Makita EK7301 Скачать руководство пользователя | Manualshive

Страница: 32 / 68

background image

32

Extract from the spare parts list

Use only original MAKITA parts. For repairs and

replacement of other parts, see your MAKITA service center.

EK7300, 7301

32

31

29 30

22

28

*

«
...
30
31
32
33
34
...
»

Содержание EK7301

Страница 1: ...KITA 2 STROKE ENGINES WILL VOID YOUR ENGINE WARRANTY ATTENTION Suivez toujours les conseils de sécurité du présent manuel d emploi et de sécurité Une utilisation incorrecte de la tronçonneuse peut entraîner des blessures graves Lisez et comprenez ce manuel Conservez avec soin ce manuel ATTENTION LES CARBURANTS CONTENANT PLUS DE 10 D ÉTHANOL NE SONT PASAUTORISÉS POUR L UTILISATION DANS LES MOTEURS ...

Страница 2: ... Any non authorized replacement part or malfunction of authorized parts due to use of non authorized parts OWNER S WARRANTY RESPONSIBILITIES As the engine owner you are responsible for the performance of the required maintenance listed in your operator s manual MAKITA recommends that you retain all receipts covering maintenance on your engine but MAKITA cannot deny warranty solely for the lack of ...

Страница 3: ...atulations on choosing a MAKITA Power Cut cutoff saw We are confident that you will be satisfied with this modern piece of equipment Like our chain saws the MAKITA Power Cuts feature specially designed high performance engines with outstanding power to weight ratios for heavy duty yet lightweight tools Other advantages of the MAKITA Power Cuts Sturdy construction and high reliability Maintenance f...

Страница 4: ...er use carbide tipped circular saw blades or any kind of wood cutting blades Combination Choke Start Stop I O switch Starting procedure Press decompression valve Engine manual start Stop engine Warning Kickback Fuel and oil mixture First aid Recycling Do not touch hot surfaces Read operator s and safety manual and follow the warning and safety precautions Particular care and caution Forbidden Wear...

Страница 5: ... the influence of alcohol drugs medica tion or other substances which may impair vision dexterity or judgement A fire extinguisher must be available in the immediate vicinity when working in easily inflammable vegetation or when it has not rained for a long time danger of fire Asbestos and other materials that can release toxins may be cut only with the necessary safety precautions and after notif...

Страница 6: ...sparks Fuel cannot be stored for an unlimited period of time Buy only as much as will be consumed in the near future When making up the gasoline oil mixture always put the oil in the mixing container first and then the gasoline Use only approved and marked containers for the transport and storage of fuel Keep fuel away from children Putting into operation Do not work on your own There must be some...

Страница 7: ...describedinthisoperator s manual 13 Alwaysplaceyourleftfootintherearhandleandgrasp the other handle firmly with thumb and fingers Other starting methods are not allowed WhenstartingthePowerCutitmustbewellsupportedandsecurely held The cutting disc must not be touching anything If the cutting disc is new test it by running it at least 60 seconds at topspeed Whendoingthis makesurethatnopersonsorbodyp...

Страница 8: ... Power Cut unattended Use the Power Cut at high speed as far as possible see Tech nical Data Only use the Power Cut during good light and visibility periods Be aware of slippery or wet areas and of ice and snow risk of slipping Never work on unstable surfaces Make sure that there are no obstacles in the working area risk of stumbling Always ensure that you have a safe footing Never cut above your ...

Страница 9: ... Instead always cut shallow around the whole piece Worn discs have a smaller diameter than new discs so that at the same engine speed they have a lower effective circumfer ential speed and therefore do not cut as well Cut I beams and L bars in steps see Figure 21 Cut bands and plates like pipes along the wide side with a long cut Whencuttingmaterialunderstress supportedmaterialormate rial in struc...

Страница 10: ...it with the engine on or the disc moving Carry the unit only by the tubular middle handle with the cut ting disc pointing behind you 26 Avoid touching the exhaust muffler burn hazard When moving the Power Cut over longer distances use a wheelbarrow or wagon When transporting the Power Cut in a vehicle make sure it is securely positioned in such a way that no fuel can leak out Always remove the cut...

Страница 11: ...KITA spares accessories or cutting discs increases the risk of accident We cannot accept any respon sibility for accidents or damage occurring in association with the use of cutting discs or accessories other than original MAKITA First aid For the event of a possible accident please make sure that a firstaidkitisalwaysimmediatelyavailablecloseby Immediately replace any items used from the first ai...

Страница 12: ... WJ 126 Ignition system with speed limitation Type electronic Spark plug Type NGK BPMR 7A BOSCH WSR 6F CHAMPION RCJ 6Y Electrode gap in mm 020 0 5 020 0 5 Fuel consumption at max load per ISO 8893 kg h 1 7 1 7 Specific consumption at max load per ISO 8893 g kWh 450 450 Fuel tank capacity fl oz l 37 1 1 37 1 1 Mixture ratio fuel two stroke oil when using MAKITA Synthetic oil 50 1 50 1 when using ot...

Страница 13: ...tank with handle 14 Decompression valve 15 Starter grip 16 Air intake 17 Combination switch Choke Start Stop I O 18 Safety locking button 19 Throttle lever 20 Tank cap fuel 21 Starter housing with starter 22 Cutting disc 23 Disc bolt 24 Spring washer 25 Hold opening Serial number Year of manufacture Identification plate 12 Indicate when ordering spare parts 1 2 3 4 5 6 7 8 25 9 10 12 11 13 14 24 2...

Страница 14: ...cutting disc is installed so it turns in the right direction if a direction is marked on the disc Putting into operation CAUTION Always turn off the engine and pull off the spark plug cap before doing any work on the Power Cut Always wear protective gloves CAUTION Start the Power Cut only after complete assembly and inspection Sequence For the the following work use the assembly tools included wit...

Страница 15: ...h off the engine and disconnect the spark plug cap NOTE When using a protective hood for a maximum disk diam eter of 300 mm 12 always shorten hose 15 to 180 mm 7 To do this unscrew sleeve 16 and carefully pull tube 15 off coupling 17 and cut to 180 mm Then push the tube end back over the coupling and tighten the sleeve all the way Install the water connection as shown in figure Push clamp 22 aroun...

Страница 16: ...n use fuel with a higher octane value This will not affect the engine In order to obtain an optimum engine output and to protect your health and the environment use unleaded fuel only To lubricate the engine use a synthetic oil for two stroke air cooled engines quality grade JASO FC or ISO L EGD which has to be added to the fuel Gasoline 50 1 The correct mixture ratio 50 1 WhenusingMAKITAsynthetic...

Страница 17: ...roke engine oil 50 1 is available in the following sizes to suit your individual requirements 2 6 floz order number T 00745 6 4 floz order number T 00739 NOTE For preparing the fuel oil mixture first mix the entire oil quantity with half of the fuel required then add the remaining fuel Shake the finished mixture thoroughly before pouring it into the tank Caution Open the tank cap carefully as pres...

Страница 18: ...ON Observe the SAFETY INSTRUCTIONS on page 5 and 6 Start the Power Cut only after complete assembly and inspection Move at least 3m 10 feet away from the place where you fuelled the Power Cut Make sure you have a good footing and place the Power Cut on the ground in such a way that the cutting disc is not touching anything 3 meters Move the protective hood 3 into the proper position for the work y...

Страница 19: ...hrottle lock NOTE If the Power Cut is mounted on the trolley do not operate the gas lever throttle on the side of the trolley Pull the starter cable out slowly until you feel resistance piston is now just before top dead center Press in the decompression valve 5 Pull starter cable quickly and firmly until you hear the first ignition but to a max of 3 5 pulls Important Do not pull the starter cable...

Страница 20: ...or the two screws are sealed shut For correct adjustment of the idling speed the following steps must be carried out Start the engine and run it until it is warm about 3 5 minutes Adjust the carburetor with the screwdriver 1 Order No 944 340 001 included with the Power Cut It has a lug that helps with adjustment Readjust the idling speed If the cut off disc is still turning when the engine is runn...

Страница 21: ... by a MAKITA service center before being used again SERVICE Unscrew the screws 8 and remove the crankcase housing cover 9 Remove the old belt 10 or belt pieces NOTE The illustration shows the V belt for models EK7300 7301 Clean out the inside of the drive arm with a brush Put in a new V belt NOTE Reassemble the crankcase housing cover 9 side piece 6 and cover 4 in the reverse order To tighten the ...

Страница 22: ...ed parts NOTE To install the cutting wheel see Mounting the cutting wheel Cleaning changing the air filter Turn the cover lock 11 counterclockwise to release it and carefully remove the filter cover 12 There is a gasket 15 between the filter cover 12 and the hood 14 Remove screws 13 and take off the cover 14 Clean the gasket 15 with a brush and check for damage Take the pre filter foam 17 out of t...

Страница 23: ...urface Replace the air filter insert every 100 operating hours Replace it immediately if there is a drop in power drop in speed or smoke in the exhaust Before installing the filter system check the intake opening to make sure no dirt particles have fallen in If they have remove them CAUTION Turn off the engine before cleaning the air filter Never clean out the air filter with compressed air Do not...

Страница 24: ...the open ing Empty fuel tank Use a wire hook to pull the suction out of the tank opening for replacement Caution Do not allow fuel to come into contact with skin Replacing the spark plug Caution Do not touch the spark plug or plug cap if the engine is running high voltage Switch off the engine before starting any maintenance work A hot engine can cause burns Wear protective gloves The spark plug O...

Страница 25: ... 21 CAUTION Do not let the knots or the cable ends protrude from the outside of the cable pulley Pull knot 22 into the cable grip 23 Guide the cable into the recess 24 on the cable drum and use the cable to turn the drum two turns in the direction shown by the arrow Holdingthecabledruminyourlefthand straightenoutthetwistin the cable with your right hand pull the cable tight and hold Release the ca...

Страница 26: ...ngs are delivered already tensioned in the housing CAREFUL the spring can pop out If it does it can be put back in as shown in the diagram observe the direction of rotation Before installing the new return spring 4 in the starter hous ing grease it lightly with multipurpose grease Order No 944 360 000 Then position it and press it until the tabs 5 engage in the slots Do not grease the cable drum 2...

Страница 27: ...l 8 to lever out the stop pin 9 as shown in the illustration until the protective hood 11 can be turned NOTE The turn stop 7 is deactivated when the stop pin 8 is removed This permits the hood 11 to be turned farther than the turn stop 7 Unscrew the grip 10 and turn the protective hood 11 as shown in the illustration Disengage the V belt 12 and remove the cutting attach ment NOTE The illustration ...

Страница 28: ...MPORTANT When you reposition the cutting attachment the direction of rotation of the cutting wheel changes If a rotation direction is marked on the cutting disc make sure the disc turns in the right direction 13 14 15 16 17 18 Replacing cleaning the spark arrester screen CAUTION Do not use sharp or pointed objects for screen cleaning Damaged or misformed screen wires may result The spark arrester ...

Страница 29: ... to the trolley and Power Cut are very fast and simple Mains pressure water system 6 The mains pressure water system is designed to be mounted on the Power Cut It can be used with or without the trolley but is especially suitable for applications involving hand held stationarycutting Thewaterlinehasafast releaseconnection and can be fed either from a mains supply or from a pressure tank 7 The wate...

Страница 30: ... dealer He will also have the spare part lists to determine the required spare part numbers and will be constantly informed about the latest improvements and spare part innovations Please bear in mind that if parts other than original MAKITA spare parts are used this will automatically invalidate the MAKITA product guarantee We will furthermore not accept any liability damages arising from the use...

Страница 31: ...arantee All repairs covered by the guarantee must be performed by a MAKITA service center Malfunction System Observation Cause Cutting disc does not start turning Clutch Engine runs Damage to clutch Cutting disc runs in idle Carburetor Cutting disc runs Incorrect idle speed clutch blocked clutch Engine does not start or Ignition system Ignition spark Malfunction in fuel supply system com only with...

Страница 32: ...32 Extract from the spare parts list Use only original MAKITA parts For repairs and replacement of other parts see your MAKITA service center EK7300 7301 32 31 29 30 22 28 ...

Страница 33: ... 1 Screwdriver carburetor 19 395 174 140 1 Spark arrester screen for models with SLR muffler Accessories not delivered with the Power Cut Diamond cutting disc 22 966 221 021 1 Concrete Standard dia 300 20 mm 12 0 8 22 966 321 020 1 Concrete DiaDuran dia 300 20 mm 12 0 8 22 966 221 011 1 Asphalt Standard dia 300 20 mm 12 0 8 22 966 321 010 1 Asphalt DiaDuran dia 300 20 mm 12 0 8 22 966 241 021 1 Co...

Страница 34: ...e rechange non autorisée ou mauvais fonctionnement de pièces autorisées dû à l utilisation de pièces non autori sées RESPONSABILITÉS DE GARANTIE DU PROPRIÉTAIRE En tant que propriétaire de la machine vous êtes tenu responsable de l exécution de la maintenance requise indiquée dans le manuel du propriétaire MAKITA recommande de conserver toutes les quittances couvrant l entretien de votre machine c...

Страница 35: ...papiers Nous vous remercions de votre confiance LadécoupeusemodernedeMAKITAvousaconvaincuàl achat CommedestronçonneusesMAKITA lesdécoupeusesMAKITA sont équipées de moteurs haute puissance spécialement construits à cet effet présentant un rapport puissance poids excellent donc une puissance moteur élevée pour un poids faible Autres avantages des découpeuses MAKITA construction robuste et haute fiab...

Страница 36: ...per le bois Commutateur combiné Starter Marche Arrêt E S Démarrage Appuyer sur la soupape de décompression Démarrer le moteur Arrêter le moteur Attention Rebond kickback Mélange carburant Premier secours Recyclage Ne touchez pas les surfaces chaudes Lire instructions d emploi et suivre les consignes de sécurité et d avertissement Danger et attention particulirs Interdit Porter un casque une protec...

Страница 37: ...pport à des tiers Ne jamais travailler sous l effet de l alcool de drogues de mé dicaments ou d autres substances risquant d affecter la vue l aptitude ou les réflexes Avoir un extincteur sous la main en cas de travaux dans un végétation facilement inflammable ou par temps de sécheresse Danger d incendie Le découpage de l amiante ou de substances susceptibles de dégager des gaz toxiques ne doit êt...

Страница 38: ... de projection des étincelles du disque à découper Les carburants ne peuvent pas être stockés infiniment N ache ter que la quantité nécessaire couvrant un temps de marche prévisible Lorsquevouseffectuezlemélangeessence huile remplird abord l huile et ensuite l essence dans le bac de mélange Ne transporter et ne stocker le carburant que dans des nourrices agrées et portant les indications nécessair...

Страница 39: ... la découpeuse que selon les instructions indiquées dans la notice d emploi 13 Poser toujours le peid droit gauche la poignéeetentourerlapoignéeaveclepouce D autrestechniques de lancement ne sont pas autorisées Lorsdelamiseenroute lamachinedoitêtresolidementmaintenue et supportée Pour cela le disque à découper doit être libre Si le disque à découper est neuf il doit être testé avant le premier déc...

Страница 40: ...sans aucune surveillance Faire fonctionner la découpeuse si possible à haut régime cf Caractéristiques techniques Netravaillerquesousdebonnes conditionsdevisibilitéetd éclai rage Faireparticulièrementattentionenprésencedesolglissant d humidité de glace et de neige danger de glissade Ne jamais travailler sur un fondement instable Faire attention aux obstacles dans la zone de travail risque de trébu...

Страница 41: ...coupésencoupant verticalement Manipuler les tubes de grand diamètre comme les barres massives Pour éviter de tenir de travers et pour un meilleur contrôle du découpage ne pas laisser le disque trop pénétrer dans le matériau Toujours tronçonner à plat tout autour Les disques à découper usées de faible diamètre ont au même régimemoinsdevitessepériphériqueetcoupentparconséquent moins bien Tronçonner ...

Страница 42: ...que le moteur ou le disque est en marche Ne porter la découpeuse que par la poignée étrier Le disque à découper est orienté vers l arrière 26 Ne jamais entrer en contact avec le pot d échappement risque de brûlure Utiliser une brouette ou un chariot pour le transport sur une distance assez longue Si la découpeuse est transportée par un véhicule automobile s assurer que celle ci soit dans une posit...

Страница 43: ... n étant pas d origine MAKITA il faut s attendre à un risque d accident important MAKITA ne pourra être tenu responsable en cas d accidents ou de dommages avec des disques à découper ou accessoires n étant pas d origine Premier secours On devra toujours disposer sur le lieu de travail d une boîte de secours pour le cas d un éventuel accident Les produits prélevés doivent immédiatement être remplac...

Страница 44: ...vitesse de rotation Type électronique Bougie d allumage Type NGK BPMR 7A BOSCH WSR 6F CHAMPION RCJ 6Y Ecartement électrodes in mm 020 0 5 020 0 5 Consommation carburant puissance max selon ISO 8893 kg h 1 7 1 7 Consommation spéc puissance max selon ISO 8893 g kWh 450 450 Capacité réservoir carburant fl oz l 37 1 1 37 1 1 Dosage mélange carburant huile 2 temps avec utilisation huile synthétique MAK...

Страница 45: ...n 15 Poignée de lancement 16 Orifice d aspiration d air 17 Commutateur combiné Starter Marche Arrêt E S 18 Bouton de blocage pour mi gaz 19 Levier d accélération 20 Couvercle du réservoir à essence 21 Boîtier du démarreur avec dispositif de lancement 22 Disque à découper 23 Vis de fixation du disque à découper 24 Disque de contrainte 25 Ouverture de contre support Numéro de série Année de construc...

Страница 46: ...tation Observer le sens de rotation du disque à découper si mar qué sur celui ci MISE EN ROUTE ATTENTION Pour tout travail effectué sur la découpeuse il est impératif de mettre le moteur hors tension de retirer la fiche de la bougie et de porter des gants de protection ATTENTION La découpeuse ne peut être mise en marche qu après le montage complet Schématique Pour les travaux suivants utilisez l o...

Страница 47: ...tre le moteur hors tension et de retirer la cosse de bougie pendant tous les travaux effectués sur la tron çonneuse ATTENTION Il est obligatoire de réduire le tuyau 15 à 180 mm 7 en cas d utilisation d un capot de protection pour un diamètre de disque maximal de 300 mm 12 Pour cela desserrer l écrou raccord 16 retirer le tuyau 15 du raccord 17 avec précaution et le raccourcir à 180 mm Ensuite réap...

Страница 48: ...é d octane minimum de 91 R M 2 Si un tel type de carburant n était pas disponible on peut aussi utiliser un carburant d un degré d octane plus élevé Le moteur n en subit aucun dommage Pour un fonctionnement optimal ainsi que pour la protec tion de la santé et de l environnement utilisez toujours un carburant sans plomb Le graissage du moteur est réalisé par une huile moteur à deux temps synthétiqu...

Страница 49: ...deux temps de MAKITA 50 1 peut être livrée selon les besoins dans des bidons aux contenances suivantes 2 6 flz N de commande T 00745 6 4 flz N de commande T 00739 REMARQUE Pour fabriquer le mélange essence huile il faut toujours mélanger préalablement le volume d huile prévu dans la moitié du volume d essence puis y ajouter le volume d essencerestant Avantdeverserlemélangedansl appareil bien le mé...

Страница 50: ...pérativement les Instructions de sécu rité de la page 37 et 38 La découpeuse ne peut être mise en marche qu après le montage complet Démarrer le moteur au moins 3 m 10 pieds de l endroit du réservoir Prendre une position sure et poser la découpeuse de ma nière à ce que le dispositif de découpage ne soit tourné dans votre direction 3 mètres Mettre le capot de protection 3 en position optimale cf Fi...

Страница 51: ...e cordon de lancement plus d environ 50 cm et le ramener lentement à la main Y enfoncer la vanne de décompression 5 Appuyer maintenant sur le bouton combiné 6 en position moyenne I Tirer de nouveau sur le cordon de lancement rapidement et fortement Dès que le moteur tourne empoigner la poignée la touche de blocage de sécurité 8 est appuyée par la pomme de la main et presser légèrement le levier d ...

Страница 52: ...alisé MAKITA Les perçages des deux vis de réglage sont par conséquent couverts Lesopérationssuivantessontnécessairespourunréglage correct du régime de ralenti Démarrez le moteur et laissez le tourner jusqu à ce qu il soit chaud env 3 à 5 min Utiliser le tournevis 1 réf 944 340 001 Il possède un talon soudé servant au réglage Corrigez le réglage du régime de ralenti Si le disque à découper tourne a...

Страница 53: ...oute remise en marche SERVICE Desserrer les vis 8 et enlever le couvercle du carter d em brayage 9 Enlever l ancienne courroie 10 ou les restes de courroie NOTE Le dessin montre la courroie trapézoïdale des modè les EK7300 7301 Nettoyer l intérieur du bras de transmission au moyen d un pinceau Mettre en place une nouvelle courroie NOTE Montageducouvercleducarter moteur 9 del entretoise latérale 6 ...

Страница 54: ... remplacer le filtre à air Tourner le verrouillage du couvercle 11 dans le sens inverse des aiguilles et retirer avec précaution le couvercle du filtre 12 Un joint 15 se trouve entre le couvercle du filtre 12 et le capot 14 Dévisser les vis 13 et retirer le capot 14 Nettoyer le joint 15 avec un pinceau et vérifier s il n est pas endommagé Nettoyer le pré filtre mousse 17 du couvercle du filtre Ret...

Страница 55: ... et la frapper avec précaution contre un support propre Remplacer la cartouche de filtre à air toutes les 100 heures de service La remplacer immédiatement en cas de perte de puissance de baisse de régime ou de dégagement d épaisse fumée dans les gaz d échappement Avant de monter le système de filtrage contrôler si aucune poussière n est tombée dans l orifice d aspiration Les enlever si besoin est ...

Страница 56: ...a crépine d aspiration à travers la bouche du réservoir au moyen d un crochet en fil métallique Attention Eviter tout contact du carburant avec la peau 0 5 mm 7 8 ATTENTION N utilisez comme re change que les bougie BOSCH WSR 6F CHAMPION RCJ 6Y oder NGK BPMR 7A 13 12 Remplacement de bougie ATTENTION Les bougies d allumage ou la fiche de la bougie ne doivent pas être touchés le moteur en marche haut...

Страница 57: ...r d enroulement 21 ATTENTION Le nœud ou l extrémité du cordon de lancement ne doit pas dépasser la surface du tambour d enroulement Insérer le noeud 22 dans la poignée de lancement 23 Introduire le cordon dans l évidement 24 sur le tambour d enroulement et tourner deux fois le tambour d enroulement avec le cordon dans le sens de la flèche Tenir le tambour d enroulement de la main gauche démêler le...

Страница 58: ...ts de rappel de remplacement sont fournis tendus dans le carter ATTENTION le ressort de rappel peut sauter Une fois enlevé le ressort de rappel peut être réinséré comme suit respecter le sens de rotation Graisser légèrement le nouveau ressort de rappel 4 avant de le monter dans le carter du démarreur avec de la graisse multi usage réf 944 360 000 puis remettre le ressort de rappel 4 en place et le...

Страница 59: ...5 Desserrer la vis de tension 3 dans le sens inverse des aiguilles jusqu à ce que l extrémité de la vis 4 soit visible dans la fente Dévisser et enlever la vis détail X uniquement sur le modèle DPC8132 Dévisser les écrous 5 et enlever le couvercle 6 Retirer le boulon de butée 8 en le levant avec la clé univer selle 9 comme montré sur la figure jusqu à ce que le capot de protection 11 puisse être t...

Страница 60: ...monter la poignée 18 comme décrit sur la Figure ATTENTION Après chaque modification de montage du dispositif de coupe le sens de rotation du disque de découpe change Observer le sens de rotation du disque à découper si indiqué sur le disque à découper 13 14 15 16 17 18 25 26 Changement nettoyage du pare étincelles Attention N utilisez pas d objets coupants ou pointus pour nettoyer le pare étincell...

Страница 61: ...La conduite d eau au réseau réservoir 6 La conduite d eau sous pression est conçue pour être montée sur la découpeuse Celle ci peut être utilisée en relation avec le chariot de guidage La conduite d eau sous pression convient particulièrement lorsque vous travaillez avec la découpeuse de manière stationnaire Au moyen d un accouplement de rupture rapide l eau peut être alimentée soit au moyen du ré...

Страница 62: ...lez aussi noter qu en utilisant des pièces qui ne sont pas d origine de MAKITA vous perdez tout droit à la garantie de l organisation MAKITA Au cas où des pièces non d origine provoqueraient de détériorations nous n assurerons pas les frais qui en découleraient Généralités Découpeuse dans Nettoyer l extérieur et vérifier si elle n est pas détériorée l ensemble En cas de détériorations faire effect...

Страница 63: ...ctuer par le vendeur spécialiste MAKITA Recherche de pannes Panne Système Observation Origine La découpeuse ne démarre pas Embrayage Moteur tourne Panne au niveau de l embrayage Disque à découper tourne Carburateur Disque à découper tourne Réglage du ralenti incorrect au ralenti Accouplement embrayage bloqué Courroie Tension de courroie trop faible courroie usée trapézoïdale Moteur ne démarre pas ...

Страница 64: ... liste des pièces de rechange N utilisez que des pièces de rechange d origine MAKITA Pour les réparations et la rechange pour d autres pièces votre atelier spécialisé MAKITA est compétent 32 31 29 30 22 28 EK7300 7301 ...

Страница 65: ...12 0 8 22 966 321 020 1 Béton DiaDuran diam 300 20 mm 12 0 8 22 966 221 011 1 Asphalte Standard diam 300 20 mm 12 0 8 22 966 321 010 1 Asphalte DiaDuran diam 300 20 mm 12 0 8 22 966 241 021 1 Béton Standard diam 350 20 mm 14 0 8 22 966 341 020 1 Béton DiaDuran diam 350 20 mm 14 0 8 22 966 241 011 1 Asphalte Standard diam 350 20 mm 14 0 8 22 966 341 010 1 Asphalte DiaDuran diam 350 20 mm 14 0 8 22 ...

Страница 66: ...66 ...

Страница 67: ...67 ...

Страница 68: ...equipment such as those dust masks that are specially designed to filter out microscopic particles Les gaz d échappement émis par ce produit contiennent des produits chimiques connus par l Etat de Californie pour provoquer le cancer des défauts de naissance ou autres dommages de reproduction ATTENTION Certaines poussières produites pendant le décapage au sable le sciage l affûtage le perçage et pe...

Отзывы:

Нет отзывов

Похожие инструкции для EK7301

Бренд: Ducati Страницы: 52

Бренд: RASOR Страницы: 16

Бренд: Olfa Страницы: 1

Бренд: D-CUT Страницы: 3

Бренд: D-CUT Страницы: 6

Evolution3 SmartFold

Бренд: KEENCUT Страницы: 33

Norton CP514-350i

Бренд: SAINT-GOBAIN ABRASIVES Страницы: 12

Бренд: Daewoo Страницы: 12

Бренд: Rockwell Страницы: 20

Бренд: Craftsman Страницы: 36

Бренд: Craftsman Страницы: 32

Бренд: KitchenAid Страницы: 44

Бренд: Craftsman Страницы: 26

Бренд: Craftsman Страницы: 26

Бренд: Craftsman Страницы: 23

Бренд: Craftsman Страницы: 18

Бренд: Craftsman Страницы: 37

Бренд: Craftsman Страницы: 47

Бренды по названию

0 1 2 3 4 5 6 7 8 9 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Популярные бренды

Загрузить еще бренды