Pfaff creative 3.0 Owner'S Manual Download Page 40

4:2

Sewing mode

Sewing mode

In sewing mode you can select stitches, adjust and sew them. The selected stitch is shown in actual size in 

WKHVWLWFKÀHOG5HFRPPHQGDWLRQVDQGPDFKLQHVHWWLQJVDUHVKRZQDWWKHWRSRIWKHWRXFKVFUHHQ

Every mode in the PFAFF

®

 

creative

 Color Touch Screen has its own color scheme, to make it easier to 

navigate and use the machine.

Start view

When your machine is turned on, a start-up screen is shown and then the machine opens sewing mode. If 

the embroidery unit is attached the machine automatically opens embroidery mode.

Sewing mode - overview

Save to 

personal menu

Tie-off options

Sewing options

Sequencing

Free-motion options

Presser foot recommendation

Speed control 

symbol

Selected stitch number

Stitch width/ 

Stitch positioning

Thread tension

Stitch length/ 

Stitch density

IDT

 system/Lower feed dogs recommended

Twin needle/stitch width safety activated

Stabilizer recommended

Note: All symbols and options will not be shown at the same time.

Stitch Creator

 

feature

Summary of Contents for creative 3.0

Page 1: ...Owner s manual ...

Page 2: ...e the sewing machine with any air openings blocked Keep ventilation openings of the sewing machine and foot control free from the accumulation of lint dust and loose cloth HHS ÀQJHUV DZD IURP DOO PRYLQJ SDUWV 6SHFLDO FDUH LV UHTXLUHG DURXQG WKH VHZLQJ PDFKLQH needle Always use the proper needle plate The wrong plate can cause the needle to break Do not use bent needles R QRW SXOO RU SXVK IDEULF ZK...

Page 3: ...perience and knowledge unless they have been given supervision or instruction concerning use of the sewing machine by a person responsible for their safety Children should be supervised to ensure that they do not play with the sewing machine 7KH QRLVH OHYHO XQGHU QRUPDO RSHUDWLQJ FRQGLWLRQV LV OHVV WKDQ G 7KH PDFKLQH PXVW RQO EH XVHG ZLWK IRRW FRQWURO RI W SH 5 PDQXIDFWXUHG E 6KDQJKDL LRDR Precisi...

Page 4: ...transform all your creative ideas into reality using the most highly tuned technology and features Before you start please spend some time reading this owner s manual You will soon discover how to maximize the use of your machine Our authorized PFAFF dealers will of course also be pleased to advise you at any time Your PFAFF creative 3 0 sewing and HPEURLGHU PDFKLQH ZLOO GHÀQLWHO enable you to exp...

Page 5: ... Sequence commands 5 4 Loading and sewing a sequence 5 5 Saving a sequence 5 5 Important sequencing information 5 6 Common sequencing pop ups 5 6 Introduction 1 7 Machine overview 1 8 Front side 1 8 Rear side 1 9 Top parts 1 9 Accessory tray 1 9 Parts of the embroidery unit 1 9 Included accessories 1 10 Presser feet 1 11 Stitch overview 1 12 Utility stitches 1 12 Decorative stitches 1 15 Alphabets...

Page 6: ...ad a design 8 3 Load a font 8 3 RDG IURP SHUVRQDO ÀOHV 86 GHYLFH 8 3 Touch functions 8 4 Move 8 4 Scale 8 4 Rotate 8 4 Select design 8 5 Move design into hoop 8 5 Mirror a design 8 5 Delete a design 8 5 Option bar in embroidery edit 8 6 6DYH WR SHUVRQDO ÀOHV 8 6 Zoom options pan 8 6 Select hoop 8 7 Embroidery text editor 8 7 Embroidery stitch out 8 7 Embroidery edit pop ups 8 8 Embroidery mode sti...

Page 7: ...Introduction 1 ...

Page 8: ... lift toggle 14 Immediate tie off 15 Stitch restart 16 Speed control 17 Needle up down 18 PFAFF creative Color Touch Screen 19 Button ruler 20 Handwheel 21 Built in USB port 22 Stylus holder 23 Main switch connectors for power cord and foot control 24 Slide for lowering the feed dogs Needle area 25 Built in needle threader 26 Bobbin cover 27 Needle plate 28 Presser foot 29 Presser foot bar and pre...

Page 9: ...5 Thread tension disk 46 Take up lever FFHVVRU WUD The accessory tray features special compartments for presser feet and bobbins plus space for needles and other accessories Store the accessories in the tray so they are easily accessible 47 Space for accessories 48 Removable tray for presser feet 49 Removable bobbin holder Parts of the HPEURLGHU XQLW type BE16 50 Embroidery unit release button 51 ...

Page 10: ...2 64 Spool cap medium 65 Spool cap small 66 Multi purpose tool 67 Bobbins 10 68 Hoop clips Included hoops 69 creative 120 Square hoop 120x120 70 creative Elite hoop 260x200 Included accessories not in picture Foot control Power cord Needles Carrying case 0LFURÀEHU FORWK creative 3 0 Embroidery collection Quick start embroidery kit Warranty 69 70 55 56 57 58 59 60 61 62 63 64 65 66 67 68 ...

Page 11: ...e foot guides the fabric The red guide on the foot is designed to ride along the fold of the hem edge 4 Zipper foot for IDT V VWHP This foot can be snapped on either the right or the left of the needle making it easy to sew close to both sides of the zipper teeth Move needle position to right or left to sew closer to zipper teeth 5A Sensormatic buttonhole foot When connected to the machine the but...

Page 12: ...lique couching eyelets 1 1 8 Stretch triple zigzag stitch Elastic stitch for decorative hems or topstitching 1 1 9 Three step zigzag stitch Sewing elastic darning patching and decorative sewing 1 1 10 Elastic stitch Sewing elastic darning patching 1 1 11 Triple stretch stitch Sewing elastic darning patching and decorative sewing 1 1 12 Honeycomb stitch Decorative stitch for stretch fabrics and hem...

Page 13: ...1 Mock cover hem Create the look of a serger cover hem for stretch fabrics 1 2 12 Open overlock blindhem Create decorative overlock blindhem for woven fabrics 1 2 13 Closed overlock blindhem Create decorative overlock blindhem for stretch fabrics 1 3 1 Linen buttonhole Buttonhole for blouses shirts and linen 1 3 2 Standard buttonhole Basic buttonhole for blouses shirts and jackets Also for home dé...

Page 14: ...d dogs 1 4 1 Decorative eyelet Decorative eyelet for heirloom sewing 1 4 2 Programmable darning stitch Darning holes or damaged fabric 1 4 3 Programmable reinforced darning stitch Reinforced darning holes or damaged fabric 1 4 4 Bartack Automatically reinforce seams and pockets 1 4 5 Denim bartack Automatically reinforce seams and pockets decoratively 1 4 6 Decorative bartack Automatically reinfor...

Page 15: ...ross stitches 2 4 Quilt stitches Crazy patch stitches 3 2 Needle art stitches Hemstitches 3 3 Needle art stitches Antique hand embroidery stitches 2 4 Quilt stitches Crazy patch stitches 3 3 Needle art stitches Antique hand embroidery stitches 4 1 Decorative stitches Satin and edge stitches 3 4 Needle art stitches Smocking stitches 4 1 Decorative stitches Satin and edge stitches ...

Page 16: ...titches 4 4 Decorative stitches Fun stitches 5 1 Sewing techniques Optional feet stitches 5 2 Sewing techniques Handlook quilt stitches 4 2 Decorative stitches Floral and ornamental stitches 4 3 Decorative stitches Art stitches 4 4 Decorative stitches Fun stitches Comic Cyrillic Outline Script Alphabets ...

Page 17: ...2 Preparations ...

Page 18: ...HYHUVH WKH SOXJ I LW VWLOO GRHV QRW ÀW FRQWDFW D TXDOLÀHG HOHFWULFLDQ WR install the proper outlet Do not modify the plug in any way Connecting the foot control cord PRQJ WKH DFFHVVRULHV RX ZLOO ÀQG WKH IRRW FRQWURO cord Connecting the foot control cord to the foot FRQWURO LV RQO QHFFHVVDU WKH YHU ÀUVW WLPH RX DUH going to use the machine 1 Take out the foot control cord Turn the foot control over...

Page 19: ... accessory tray Slide the tray on to the machine around the free arm 5 Place the foot control in the space above the free arm 6 Put on the hard cover LED lights Your machine has LED lights which distribute the light evenly over the sewing area and eliminates shadows Free arm To use the free arm slide off the accessory tray When attached a hook keeps the accessory tray locked to the machine Remove ...

Page 20: ...cap slightly larger than the thread spool For narrow thread spools use a smaller spool cap in front of the spool For large thread spools use a larger spool cap in front of the spool 7KH ÁDW VLGH RI WKH VSRRO FDS VKRXOG EH SUHVVHG ÀUPO DJDLQVW WKH VSRRO 7KHUH VKRXOG EH QR VSDFH between the spool cap and the thread spool Vertical position Raise the spool pin to the vertical position Slide on the lar...

Page 21: ...nd down in the left hand threading slot to the needle thread guide E 5 Thread the needle Needle threader The needle threader allows you to thread the needle automatically The needle must be in the up position to use the built in needle threader 1 Lower the presser foot 2 Use the handle to pull the needle threader all the way down The threader hook G swivels through the needle eye 3 Place the threa...

Page 22: ...ads from the right into the take up lever D and down in the left hand threading slot Make sure that one thread is inside the needle thread guide E and the other one outside Make sure that the threads do not become twisted together 5 Thread the needles Note Activate twin needle and select the correct twin needle width in the Settings menu This will limit the width of all stitches for that needle si...

Page 23: ...e to the outside 5 Push the bobbin winder spindle to the right to wind A pop up appears on the screen to inform you that bobbin winding is active To adjust winding speed use the slider in the pop up Start bobbin winding by pressing the foot control or touch the start stop When the bobbin is full it will stop winding Release the foot control or touch start stop to stop the bobbin winder motor from ...

Page 24: ...e 3 0 sewing and embroidery machine provides the ideal solution the integrated dual feed IDT system As on industrial machines the IDT system feeds the fabric from the top and bottom at the same time The material is fed precisely eliminating puckering on seams in light weight fabrics such as silk and rayon The dual feed action of the IDT system prevents layers from shifting while sewing keeping qui...

Page 25: ...hen lowered Changing the needle 1 Use the hole in the multi purpose tool to hold the needle 2 Loosen the needle screw 3 Remove the needle 4 Insert the new needle using the multi purpose WRRO 3XVK WKH QHZ QHHGOH XSZDUGV ZLWK WKH ÁDW side away from you until it will go no further 5 Tighten the needle screw as tight as it will go Lowering feed dogs You can lower the feed dogs by moving the switch on ...

Page 26: ...GHU QHHGOH Embroidery needles have a special scarf a slightly rounded point and a slightly larger eye to avoid damage to thread and materials Use with metallic and other specialty threads for embroidery and decorative sewing HQLP QHHGOH Denim needles have a sharp point to penetrate WLJKWO ZRYHQ IDEULFV ZLWKRXW GHÁHFWLQJ WKH QHHGOH RU FDQYDV GHQLP PLFURÀEHUV LQJ QHHGOH The Wing needle has wide wing...

Page 27: ...ot of excess dye always pre wash it before sewing embroidering to prevent discoloration of your machine Stabilizers 7HDU DZD VWDELOL HUV Tear away stabilizers are used with stable woven fabrics Place underneath fabric for decorative stitching or hoop with the fabric when embroidering Tear away excess stabilizer after stitching URQ RQ WHDU DZD Iron on tear away is a totally stable stabilizer that h...

Page 28: ... while the OLJKW LV ÁDVKLQJ DV WKLV FDQ GDPDJH WKH ÀOHV RQ RXU 86 embroidery stick RPSOLPHQWDU VRIWZDUH 3 A PC software package is available for your PFAFF creative 3 0 sewing and embroidery machine It adds following features QuickFont program to create unlimited number of embroidery fonts from most TrueType and OpenType fonts on your computer Handling of embroidery designs viewing designs as thum...

Page 29: ...re to your USB embroidery stick Make sure that your machine is turned off Connect the USB embroidery stick loaded with the new software version to the USB port on your machine While pressing and holding the reverse button turn your machine on The update starts automatically and you can release the reverse button when the progress bar appears Note It might take up to one minute before the progress ...

Page 30: ......

Page 31: ...3 Machine settings buttons ...

Page 32: ... RX ZLOO DOVR ÀQG machine information in the settings menu Quick help Your machine has built in quick help which gives you instant information about everything you see on the touch screen Touch the quick help icon to activate quick help A question mark will appear on the PFAFF creative Color Touch Screen Touch any icon text or area on the touch area that you want information about A pop up gives a...

Page 33: ...ted in intervals until it is cancelled Lock screen If there is a possibility of bumping into the screen and changing the stitch embroidery or setting while sewing or embroidering it is easy to lock the screen When selected the screen will become locked ten seconds after the last touch The screen will be locked until you unlock it by touching OK Calibrate touch screen The touch screen can be calibr...

Page 34: ...d for every stitch selection that is not a straight stitch a pop up informs you that it is set to straight stitch Deselect stitch width safety to go back to normal sewing Note Twin needle and stitch width safety cannot be used at the same time Presser foot pressure In some cases you might need to adjust the presser foot pressure Specialty techniques or thick fabric may require an adjustment The hi...

Page 35: ...matic free motion foot 6A deactivate Dynamic spring foot 6D in the settings menu XW MXPS VWLWFKHV Your machine features the automatic function Cut jump stitches This function saves you time trimming after the embroidery is completed When Cut jump stitches is selected your machine will trim the top jump stitch thread and pull the thread end to the underside of the fabric as you embroider When desel...

Page 36: ... deselect the button Reverse button Reverse indicator Action indicator Start stop Presser foot up and extra lift toggle Thread snips Presser foot down and pivot toggle Stitch restart Immediate tie off Needle up down Speed control You can change the speed limit on your machine Long touch the speed control button to open a pop up Set desired speed limit using the slider then close the pop up The nex...

Page 37: ...edle thread only cuts automatically at WKH FRORU FKDQJH KHQ WKH GHVLJQ LV ÀQLVKHG ERWK QHHGOH and bobbin threads are cut automatically Reverse button For permanent reverse press the button once before starting to sew The reverse indicator will be lit and the machine sews in reverse until you press the button again to cancel If you press the reverse button while sewing the machine sews in reverse f...

Page 38: ...ll up down for more available options Long touch Some icons have increased functions marked with an arrow at the lower right corner To access these functions long touch the icon OK and Cancel 7KH 2 DQG FDQFHO LFRQV DUH XVHG WR FRQÀUP RXU settings and selections They are also used to close full screen windows To abort an actual process touch cancel To continue touch OK OK Cancel Long touch Scroll b...

Page 39: ...4 Sewing mode ...

Page 40: ...on a start up screen is shown and then the machine opens sewing mode If the embroidery unit is attached the machine automatically opens embroidery mode Sewing mode overview Save to personal menu Tie off options Sewing options Sequencing Free motion options Presser foot recommendation Speed control symbol Selected stitch number Stitch width Stitch positioning Thread tension Stitch length Stitch den...

Page 41: ... of stitches To view all categories touch stitch category icon For each category there are two or more subcategories For each subcategory a list of stitches is shown Selecting a font Text can be created with stitch fonts To load a stitch font open the selection menu Select stitch fonts from the selection bar Your machine contains four built in stitch fonts The number to the right of each font show...

Page 42: ...h control will not change its appearance This indicates that the selected stitch cannot toggle between the two stitch settings Note When trying to exceed minimum or maximum settings for the stitch controls a warning sound will be heard The default value is shown in white Stitch width Increase or decrease the stitch width using and The number above the control shows stitch width in mm Stitch positi...

Page 43: ...f the entire stitch Touch to decrease the density Touch to increase the density The number above the control shows the distance between satin stitches in mm Note This is often used with specialty threads and when a less dense satin stitch is desired Balance When sewing on special fabrics or doing a special technique the balance may need to be adjusted If a stitch can be balanced a long touch symbo...

Page 44: ...ad is visible on the top side of the fabric the needle thread tension is too tight Reduce the needle thread tension B If the needle thread is visible on the back side of the fabric the needle thread tension is too loose C Increase the needle thread tension For buttonholes and decorative stitches the needle thread should be visible on the underside of the fabric C Reduce the needle thread tension t...

Page 45: ... stitch is saved Any box with a stitch is an occupied position You can overwrite a previously stored stitch Simply touch the stitch to overwrite A pop up will DSSHDU WR FRQÀUP WKDW RX ZDQW WR RYHUZULWH WKH previously stored stitch Cancel the saving process by touching the cancel icon The saving window will close and you will return to the previous screen Delete a stitch I RX ZDQW WR GHOHWH RQH VWL...

Page 46: ...PLF VSULQJ IRRW IUHH PRWLRQ Activate to set the machine in Dynamic spring foot free motion mode for the Dynamic spring foot 6D optional accessory part number 820991 096 The Dynamic spring foot measures the fabric thickness and will raise and lower with each stitch to hold the fabric on the needle plate while the stitch is being formed Note The Dynamic spring foot 6D is recommended for use with str...

Page 47: ...itches can occur if your fabric moves up and down with the needle as you are stitching Lowering the presser foot height will reduce the space between the presser foot and the fabric and eliminate the skipped stitches To adjust the presser foot height in Sensormatic free motion mode long touch the check box and make adjustments in the pop up Note Be careful not to reduce the presser foot height too...

Page 48: ...ons selected 1 The tie off beginning will be performed as soon as you start to sew 2 Press the reverse button to perform tie off end The action indicator will be lit The machine will ÀQLVK WKH VWLWFK DQG GR D WLH RII When a thread snip is programmed the machine will automatically cut the threads after performing the tie off end The needle and presser foot will raise Note To activate reverse sewing...

Page 49: ...ing is activated at both the beginning and at the end and you start to sew the stitch width will start at 0mm It becomes wider until the selected stitch width is reached Sew your desired length and press the reverse button The width is reduced until the width is 0mm and the action indicator on the machine will be lit until the taper is ÀQLVKHG Single stitch program Activate the single stitch progr...

Page 50: ...ouching the icon Follow the instructions for tapering on the previous page When the reverse button is pressed the action indicator will be lit until the taper and last repetion RI WKH VWLWFK LV ÀQLVKHG The stitch is now programmed and the single stitch program is activated When you start to sew again the stitch will automatically be repeated with the same length Between the and icons the number of...

Page 51: ...ght stitch Note If the presser foot is attached on the right side of the presser foot bar the needle must only be moved to the left If the foot is attached on the left side of the presser foot bar the needle must only be moved to the right Sewing KHPV LQ KHDY IDEULF When sewing over seams in extra heavy fabric or a blue jeans hem the presser foot can tip as the machine climbs over the seam Use the...

Page 52: ...pproximately µ FP RI WKH ÀQLVKHG HGJH H WHQGV EH RQG the fold The wrong side of your project should now be facing up Place the fabric under the presser foot so that the fold runs along edge guide A When the needle swings into the fold it should catch a small amount of fabric If the stitches are visible on the right side adjust edge guide A by turning adjusting screw B until the stitch that catches...

Page 53: ...the fabric and stabilizer you will use Note Make sure that the IDT system is disengaged Attaching the Sensormatic buttonhole foot 1 Snap on the Sensormatic buttonhole foot 2 Plug the cord into the socket found to the left above the needle area behind the needle threader A Sensormatic buttonhole When you sew a buttonhole with the Sensormatic buttonhole foot adjust the slit length so that it is slig...

Page 54: ... function just deselect the icon The repeat function will also be cancelled if any adjustments are made Corded buttonhole Corded buttonholes that are sewn with gimp threads are more stable durable and have a professional appearance Use pearl cotton or a regular gimp thread 1 Place the center of a length of gimp thread over the metal bar extending from the center back of the Manual buttonhole foot ...

Page 55: ...create a thread shank for your button You can also use a sew on button foot available as an optional accessory at your local authorized PFAFF dealer Darning Darning a small hole or a tear before it becomes larger can save a garment Choose a lightweight thread in a color as close to your garment as possible 1 Place fabric or stabilizer in position under the hole or tear in your garment 2 Select a d...

Page 56: ...le plate Patchwork program The patchwork program makes it possible for you to program an exact seam length that can be sewn repeatedly This is very useful when quilting especially when piecing many quilt blocks of the same size See page 4 12 on how to use the patchwork program Piecing the quilt top Cut out the pieces of fabric for your quilt top with a seam allowance of 6mm Snap on the quilting fo...

Page 57: ...adjust the thread tension depending on which fabric thread and batting that is used Make a few tests on a scrap piece of the fabric you are going to sew and check the tension Stitch in the Ditch Stitch in the ditch is another option for joining the layers of your quilt Pin baste the layers as described above Snap on the Fancy stitch foot 1A with IDT system and engage IDT system Stitch in the seams...

Page 58: ...our quilt It is important to move the fabric at the same rate as the sewing speed to prevent stitches that are too long or too short Maintaining a consistent speed while free motion sewing will also help keep stitches even To get an even speed lower the sewing speed and press the foot control 4 Begin near the center of your quilt Take one stitch and pull the bobbin thread to the top of the quilt T...

Page 59: ...utomatically if the needle thread runs out or breaks Re thread the needle thread close the pop up and start sewing again Remove Sensormatic buttonhole foot The Sensormatic buttonhole foot needs to be removed before doing any of the following Sewing a stitch that is not a buttonhole Sewing a buttonhole that can not be sewn with the Sensormatic buttonhole foot Sewing an adjusted buttonhole saved wit...

Page 60: ......

Page 61: ...5 Sequencing ...

Page 62: ...rative stitches and stitch fonts from the machine or from an external device Stitches made in Stitch Creator can also be inserted in a sequence Sequencing overview Approximate length of sequence Stop command Tie off command Thread snip command Stitch width Stitch positioning OK close Sequence 6WLWFK ÀHOG Stitch length Stitch density Arrows move cursor back and forth in the sequence ...

Page 63: ...itches Touch a stitch in the selection area to add it to the sequence To get an overview of all stitch categories touch the stitch category icon Create sequence from letters Open the selection menu Touch stitch fonts to open a window with available stitch fonts Touch to load the desired stitch font into sequecing Touch font style icon to toggle between upper or lower case letters numbers or specia...

Page 64: ...ch simply select it and then touch delete and insert the new stitch It will be placed at the cursor position Sequence commands You can insert tie off stop and thread snip commands into the sequence These commands will be included in the sequence and will always be performed when sewing it Move the cursor to the position where you want to add a command Select it and an icon will be added LQWR WKH V...

Page 65: ...ching OK in the top right corner of the sequencing window Save the sequence by touching the save to personal menu icon You can scroll through the personal menus WR ÀQG D IUHH SRVLWLRQ XVLQJ WKH VFUROO DUURZV Q box without a stitch is a free position and can be used to save your new stitch Simply touch the position and your stitch is saved Any box with a stitch is an occupied position You can overw...

Page 66: ...ence will become one stitch When re opening sequencing it will not be possible to adjust any part of the former stitches in the sequence any more The entire sequence will be handled as one stitch Common sequencing pop ups Not an editable stitch Some stitches are not possible to insert into a sequence for example buttonholes Sequence out of range The stitch you are trying to add will make the seque...

Page 67: ...6 Stitch Creator feature ...

Page 68: ...H ZLGWK RI WKH VWLWFK ÀHOG LV PP DQG PD LPXP VWLWFK OHQJWK LV PP 7KH JULG DQG WKH YHUWLFDO FHQWHU line will help you to create your stitch Your stitch can be up to approximately 500mm 20 long and can be stored in your personal menu Stitch Creator feature overview 6WLWFK ÀHOG Select stitch point Delete Touch function Move Touch function Zoom Pan Wheel New stitch point Triple stitch Stitch point sid...

Page 69: ...new stitch point icon You can also add a built in stitch from the selection menu Select stitch points To select a stitch point just touch it on screen with your stylus or use the arrows in the select stitch point control If selecting more than one stitch point with the stylus the stitches between the two stitch points will automatically be selected as well marked with green color A and B in pictur...

Page 70: ...iple stitch icon and the selected stitch es will be tripled Note Only enabled if more than one stitch point is selected Mirroring side to side The selected stitch point s will be mirrored horizontally Mirroring end to end The selected stitch points will be mirrored vertically Note Only enabled if more than one stitch point is selected Delete selected stitch point If you want to delete a single sti...

Page 71: ...hen scale is 100 or less you can not pan sideways The distance between the grid lines equals 1mm on the fabric Use the arrows in the wheel to zoom in or RXW I RX RRP LQ RQ WKH VWLWFK ÀHOG WKLQQHU JULG lines will appear The distance between these lines equals 0 5mm If zooming out only the edge lines of WKH VWLWFK ÀHOG ZLOO EH YLVLEOH Position of the marked stitch point The number to the left above ...

Page 72: ...the stitch by touching the save to personal menu icon RX ZLOO ÀQG VDYHG VWLWFKHV LQ FDWHJRU SHUVRQDO menu Each subcategory in the personal menu has 10 positions to save your own stitches or sequences Choose the subcategory you want to save your stitch in All your previously saved stitches will be shown in the personal menu Common Stitch Creator feature pop ups Not an editable stitch Some stitches ...

Page 73: ...7 Embroidery mode preparations ...

Page 74: ...ick release J Retaining screw 5LEV IRU ÀWWLQJ WKH FOLSV L Center marks WWDFK WKH HPEURLGH IRRW When embroidering use the Embroidery Sensormatic free motion foot 6A See page 2 9 for instructions on how to change presser foot Note You can also use the optional Dynamic Spring Foot 6D part number 820991 096 when embroidering F G I J K H E D C L When removing the embroidery unit IURP WKH ER IRU WKH ÀUV...

Page 75: ...he machine is turned off turn it on 3 A pop up tells you to clear the embroidery area and remove the hoop for positioning Touch OK The machine will calibrate and the embroidery arm will move to the ready position This calibration will set your embroidery functions each time you slide on the embroidery unit Make sure not to calibrate the machine with the embroidery hoop attached as this can damage ...

Page 76: ...ow at the bottom edge If you can see the hoop size in the lower part of the inner hoop you have attached it correctly C 3XVK WKH LQQHU KRRS ÀUPO LQWR WKH RXWHU KRRS 4 Close the quick release Adjust the pressure of the outer hoop by turning the retaining screw B The fabric should be taut in the hoop for the best results Note When embroidering additional designs on the same fabric open the quick rel...

Page 77: ...d a design from an USB device RU IURP SHUVRQDO ÀOHV 7RXFK 86 GHYLFH RU SHUVRQDO ÀOHV WR ORFDWH RXU GHVLJQ DQG ORQJ touch the design to load it 3 The design is placed in the center of the hoop 4 Switch from Embroidery edit to Embroidery stitch out by touching the Embroidery stitch out icon on the option bar 5 When entering Embroidery stitch out mode a pop up will appear on the screen Thread the mac...

Page 78: ...the thread end Cut the thread and press start stop to continue embroidering 9 While you embroider you can touch color list to see all colors in the design The active color block is marked with a green frame A KHQ WKH ÀUVW FRORU LV FRPSOHWH RXU PDFKLQH stops Re thread with the recommended thread color that is displayed in the pop up and continue embroidering by pressing start stop Each color segmen...

Page 79: ...8 Embroidery mode edit ...

Page 80: ...o not need to have the embroidery unit connected to your PDFKLQH WR HGLW RXU GHVLJQV 7KH ORDGHG GHVLJQ V DUH VKRZQ LQ WKH HPEURLGHU ÀHOG PEURLGHU HGLW overview Save to SHUVRQDO ÀOHV Touch function Move Zoom options pan Select hoop Embroidery text editor Embroidery stitch out Currently selected design Total number of stitches Touch function Scale Touch function Rotate Wheel Wheel center PEURLGHU ÀH...

Page 81: ...oidery fonts To load an embroidery font open the selection menu Select embroidery fonts tab Use the scroll bar to browse through all built in embroidery fonts Your machine contains two built in embroidery fonts The number to the right of each font shows the font size A selected embroidery font opens in embroidery text editor Read more about embroidery text editor on page 8 7 Note Embroidery fonts ...

Page 82: ...re locked This is shown with the closed padlock in the wheel center icon To unlock just touch the padlock Height and width can now be changed individually If you move the stylus on the screen towards the center of the selected design s the size will decrease If you move the stylus from the center of the selected design s the size will increase Use the ZKHHO WR ÀQH WXQH ERYH WKH ZKHHO RX FDQ VHH WK...

Page 83: ...JQ LQ WKH HPEURLGHU ÀHOG WR GHVHOHFW WKH design 1RWH 7R HGLW D GHVLJQ LQ WKH HPEURLGHU ÀHOG WKH GHVLJQ needs to be active by being selected Move design into hoop This is used to move any design that is outside the hoop area into the hoop area The design will be placed as close to the previous position as possible Mirror a design To mirror a design horizontally touch the mirror side to side icon To...

Page 84: ... to Embroidery edit RRP RSWLRQV SDQ Touch the zoom options pan icon to open a foldout with zoom options Use the and icons WR RRP LQ RU RXW LQ WKH HPEURLGHU ÀHOG 7KH adjustments will be shown in percent Pan is always active when zoom options pan tab is active Zoom to box lets you decide how much and where to zoom in the embroidery area First select zoom to box The zoom to box icon will be surrounde...

Page 85: ...ackward Touch character style icon to select upper or lower case letters numbers and special symbols Touch OK to return to Embroidery edit and your text will be shown in the embroidery ÀHOG Add letter into a text Use the arrows to move the cursor to where you want to add a letter Touch the letter and it will be inserted at the cursor position Delete a letter To delete one letter place the cursor a...

Page 86: ...ery arm to move freely remove the hoop and then touch OK To abort the function touch Cancel PEURLGHU FRPELQDWLRQ LV WRR FRPSOH This pop up appears for one of the following reasons The design combination contains too many color blocks There are too many designs in the combination The design combination you are trying to make contains too many stitches Your design combination can have up to approxim...

Page 87: ...9 Embroidery mode stitch out ...

Page 88: ...trol This function enables you to easily reduce the embroidery speed Just touch the speed control button placed at the front of the machine to reduce the speed To return to maximum speed deselect the button You can change the speed limit on your machine Long touch the speed control button to get a pop up Set desired speed limit using the scroll then close the pop up Once you touch the speed contro...

Page 89: ...esigns are shown in a grey color and the machine does not stop for color block changes To deactivate monochrome embroidery touch the icon again 6WHS VWLWFK E VWLWFK Touch to step forward and to step backwards stitch by stitch Use the icon to move backwards a few steps if the needle thread breaks or runs out Touch and hold to move through the stitches quickly The crosshair will follow the stitches ...

Page 90: ...1RWH 7KH JUH ÀHOG WR WKH ULJKW RI HDFK LFRQ LV D WRXFK ÀHOG WR PDNH LW HDVLHU WR VHOHFW LQ WKH RSWLRQ EDU Basic precise positioning Basic precise positioning allows you to place a design on an exact spot on your fabric It is also used when you want to embroider a design next to a previously embroidered design Use zoom options pan to be sure that you are placing the design exactly where you want it...

Page 91: ...DUHD WR EH RRPHG RRP WR ER ZLOO WKHQ be deactivated Zoom to all will show all the designs in the embroidery combination as large as possible Zoom to hoop will adjust the view to show the selected hoop Hoop position Use the hoop position functions to move the hoop to different positions Current position When you want to return to the current stitch and start embroidering again where the embroidery ...

Page 92: ... Each listed color shows color order and number Use the scroll bar to see all of the colors in the list Touch a color block in WKH FRORU EORFN OLVW WR VHW WKH FXUUHQW VWLWFK WR WKH ÀUVW stitch in that color block Thread number is displayed for designs in VP3 and VIP format Thread manufacturer will be shown when using Quick help on a color block Example A 1 2 2296 means the second thread color in W...

Page 93: ...y Drag on the screen with the stylus or use the arrows on the wheel to move the hoop under the needle Continue to move until the needle is exactly above the point on the fabric that you want to match Check the position by lowering the needle with the hand wheel Use the arrows of the ZKHHO WR ÀQH WXQH LI QHFHVVDU The position of the needle indicates where the locking point is placed on the fabric D...

Page 94: ...he center of the embroidery E g when choosing the upper left corner icon the connecting point will be set at the upper left corner in the outer line of the design s After this you can continue and make your own adjustments on the connecting point Trace the GHVLJQ ÀHOG The corner icons can also be used to trace the design ÀHOG E WRXFKLQJ HDFK RI WKH IRXU FRUQHU LFRQV LQ WXUQ RX FDQ ÀQG WKH FHQWHU R...

Page 95: ...ayed in the pop up or change the hoop setting To change hoop settings return to Embroidery edit and touch select hoop icon Bobbin thread low move to bobbin position When the bobbin thread is running low a pop up message appears giving you an indication that the bobbin needs to be changed soon This gives you an opportunity to plan where to stop embroidering and change the bobbin It is possible to e...

Page 96: ...sory PFAFF Embroidery Cutwork Needle Kit P N 820 945 096 These designs are marked with a cutwork needle symbol in the creative 3 0 Embroidery Collection When the machine stops and this pop up message is shown insert the corresponding cutwork needle Touch OK and press the start stop button to resume embroidering Note These cutwork designs can also be stitched without the cutwork needles but that co...

Page 97: ... 3HUVRQDO ÀOHV ...

Page 98: ...st thumbnail view File formats RXU PDFKLQH FDQ ORDG WKH IROORZLQJ ÀOH IRUPDWV SHV DHV VP3 VIP HUS PEC PES PCS XXX SEW JEF EXP 10 and DST HPEURLGHU ÀOHV 9 HPEURLGHU IRQW ÀOHV 1RWH I WKH ÀOH W SH RU ÀOH YHUVLRQ LV QRW VXSSRUWHG E RXU PDFKLQH RU WKH ÀOH LV GDPDJHG LW LV VKRZQ LQ WKH VHOHFWLRQ DUHD DV DQ XQUHFRJQL HG ÀOH Available PHPRU In the built in memory you can store designs fonts DQG RWKHU ÀOHV...

Page 99: ...LO YLHZ LFRQ WR VKRZ WKH ÀOHV LQ D OLVW ZLWK PRUH VSDFH IRU WKH ÀOH QDPH FKDUDFWHUV RU HDFK ÀOH ÀOH QDPH DQG W SH ZLOO EH GLVSOD HG Touch the list thumbnail view icon again to toggle to thumbnail view Load a ÀOH 7R ORDG D ÀOH ORQJ WRXFK WKH GHVLUHG ÀOH 8VH WKH scroll bar to scroll down in the folder You can only RSHQ RQH ÀOH DW WKH WLPH Open a folder 7R RSHQ D IROGHU LQ SHUVRQDO ÀOHV ORQJ WRXFK WK...

Page 100: ...GHOHWLRQ I D IROGHU LV GHOHWHG DOO ÀOHV ZLWKLQ WKH IROGHU DUH GHOHWHG DV ZHOO 7R GHOHWH DOO ÀOHV DQG IROGHUV LQ WKH FXUUHQW IROGHU ORQJ touch the delete icon 5HQDPH D ÀOH RU IROGHU 6HOHFW WKH IROGHU RU ÀOH RX ZDQW WR UHQDPH WKHQ WRXFK the rename icon to open a pop up where you can change the name RPPRQ SHUVRQDO ÀOHV pop ups YDLODEOH PHPRU LV ORZ RXU PDFKLQH FDQ VWRUH ÀOHV LQ WKH EXLOW LQ PHPRU Whe...

Page 101: ...11 Maintenance ...

Page 102: ...the bobbin case after sewing several projects or any time you notice an accumulation of lint in the bobbin case area Remove the bobbin case holder A covering the front part of the bobbin case by lifting it up Remove the bobbin case B by lifting it up Clean with the brush Note Use caution when cleaning around the thread snips knife C Put the bobbin case and the bobbin case holder back in place Note...

Page 103: ...en and or Function Buttons do not respond to touch The sockets and function buttons on the machine can be sensitive to static electricity If the screen does not respond to touch turn the machine OFF and then ON again If the problem persists contact your authorized PFAFF dealer The machine skips stitches Did you insert the needle properly Change needle and insert correctly as described in chapter 2...

Page 104: ...Has sewing lint collected between the feed dogs Remove the needle plate and clean the feed dogs with a brush Fabric does not move Make sure that the feed dogs are not lowered and that the embroidery unit is not attached 7KUHDG ORRSV DUH IRUPLQJ RQ WKH XQGHUVLGH RI WKH HPEURLGHU GHVLJQ Has the embroidery built up too much to move freely under the presser foot Increase the presser foot height in the...

Page 105: ...in memory 10 2 Built in needle threader 1 8 2 5 Built in USB port 1 8 Buttonhole 4 15 Attaching the Sensormatic buttonhole foot 4 15 Corded buttonhole 4 16 Manual buttonhole 4 16 Repeat a manual buttonhole 4 16 Sensormatic buttonhole 4 15 Button ruler 1 8 Buttons and indicators 3 6 Action indicator 3 7 Immediate tie off 3 6 Needle up down 3 6 Presser foot down and pivot toggle 3 6 Presser foot up ...

Page 106: ... Dynamic spring foot 6D 3 5 4 8 Dynamic spring foot 6D free motion 4 8 E Edge guide 1 10 Elastic blindhem stitch 4 14 Embroidery arm 1 9 7 2 Embroidery bobbin thread 2 11 Embroidery collection 1 10 7 3 Embroidery edit 8 2 8 8 Embroidery edit pop ups 8 8 PEURLGHU IRQW ÀOH 10 2 Embroidery fonts bulit in 8 3 Embroidery foot 6A 1 11 7 2 Embroidery hoop connection assembly 1 9 7 2 Embroidery hoop overv...

Page 107: ...G IURP SHUVRQDO ÀOHV 86 GHYLFH 8 3 Loading and sewing a sequence 5 5 Locking point 9 4 9 7 Lock screen 3 3 Long touch 3 8 Lower feed dogs 2 9 Lower feed dogs recommendation 4 8 M Machine information 3 5 Machine needs to rest 4 21 9 10 Machine overview 1 8 Machine settings 3 3 Main switch 1 8 Maintenance 11 2 Manual buttonhole 4 16 Manual buttonhole foot 5M 1 11 Marked stitch point 6 3 Memory avail...

Page 108: ...4 Use thread color 7 5 Position hoop 9 4 9 7 Position of the marked stitch point 6 5 Power cord 1 10 Presser feet included 1 11 Presser foot 1 8 Presser foot bar 1 8 Presser foot change 2 9 Presser foot down and pivot toggle 1 8 3 6 Presser foot height 3 5 Presser foot height control 3 5 Presser foot holder 1 8 Presser foot pressure 3 4 Presser foot pressure control 3 4 Presser foot recommendation...

Page 109: ...n 3 5 10 2 Special sewing techniques 4 20 Speed control 1 8 3 6 4 6 9 2 Speed control symbol 4 2 9 2 Spool cap 1 9 1 10 2 4 Spool pin 1 9 Spool pins 2 4 Auxiliary spool pin 2 4 Horizontal position 2 4 Main spool pin 2 4 Vertical position 2 4 Spring foot free motion 4 8 Stabilizer recommended 4 2 Stabilizers 2 11 Standard presser foot with IDT system 0A 1 11 Start stop 1 8 3 6 3 7 Start view 4 2 St...

Page 110: ...HVLJQ ÀHOG 9 8 Transparent thread 2 11 Triple stitch 6 2 6 4 Troubleshooting 11 3 Twin needle 2 6 3 4 4 2 Twin needle stitch width safety 4 2 Twin needle width 3 4 U Universal needle 2 10 Unpacking 2 2 8QUHFRJQL HG ÀOH 10 2 Update your machine 2 13 USB device 4 3 7 5 8 3 10 2 10 3 USB embroidery stick 1 10 2 12 USB port 1 8 2 12 Connect to and remove from USB port 2 12 Using the USB embroidery sti...

Page 111: ...W VHZ with your thread on a scrap of your sewing fabric and bring it to your dealer A sewing sample will often give much better information than words You have purchased a modern updatable sewing and embroidery machine As we regularly release software updates it is possible that there may be some differences between the machine software and the software described in the owner s manual Consult your...

Page 112: ...www pfaff com 413 35 71 26D QJOLVK Q RXVH 6 1 X HPERXUJ 6 DU O OO ULJKWV UHVHUYHG 3ULQWHG LQ HUPDQ RQ HQYLURQPHQWDOO IULHQGO SDSHU ...

Reviews: