Pfaff performance 5.0 Скачать руководство пользователя страница 38

4:2

Sewing mode

6HZLQJPRGH

In sewing mode you can select stitches, adjust and sew them. The selected stitch is shown in actual size in 

WKHVWLWFKÀHOG5HFRPPHQGDWLRQVDQGPDFKLQHVHWWLQJVDUHVKRZQDWWKHWRSRIWKHWRXFKVFUHHQ

Every mode in the PFAFF

®

 

creative

 Color Touch Screen has its own color scheme, to make it easier to 

navigate and use the machine.

Start view

When your machine is turned on, a start-up screen is shown and then the machine opens sewing mode. 

6HZLQJPRGHRYHUYLHZ

Save to 

personal menu

Tie-off options

Sewing options

Sequencing

Free-motion options

Presser foot recommendation

Speed control 

symbol

Selected stitch number

Stitch width/ 

Stitch positioning

Thread tension

Stitch length/ 

Stitch density

IDT

 system recommended

Twin needle/stitch width safety activated

Stabilizer recommended

Note: All symbols and options will not be shown at the same time.

Stitch Creator

 

feature

Содержание performance 5.0

Страница 1: ...Owner s manual performance 5 0...

Страница 2: ...te the sewing machine with any air openings blocked Keep ventilation openings of the sewing machine and foot control free from the accumulation of lint dust and loose cloth HHS QJHUV DZD IURP DOO PRYL...

Страница 3: ...erience and knowledge unless they have been given supervision or instruction concerning use of the sewing machine by a person responsible for their safety Children should be supervised to ensure that...

Страница 4: ...you to transform all your creative ideas into reality using the most highly tuned technology and features Before you start please spend some time reading this owner s manual You will soon discover ho...

Страница 5: ...1 Stabilizers 2 11 USB port 2 12 How to update your machine 2 12 Machine settings buttons 3 1 Touch screen 3 2 Touch area overview 3 2 Settings menu 3 3 Machine settings 3 3 Sewing settings 3 4 Machin...

Страница 6: ...sequence 5 5 Important sequencing information 5 6 Common sequencing pop ups 5 6 Stitch Creator feature 6 1 Stitch Creator feature 6 2 Stitch Creator feature overview 6 2 Open and exit Stitch Creator...

Страница 7: ...Introduction 1...

Страница 8: ...tra lift toggle 14 Immediate tie off 15 Stitch restart 16 Speed control 17 Needle up down 18 PFAFF creative Color Touch Screen 19 Button ruler 20 Handwheel 21 Built in USB port 22 Stylus holder 23 Mai...

Страница 9: ...r 40 Bobbin winder spindle 41 Auxiliary spool pin 42 Spool caps 43 Spool pin 44 Thread tension disk 45 Take up lever FFHVVRU WUD The accessory tray features special compartments for presser feet and b...

Страница 10: ...crewdriver 54 Seam ripper 55 Brush 56 Spool cap large 2 57 Spool cap medium 58 Spool cap small 59 Multi purpose tool 60 Bobbins 5 61 Knee lift 62 Straight stitch needle plate Included accessories not...

Страница 11: ...eft of the needle making it easy to sew close to both sides of the zipper teeth Move needle position to right or left to sew closer to zipper teeth 5A 6HQVRUPDWLF EXWWRQKROH IRRW When connected to the...

Страница 12: ...ets 1 1 8 Stretch triple zigzag stitch Elastic stitch for decorative hems or topstitching 1 1 9 Three step zigzag stitch Sewing elastic darning patching and decorative sewing 1 1 10 Elastic stitch Sew...

Страница 13: ...Mock cover hem Create the look of a serger cover hem for stretch fabrics 1 2 12 Open overlock blindhem Create decorative overlock blindhem for woven fabrics 1 2 13 Closed overlock blindhem Create dec...

Страница 14: ...ng holes or damaged fabric 1 4 4 Programmable reinforced darning stitch Reinforced darning holes or damaged fabric 1 4 5 Bartack Automatically reinforce seams and pockets 1 4 6 Denim bartack Automatic...

Страница 15: ...stitches Satin and edge stitches 3 4 Needle art stitches Smocking stitches 4 1 Decorative stitches Satin and edge stitches 4 2 Decorative stitches Floral and ornamental stitches 4 3 Decorative stitch...

Страница 16: ...l and fun stitches Comic Cyrillic Outline Script Alphabets 5 3 Maxi stitches Stippling stitches 5 4 Maxi stitches Maxi Monogram 6 1 Sewing techniques Optional feet stitches 6 2 Sewing techniques Handl...

Страница 17: ...Preparations 2...

Страница 18: ...UVH WKH SOXJ I LW VWLOO GRHV QRW W FRQWDFW D TXDOL HG HOHFWULFLDQ WR install the proper outlet Do not modify the plug in any way RQQHFWLQJ WKH IRRW FRQWURO FRUG PRQJ WKH DFFHVVRULHV RX ZLOO QG WKH IRR...

Страница 19: ...rea and eliminates shadows UHH DUP To use the free arm slide off the accessory tray When attached a hook keeps the accessory tray locked to the machine Remove the tray by sliding it to the left Thread...

Страница 20: ...cap slightly larger than the thread spool For narrow thread spools use a smaller spool cap in front of the spool For large thread spools use a larger spool cap in front of the spool 7KH DW VLGH RI WKH...

Страница 21: ...down in the left hand threading slot to the needle thread guide E 5 Thread the needle Needle threader The needle threader allows you to thread the needle automatically The needle must be in the up po...

Страница 22: ...to the right sides of the tension disk F 4 Bring the threads from the right into the take up lever D and down in the left hand threading slot Make sure that one thread is inside the needle thread guid...

Страница 23: ...e outside 5 Push the bobbin winder spindle to the right to wind A pop up appears on the screen to inform you that bobbin winding is active To adjust winding speed use the slider in the pop up Start bo...

Страница 24: ...rformance 5 0 sewing machine provides the ideal solution the integrated dual feed IDT system As on industrial machines the IDT system feeds the fabric from the top and bottom at the same time The mate...

Страница 25: ...multi purpose tool to hold the needle 2 Loosen the needle screw 3 Remove the needle 4 Insert the new needle using the multi purpose WRRO 3XVK WKH QHZ QHHGOH XSZDUGV ZLWK WKH DW side away from you unti...

Страница 26: ...U QHHGOH Embroidery needles have a special scarf a slightly rounded point and a slightly larger eye to avoid damage to thread and materials Use with metallic and other specialty threads for embroidery...

Страница 27: ...e used with stable woven fabrics Place underneath fabric for decorative stitching or hoop with the fabric when embroidering Tear away excess stabilizer after stitching URQ RQ WHDU DZD Iron on tear awa...

Страница 28: ...UXFWLRQV Go to the PFAFF web site at www pfaff com and QG RXU VHZLQJ PDFKLQH HUH RX ZLOO QG updates available for your machine Download and unzip the update software to an USB stick Make sure that you...

Страница 29: ...Machine settings buttons 3...

Страница 30: ...tings DQG VHZLQJ VHWWLQJV RX ZLOO DOVR QG PDFKLQH information in the settings menu Quick help Your machine has built in quick help which gives you instant information about everything you see on the t...

Страница 31: ...s is repeated in intervals until it is cancelled Lock screen If there is a possibility of bumping into the screen and changing the stitch or setting while sewing it is easy to lock the screen When sel...

Страница 32: ...selection that is not a straight stitch a pop up informs you that it is set to straight stitch Deselect stitch width safety to go back to normal sewing Note Twin needle and stitch width safety cannot...

Страница 33: ...cribed below Scroll bar Touch and drag the scroll bar to scroll up down for more available options RQJ WRXFK Some icons have increased functions marked with an arrow at the lower right corner To acces...

Страница 34: ...cator Action indicator Start stop Presser foot up and extra lift toggle Thread snips Presser foot down and pivot toggle Stitch restart Immediate tie off Needle up down Speed control You can change the...

Страница 35: ...ancelled in the settings menu Reverse button For permanent reverse press the button once before starting to sew The reverse indicator will be lit and the machine sews in reverse until you press the bu...

Страница 36: ......

Страница 37: ...Sewing mode 4...

Страница 38: ...machine Start view When your machine is turned on a start up screen is shown and then the machine opens sewing mode 6HZLQJ PRGH RYHUYLHZ Save to personal menu Tie off options Sewing options Sequencin...

Страница 39: ...arrows to scroll in the list of stitches To view all categories touch stitch category icon For each category there are two or more subcategories For each subcategory a list of stitches is shown 6HOHF...

Страница 40: ...ontrol will not change its appearance This indicates that the selected stitch cannot toggle between the two stitch settings Note When trying to exceed minimum or maximum settings for the stitch contro...

Страница 41: ...ncrease the density The number above the control shows the distance between satin stitches in mm Note This is often used with specialty threads and when a less dense satin stitch is desired Balance Wh...

Страница 42: ...d is visible on the top side of the fabric the needle thread tension is too tight Reduce the needle thread tension B If the needle thread is visible on the back side of the fabric the needle thread te...

Страница 43: ...stitch is saved Any box with a stitch is an occupied position You can overwrite a previously stored stitch Simply touch the stitch to overwrite A pop up will DSSHDU WR FRQ UP WKDW RX ZDQW WR RYHUZULWH...

Страница 44: ...achine in Dynamic spring foot free motion mode for the Dynamic spring foot 6D optional accessory part number 820991 096 The Dynamic spring foot measures the fabric thickness and will raise and lower w...

Страница 45: ...ches can occur if your fabric moves up and down with the needle as you are stitching Lowering the presser foot height will reduce the space between the presser foot and the fabric and eliminate the sk...

Страница 46: ...he tie off beginning will be performed as soon as you start to sew 2 Press the reverse button to perform tie off end The action indicator will be lit The machine will QLVK WKH VWLWFK DQG GR D WLH RII...

Страница 47: ...ing is activated at both the beginning and at the end and you start to sew the stitch width will start at 0mm It becomes wider until the selected stitch width is reached Sew your desired length and pr...

Страница 48: ...ching the icon Follow the instructions for tapering on the previous page When the reverse button is pressed the action indicator will be lit until the taper and last repetion RI WKH VWLWFK LV QLVKHG T...

Страница 49: ...ht stitch Note If the presser foot is attached on the right side of the presser foot bar the needle must only be moved to the left If the foot is attached on the left side of the presser foot bar the...

Страница 50: ...approximately FP RI WKH QLVKHG HGJH H WHQGV EH RQG the fold The wrong side of your project should now be facing up Place the fabric under the presser foot so that the fold runs along edge guide A When...

Страница 51: ...he fabric and stabilizer you will use Note Make sure that the IDT system is disengaged WWDFKLQJ WKH 6HQVRUPDWLF EXWWRQKROH IRRW 1 Snap on the Sensormatic buttonhole foot 2 Plug the cord into the socke...

Страница 52: ...buttonhole manually To cancel the function just deselect the icon Corded buttonhole Corded buttonholes that are sewn with gimp threads are more stable durable and have a professional appearance Use p...

Страница 53: ...l to create a thread shank for your button You can also use a sew on button foot available as an optional accessory at your local authorized PFAFF dealer DUQLQJ Darning a small hole or a tear before i...

Страница 54: ...o program an exact seam length that can be sewn repeatedly This is very useful when quilting especially when piecing many quilt blocks of the same size See page 4 12 on how to use the patchwork progra...

Страница 55: ...o adjust the thread tension depending on which fabric thread and batting that is used Make a few tests on a scrap piece of the fabric you are going to sew and check the tension Stitch in the Ditch Sti...

Страница 56: ...speed to prevent stitches that are too long or too short Maintaining a consistent speed while free motion sewing will also help keep stitches even To get an even speed lower the sewing speed and press...

Страница 57: ...with a full one touch OK in the pop up 5HPRYH 6HQVRUPDWLF EXWWRQKROH IRRW The Sensormatic buttonhole foot needs to be removed before doing any of the following Sewing a stitch that is not a buttonhol...

Страница 58: ......

Страница 59: ...Sequencing 5...

Страница 60: ...ative stitches and stitch fonts from the machine or from an external device Stitches made in Stitch Creator can also be inserted in a sequence 6HTXHQFLQJ overview Approximate length of sequence Stop c...

Страница 61: ...n the selection area to add it to the sequence To get an overview of all stitch categories touch the stitch category icon UHDWH VHTXHQFH IURP OHWWHUV Open the selection menu Touch stitch fonts to open...

Страница 62: ...etter To replace a stitch simply select it and then touch delete and insert the new stitch It will be placed at the cursor position 6HTXHQFH FRPPDQGV You can insert tie off stop and thread snip comman...

Страница 63: ...hing OK in the top right corner of the sequencing window Save the sequence by touching the save to personal menu icon You can scroll through the personal PHQXV WR QG D IUHH SRVLWLRQ XVLQJ WKH VFUROO a...

Страница 64: ...nce will become one stitch When re opening sequencing it will not be possible to adjust any part of the former stitches in the sequence any more The entire sequence will be handled as one stitch RPPRQ...

Страница 65: ...Stitch Creator feature 6...

Страница 66: ...H ZLGWK RI WKH VWLWFK HOG LV PP DQG PD LPXP VWLWFK OHQJWK LV PP 7KH JULG DQG WKH YHUWLFDO FHQWHU line will help you to create your stitch Your stitch can be up to approximately 500mm 20 long and can b...

Страница 67: ...titch point icon You can also add a built in stitch from the selection menu Select stitch points To select a stitch point just touch it on screen with your stylus or use the arrows in the select stitc...

Страница 68: ...nt The two stitch points will create a new stitch Triple stitch Touch the triple stitch icon and the selected stitch es will be tripled Note Only enabled if more than one stitch point is selected 0LUU...

Страница 69: ...hen scale is 100 or less you can not pan sideways The distance between the grid lines equals 1mm on the fabric Use the arrows in the wheel to zoom in or RXW I RX RRP LQ RQ WKH VWLWFK HOG WKLQQHU JULG...

Страница 70: ...by touching the save to personal menu icon RX ZLOO QG VDYHG VWLWFKHV LQ FDWHJRU SHUVRQDO menu Each subcategory in the personal menu has 10 positions to save your own stitches or sequences Choose the...

Страница 71: ...3HUVRQDO OHV 7...

Страница 72: ...RYHUYLHZ Move up one folder level Create new folder USB device only enabled when a device is connected Cut Copy Paste 5HQDPH OH RU IROGHU 3HUVRQDO OHV List thumbnail view Available PHPRU In the built...

Страница 73: ...YLHZ 7RXFK WKH OLVW WKXPEQDLO YLHZ LFRQ WR VKRZ WKH OHV LQ D OLVW ZLWK PRUH VSDFH IRU WKH OH QDPH FKDUDFWHUV RU HDFK OH OH QDPH DQG W SH ZLOO EH GLVSOD HG Touch the list thumbnail view icon again to t...

Страница 74: ...I D IROGHU LV GHOHWHG DOO OHV ZLWKLQ WKH IROGHU DUH GHOHWHG DV ZHOO 7R GHOHWH DOO OHV DQG IROGHUV LQ WKH FXUUHQW IROGHU ORQJ touch the delete icon 5HQDPH D OH RU IROGHU 6HOHFW WKH IROGHU RU OH RX ZDQ...

Страница 75: ...Maintenance 8...

Страница 76: ...ush found with the accessories OHDQLQJ XQGHU WKH EREELQ DUHD Clean the area under the bobbin case after sewing several projects or any time you notice an accumulation of lint in the bobbin case area R...

Страница 77: ...ets and function buttons on the machine can be sensitive to static electricity If the screen does not respond to touch turn the machine OFF and then ON again If the problem persists contact your autho...

Страница 78: ...hread Is the bobbin thread evenly wound Check bobbin winding See chapter 2 Is a correct needle used Insert a proper needle correctly as described in chapter 2 7KH PDFKLQH GRHV QRW IHHG RU IHHGV LUUHJX...

Страница 79: ...ler 1 8 Buttons and indicators 3 6 Button sewing 4 17 C Calibrate touch screen 3 3 Cancel 3 5 Carrying case 2 2 Changing the presser foot 2 9 Attach presser foot 2 9 Remove presser foot 2 9 Check need...

Страница 80: ...8 3 6 Included accessories 1 10 Insert a new stitch point 6 4 Insert a stitch or letter 5 4 Inserting the bobbin 2 8 Iron on Tear Away 2 11 K Knee lift 1 10 2 3 L Language 3 3 LED lights 1 8 2 3 Licen...

Страница 81: ...program 4 18 Piecing the quilt top 4 18 Straight stitch needle plate 4 18 R Removable bobbin holder 1 9 Removable tray for presser feet 1 9 Remove presser foot 2 9 Remove Sensormatic buttonhole foot...

Страница 82: ...Stitch repetition 4 17 Stitch restart 1 8 3 6 Stitch select 4 3 Stitch settings 4 4 Stitch width 4 2 4 4 5 2 5 4 Stitch width safety 3 4 4 2 4 8 Stop command 5 4 Straight stitch needle plate 1 10 4 18...

Страница 83: ...nderneath the Sewing Machine PFAFF PERFORMANCE STITCH CREATOR PERFECTION STARTS HERE and IDT image are trademarks of KSIN Luxembourg II S ar l CE Authorised Representative VSM Group AB SVP Worldwide D...

Страница 84: ...www pfaff com 413 35 73 26D English InHouse 2014 KSIN Luxembourg II S ar l All rights reserved Printed in Germany on environmentally friendly paper...

Отзывы: