demora de 1 a 24 horas La OX LQGLFDGRUD 7LPHU 2 GHO SDQHO GH FRQWURO GHO DLUH acondicionado se encenderá 3 El timbre suena dos veces después de 5 segundos luego 7LPHU 2 FXHQWD DWUiV LQLFLDUi PARA BORRAR LA PROGRAMACIÓN DE DEMORA DEL TEMPORIZADOR NOT...

Страница 25: ... rejillas que dan dirección al aire Enfriamiento máximo Para maximizar la capacidad de enfriamiento apunte para abajo las rejillas que dan dirección al aire CAMBIO DE LA DIRECCIÓN DEL AIRE OXMR GH DLUH GH GLUHFFLRQHV DV UHMLOODV GLUHFFLRQDOHV de aire le permiten controlar la dirección del flujo de aire El flujo de aire se puede dirigir hacia arriba o hacia abajo ...

Страница 26: ...iYHOR FRQ DJXD WLELD GHWHUJHQWH VXDYH 1R ODYH el filtro de aire en un lavavajillas una lavadora ni utilice OLPSLDGRUHV TXtPLFRV 1R XVH XQD VHFDGRUD QL XQ KRUQR GH PLFURRQGDV SDUD VHFDUOR HMH TXH HO ILOWUR VHTXH completamente al aire libre antes de colocarlo de nuevo en la unidad 4 Vuelva a colocar el filtro de aire en el acondicionador de aire La parte inferior del filtro negro se deberá poder cal...

Страница 27: ...dos con un fusible de dilatación de tiempo de 15 amperios o un cortacircuitos El enchufe de tres púas con conexión a tierra minimiza la posibilidad de descargas eléctricas Si el tomacorriente de la pared que usted planea usar solamente tiene 2 tomas es su responsabilidad hacer que un técnico lo reemplace por uno de tres tomas con conexión a tierra PRECAUCIÓN DMR QLQJXQD FLUFXQVWDQFLD FRUWH R UHPXH...

Страница 28: ...AUTO COOL FAN ENERGY SAVE TEMP UP Cinta de espuma Control remoto PARTES INCLUIDAS La apariencia puede variar Riel de montaje superior Acondicionador de aire Cortinas Laterales Marcos de la Cortina Lateral dejado derecho 7LSR Tornillo de madera GH Soporte de Cierre GH OD 9HQWDQD Soportes Laterales 7LSR Tornillos autorroscantes GH XUOHWH Gomaespuma de la Cortina Lateral ...

Страница 29: ...s las partes de apoyo deben quedar totalmente aseguradas a algún metal mampostería o a la madera El tomacorriente eléctrico debe estar al alcance del cable eléctrico del acondicionador de aire Siga las dimensiones de la tabla y la ilustración según su modelo 2 REQUISITOS DE UNA VENTANA DE TORMENTAS 8Q PDUFR GH YHQWDQD GH WRUPHQWDV QR SHUPLWLUi TXH el acondicionador de aire se incline hacia el exte...

Страница 30: ...esté nivelado o apenas inclinado hacia el exterior 4 INSTALL THE AIR CONDITIONER IN THE WINDOW continues C Instale el soporte lateral en la unidad y en el alféizar de la ventana usando los dos tornillos GH PDGHUD GH SURYLVWRV 5HSLWD HVWH SDVR GHO otro lado D Extienda los paneles de la cortina hasta que llenen la ventana Marque la ubicación de los agujeros en cada HVTXLQD 8VH HO WDODGUR XQD EURFD G...

Страница 31: ...B Corte la junta de gomaespuma superior de la ventana del mismo ancho que la ventana C Coloque la gomaespuma entre el vidrio y la ventana para evitar el ingreso de aire e insectos a la habitación NOTA Si la junta provista no se ajusta a su ventana obtenga el material apropiado en forma local para contar con un sellado correcto en la instalación Madera Vinilo 5 INSTALE EL SOPORTE DE LA TRABA DE LA ...

Страница 32: ...ebería El flujo de aire está restringido Cerciórese de que no existe ninguna cortina persiana o mueble bloqueando el frente del acondicionador de aire El control de temperatura no está ajustado apropiadamente En los modelos con botones gire la temperatura a un número mayor El filtro de aire está sucio Limpie el filtro cada 30 días por lo menos Ver la sección de Cuidado y limpieza La habitación pod...

Страница 33: ...es WiFi Connected Habilitado Si su acondicionador de aire posee una etiqueta de Información del Electrodoméstico Conectado ubicada en la parte externa como se muestra a continuación su acondicionador de aire cuenta con L L RQQHFW DELOLWDGR 8QD WDUMHWD GH FRPXQLFDFLyQ GH L L HVWi LQFRUSRUDGD HQ HO SURGXFWR SHUPLWLHQGR OD FRPXQLFDFLyQ del mismo con su teléfono inteligente para el monitoreo remoto co...

Страница 34: ...ciones externos O XVR GH RUNV FRQ HO ORJRWLSR GH SSOH RPH LW VLJQLILFD que un accesorio electrónico se ha diseñado para conectarse específicamente con iPod touch iPhone o iPad respectivamente y el desarrollador ha certificado que cumple con los estándares de rendimiento de Apple Apple no es responsable del funcionamiento de este dispositivo ni de su cumplimiento de las normas de seguridad y reglam...

Страница 35: ...luyendo la falta de mantenimiento razonable o necesario Ŷ 5HHPSOD R GH IXVLEOHV GHO KRJDU R UHLQLFLR GH disyuntores Ŷ DOODV FRPR FRQVHFXHQFLD GH FRUURVLyQ HQ PRGHORV sin protección contra ésta Ŷ DxRV RFDVLRQDGRV VREUH HO SURGXFWR SRU QLYHO de suministro de voltaje inadecuado accidente incendio inundaciones o catástrofes naturales Ŷ DxRV FRQVHFXHQWHV R LQFLGHQWDOHV FDXVDGRV SRU posibles defectos de...

Страница 36: ...ue están disponibles mientras su garantía aún está vigente La puede adquirir en cualquier momento a través de Internet Los Servicios de GE Appliances aún HVWDUiQ DOOt FXDQGR VX JDUDQWtD FDGXTXH Q 88 GEAppliances com extended warranty R OODPH DO GXUDQWH el horario comercial habitual Conectividad Remota 3DUD VROLFLWDU DVLVWHQFLD FRQ OD FRQHFWLYLGDG GH UHG LQDOiPEULFD SDUD PRGHORV FRQ DFWLYDFLyQ UHPR...

Отзывы: