background image

12

5

Play

Play a disc

Caution

Do not place any objects other than discs into the disc 

‡

compartment.
Do not touch the disc optical lens inside the disc 

‡

compartment.

1

Press   to open the disc compartment.

2

Insert a disc with its label facing up.

3

Press   to close the disc compartment and 
start disc play.

To view disc play, turn on the TV to the 

‡

correct viewing channel for this product.
To stop disc play, press

‡

.

Note

&KHFNWKHW\SHVRIGLVFVVXSSRUWHGVHH´6SHFLÀFDWLRQVµ

‡

!´3OD\PHGLDµ

If the password entry menu is displayed, enter the 

‡

password before you can play the locked or restricted 

GLVFVHH´$GMXVWVHWWLQJVµ!´3UHIHUHQFH6HWXSµ!

[Parental Control]

If you pause or stop a disc, the screen saver appears after 

‡

10 minutes of inactivity. To deactivate the screen saver, 
press any button.
After you pause or stop a disc and no button is pressed 

‡

within 30 minutes, this product automatically switches 
to standby. 

Disc content structure

The structure of a disc content is generally divided 
as shown below.

>WLWOHFKDSWHU@WLWOHFKDSWHUUHIHUVWRWKH

‡

contents on a BD/DVD.

>WUDFN@WUDFNUHIHUVWRWKHFRQWHQWVRQDQ

‡

audio CD.

>IROGHUÀOH@IROGHUÀOHUHIHUVWRWKHFRQWHQWV

‡

on a disc in MP3/WMA/JPEG format.

BD-video, DVD-video

title 1

title 2

chapter 2

chapter 1

chapter 3

chapter 2

chapter 1

track 2

track 1

track 5

track 4

track 3

Audio CD

MP3, Windows Media™ Audio, JPEG

folder (group) 1

folder (group)

2

file 3

file 2

file 1

file 2

file 1

6

Once connected, an IP address is obtained 
automatically.

If no IP address is obtained, select 

‡

[Retry]

 and press 

OK

 to try to obtain 

the IP address again. 

7

Select 

[Finish]

 in the menu, then press 

OK

 to 

exit.

Note

This product does not support automatic detection of an 

‡

Ethernet crossover cable.
Loading BD-Live content from the internet may take 

‡

VRPHWLPHGHSHQGLQJRQWKHÀOHVL]HDQGWKHVSHHGRI

the internet connection.

Use Philips EasyLink

This product supports Philips EasyLink which uses the 

+'0,&(&&RQVXPHU(OHFWURQLFV&RQWUROSURWRFRO

You can use one single remote control to control 
EasyLink-compliant devices that are connected 
through HDMI connectors.

Note

To enable the EasyLink feature, you must turn on the 

‡

HDMI CEC operations on the TV and on other devices 
connected to TV. Refer to the TVs/devices manual for 
details.

One-touch play
1

Press the 

STANDBY

 button to turn on this 

product.

7KH79LIWKH79VXSSRUWVRQHWRXFKSOD\

»

automatically turns on and switches to the 
correct video-in channel.

If a disc is loaded in this product, disc play 

»

automatically starts.

One-touch standby
1

Press and hold the 

STANDBY

 button on the 

remote control for more than 3 seconds.

$OOWKHFRQQHFWHGGHYLFHVLIWKHGHYLFH

»

VXSSRUWVRQHWRXFKVWDQGE\DXWRPDWLFDOO\

switch to standby. 

Note

Philips does not guarantee 100% interoperability with all 

‡

HDMI CEC devices.

EN

Содержание BDP3000

Страница 1: ...www philips com welcome Register your product and get support at EN User manual BDP3000 ...

Страница 2: ...ontrol 10 Find the correct viewing channel 11 Use the Home menu 11 Navigate the menu 11 Select menu display language 11 Setup network 11 Use Philips EasyLink 12 5 Play 12 Play a disc 12 Play video 13 Play music 15 Play photo 16 6 Adjust settings 16 Video setup 16 Audio Setup 18 Preference Setup 18 EasyLink Setup 19 Advanced Setup 20 7 Additional Information 21 Update software 21 Care 21 6SHFLÀFDWL...

Страница 3: ...DXGLR tracks 1 Important Safety and important notice Warning 5LVN RI RYHUKHDWLQJ 1HYHU LQVWDOO WKH SURGXFW LQ D FRQÀQHG space Always leave a space of at least 4 inches around the product for ventilation Ensure curtains or other objects never cover the ventilation slots on the product Never place the product remote control or batteries near QDNHG ÁDPHV RU RWKHU KHDW VRXUFHV LQFOXGLQJ GLUHFW VXQOLJK...

Страница 4: ...LIVE and BONUSVIEW are trademarks of Blu ray Disc Association x v Colour is a trademark of Sony Corporation 2 Your product Congratulations on your purchase and welcome to 3KLOLSV 7R IXOO EHQHÀW IURP WKH VXSSRUW WKDW 3KLOLSV offers register your product at www philips com welcome Feature highlights Philips EasyLink Your product supports Philips EasyLink which uses WKH 0 RQVXPHU OHFWURQLFV RQWURO pr...

Страница 5: ...yed HOME Home menu is displayed CHAPTER Current chapter is in chapter repeat mode DOLBY D Dolby Digital audio is being played DOLBY HD Dolby HD audio is being played UPGRADE Software upgrade is in progress Product overview Main unit a Turn on this product or switch to standby mode b Disc compartment c Open or close the disc compartment d IR sensor Point the remote control at the IR sensor e Displa...

Страница 6: ... n AUDIO Select an audio language or channel on a disc o Alphanumeric buttons Select an item to play p Open or close the disc compartment q TV CH 6HOHFW D 79 FKDQQHO DSSOLFDEOH RQO WR FHUWDLQ 3KLOLSV EUDQG 79V r Stop play s Pause play Move the paused picture one step forward t Start or resume play u INFO Display the current status or the disc information Remote control a Turn on this product or sw...

Страница 7: ...t both WKLV SURGXFW DQG WKH GLVSOD GHYLFH RU DQ 9 UHFHLYHU DPSOLÀHU VXSSRUW D FRS ULJKW SURWHFWLRQ V VWHP FDOOHG 3 KLJK EDQGZLGWK GLJLWDO FRQWHQW SURWHFWLRQ V VWHP This type of connection provides best picture quality H DMII N v OPTIONS Access options for the current activity or selection w Color buttons BD Select tasks or options x HDMI Select the video resolution of HDMI output y REPEAT Select r...

Страница 8: ...from this product to other devices RQQHFW WR GLJLWDO DPSOLÀHU UHFHLYHU 1 RQQHFW D FRD LDO FDEOH QRW VXSSOLHG WR the COAXIAL jack on this product the COAXIAL DIGITAL input jack on the device AUDIO IN V IDE O IN COAXIAL Option 2 Connect to the component video jack 1 RQQHFW WKH FRPSRQHQW YLGHR FDEOHV QRW VXSSOLHG WR the Y Pb Pr jacks on this product the COMPONENT VIDEO input jacks on the TV 2 Connect...

Страница 9: ...llow the instructions in this chapter in sequence Prepare the remote control Caution Risk of explosion Keep batteries away from heat VXQVKLQH RU ÀUH 1HYHU GLVFDUG EDWWHULHV LQ ÀUH 1 Press and push the battery compartment to VOLGH LW RSHQ VHH µ LQ WKH LOOXVWUDWLRQ 2 Insert two AAA batteries with correct SRODULW DV LQGLFDWHG Connect analogue stereo system 1 Connect the audio cables to the AUDIO L R ...

Страница 10: ... to detect if there is a connection to the network If the connection test fails select Retry and press OK to re connect again to the network Video Setup Advanced Setup Audio Setup Preference Setup EasyLink Setup Menu Language Parental Control Screen Saver Display Panel Auto Standby VCD PBC Change Password 3 Push and slide back the battery compartment VHH µ LQ WKH LOOXVWUDWLRQ Note If you are not g...

Страница 11: ...rack 1 track 5 track 4 track 3 Audio CD MP3 Windows Media Audio JPEG folder group 1 folder group 2 file 3 file 2 file 1 file 2 file 1 6 Once connected an IP address is obtained automatically If no IP address is obtained select Retry and press OK to try to obtain the IP address again 7 Select Finish in the menu then press OK to exit Note This product does not support automatic detection of an Ether...

Страница 12: ...ed 2 Select Time Search in the menu then press OK 3 Press the Navigation buttons WR FKDQJH the time to skip to then press OK Play video Control video play 1 Play a title 2 Use the remote control to control the play Button Action Pause play Start or resume play Stop play Skip to a previous next title or chapter Search fast backward or fast forward Press repeatedly to change the search speed In paus...

Страница 13: ...window 2 Press OPTIONS The play options menu is displayed Zoom in out 1 During play press OPTIONS The play options menu is displayed 2 Select Zoom in the menu then press OK 3 Press the Navigation buttons WR VHOHFW D zoom factor then press OK 4 Press the Navigation buttons to pan through the zoomed picture To cancel zoom mode press BACK or OK to display the zoom factor bar then press the Navigation...

Страница 14: ...ess 4 Select the language to play then press OK Enjoy BD LIVE SSOLFDEOH RQO WR D GLVF WKDW HQDEOHV LYH ERQXV FRQWHQW GGLWLRQDO FRQWHQWV VXFK DV PRYLH WUDLOHUV VXEWLWOHV HWF FDQ EH GRZQORDGHG WR WKLV SURGXFW V local storage or a connected USB storage device Special video data may be played while they are being downloaded When the disc supporting BD Live is played this product or disc s ID can be se...

Страница 15: ... JPEG photos 2 Press select Play Disc then press OK A contents menu is displayed 3 Select a photo folder then press OK to enter To select a photo press the Navigation buttons To enlarge the selected photo and start slideshow press OK 4 Press OK to start slideshow play Note It may require longer time to display the disc content on the TV due to the large number of songs photos compiled onto one dis...

Страница 16: ...Soft color setting Action Sharp color setting It enhances the details in the dark area Ideal for action movies Animation Contrast color setting Ideal for animated pictures Black Level Improve black color contrast Normal Standard black level Enhanced Enhance black level 5 Select a setting then press OK To return to the previous menu press BACK To exit the menu press Audio Select an audio language f...

Страница 17: ...etup Advanced Setup Audio Setup Preference Setup EasyLink Setup Menu Language Parental Control Screen Saver Display Panel Auto Standby VCD PBC Change Password English Off Off Normal On On Audio Setup 1 Press 2 Select Settings then press OK 3 Select Audio Setup then press 4 Select an option then press OK 5 Select a setting then press OK To return to the previous menu press BACK To exit the menu pre...

Страница 18: ...ict access to discs that are unsuitable for children These types of discs must be recorded with ratings To access enter your last set password or 0000 Note Rated discs above the level you set in Parental Control require a password to be played The ratings are country dependent To allow all discs to play select 8 for DVD video and BD Video Some discs have ratings printed on them but are not recorde...

Страница 19: ...arental Control setting Advanced Setup 1 Press 2 Select Settings then press OK 3 Select Advanced Setup then press 4 Select an option then press OK 5 Select a setting then press OK To return to the previous menu press BACK To exit the menu press BD Live Security You can restrict internet access for BD Live bonus contents which are available to certain Blu ray discs On Internet access is prohibited ...

Страница 20: ...ct to FRPSDUH ZLWK WKH ODWHVW VRIWZDUH LI DYDLODEOH DW WKH Philips website 1 Press 2 Select Settings then press OK 3 Select Advanced Setup Version Info then press OK Update software via network 1 6HW XS WKH QHWZRUN FRQQHFWLRQ VHH HW VWDUWHG 6HW XS QHWZRUNµ 2 In the Home menu select Settings Advanced Setup Software Download Network You are prompted to start upgrading processs if upgrade media is de...

Страница 21: ...DPSOLÀHU UHFHLYHU Ensure that the audio cables are connected to the audio input of the audio device Turn on the audio device to its correct audio input source No sound on HDMI connection You may not hear any sound from the HDMI output if the connected device is non HDCP compliant or only DVI compatible HDMI output Sampling frequency MP3 32 kHz 44 1 kHz 48 kHz WMA 44 1 kHz 48 kHz Constant bit rate ...

Страница 22: ...r ensure that the network has been set up OHDU ORFDO VWRUDJH LQWHUQDO PHPRU LI DQ or USB Ensure that the BD disc supports BD Live feature 9 Glossary A Aspect ratio Aspect ratio refers to the length to height ratio of TV screens The ratio of a standard TV is 4 3 while WKH UDWLR RI D KLJK GHÀQLWLRQ RU ZLGH 79 LV The letter box allows you to enjoy a picture with a wider perspective on a standard 4 3 ...

Страница 23: ...QL HG E WKHLU ÀOH extension jpg or jpeg L LAN Local Area Network A group of linked devices in a company school or home Indicates the boundaries of a particular network Local storage This storage area is used as destination for storing additional contents from BD Live enabled BD Video M MP3 ÀOH IRUPDW ZLWK D VRXQG GDWD FRPSUHVVLRQ system MP3 is the abbreviation of Motion Picture SHUWV URXS RU 03 XG...

Страница 24: ...reeTypeTeam See http freetype sourceforge net and in particular http freetype sourceforge net FTL TXT Portions of the relevant license conditions are copied below The FreeType Project LICENSE 2006 Jan 27 Copyright 1996 2002 2006 by DavidTurner Robert Wilhelm and Werner Lemberg 1 No Warranty THE FREETYPE PROJECT IS PROVIDED AS IS WITHOUT WARRANTY OF ANY KIND EITHER EXPRESS OR IMPLIED INCLUDING BUT ...

Страница 25: ...UHVHUYHG 5HGLVWULEXWLRQ DQG XVH LQ VRXUFH DQG ELQDU IRUPV ZLWK RU ZLWKRXW PRGLÀFDWLRQ DUH SHUPLWWHG SURYLGHG WKDW the following conditions are met 1 Redistributions of source code must retain the above copyright notice this list of conditions and the following disclaimer 2 Redistributions in binary form must reproduce the above copyright notice this list of conditions and the following disclaimer ...

Страница 26: ...ight notice this list of conditions and the following disclaimer 2 Redistributions in binary form must reproduce the above copyright notice this list of conditions and the following disclaimer in the documentation and or other materials provided with the distribution 3 All advertising materials mentioning features or use of this software must display the following DFNQRZOHGJHPHQW 7KLV SURGXFW LQFO...

Страница 27: ...ly set forth herein you may not copy the Software without prior ZULWWHQ DXWKRUL DWLRQ RI 3KLOLSV H FHSW WKDW RX PD PDNH RQH FRS RI WKH 6RIWZDUH IRU RXU EDFN XS purposes only You may not copy any printed materials accompanying the Software nor print more than RQH FRS RI DQ XVHU GRFXPHQWDWLRQ SURYLGHG LQ HOHFWURQLF IRUP H FHSW WKDW RX PD PDNH RQH copy of such printed materials for your back up purpo...

Страница 28: ...ying the Device This Agreement does not apply to this software DV VXFK E RXU OLFHQVH ULJKWV XQGHU WKLV JUHHPHQW GR QRW LQFOXGH DQ ULJKW RU OLFHQVH WR XVH GLVWULEXWH or create derivative works of the Software in any manner that would subject the Software to Open 6RXUFH 7HUPV 2SHQ 6RXUFH 7HUPVµ PHDQV WKH WHUPV RI DQ OLFHQVH WKDW GLUHFWO RU LQGLUHFWO FUHDWH or purport to create obligations for Philip...

Страница 29: ...RISING OUT OF THIS AGREEMENT EXCEED THE GREATER OF THE PRICE ACTUALLY PAID BY YOU FOR THE SOFTWARE OR FIVE POUNDS 67 5 1 12 Trademarks Certain of the product and Philips names used in this Agreement the Software and the printed user documentation may constitute trademarks of the Philips its licensors or other third parties You are not authorized to use any such trademarks 13 Export Administration ...

Страница 30: ...31 ...

Страница 31: ...32 ...

Страница 32: ...33 ...

Страница 33: ...34 ...

Страница 34: ...35 ...

Страница 35: ...36 ...

Страница 36: ......

Страница 37: ... 2009 Koninklijke Philips Electronics N V All rights reserved BDP3000_55_UM_V4 0_1008 ...

Отзывы: