background image

5

02/2020

Tous les éléments / Alle elementen / All elements / Alle Elemente

Fundament

•   Le sol doit être 

plat et de niveau

. Le sol doit être réalisé pour

permettre une fixation adéquate de l’abris de jardin.

De vloer moet 

vlak en waterpas

 zijn. De vloer moet gemaakt

worden zodat de bevestiging van het tuinhuis wel mogelijk is.

The floor must be 

flat and leve

. The floor must be made in

such a way that it is possible to fix the garden house.

Der Aufbauort muss eine 

flach , geschlossene und in

Waage liegende Bodemplatte

 aufzeigen. Die Bodenplatte

muss so beschaffen sein, das eine mechanische Befestigung
von dem Eleganto erfolgen kann.

PS

L’abris de jardin doit être centrée sur la dalle de béton.

Het tuinhuis moet gecentreerd geplaatst worden op het 
fundament.

•  The garden house must be centered on the foundation.

Das Gartenhaus muss auf dem Fundament zentriert sein.

PP

PP

PP

%HWRQSODDW

%HWRQ.JPí

(O

36

'DV*DUWHQKDXVPXVVDXIGHP)XQGDPHQW]HQWULHUWVHLQ

‡

7KHJDUGHQKRXVHPXVWEHFHQWHUHGRQWKHIRXQGDWLRQ

‡

/DEULVGHMDUGLQGRLWrWUHFHQWUpHVXUODGDOOHGHEpWRQ

‡

+HWWXLQKXLVPRHWJHFHQWUHHUGJHSODDWVZRUGHQRSKHWIXQGDPHQW

‡

)XQGDPHQW

'HU$XIEDXRUWPXVVHLQHIODFKHJHVFKORVVHQHXQGLQ:DDJH

‡

OLHJHQGH%RGHPSODWWHDXI]HLJHQ'LH%RGHQSODWWHPXVVVR

EHVFKDIIHQVHLQGDVHLQHPHFKDQLVFKH%HIHVWLJXQJYRQGHP

(OHJDQWRHUIROJHQNDQQ

7KHIORRUPXVWEHIODWDQGOHYHO7KHIORRUPXVWEHPDGHLQVXFKDZD\

‡

WKDWLWLVSRVVLEOHWRIL[WKHJDUGHQKRXVH

/HVROGRLWrWUHSODWHWGHQLYHDX/HVROGRLWrWUHUpDOLVpSRXU

‡

SHUPHWWUHXQHIL[DWLRQDGpTXDWHGHODEULVGHMDUGLQ

'HYORHUPRHWYODNHQZDWHUSDVV]LMQ'HYORHUPRHWJHPDDNWZRUGHQ

‡

]RGDWGHEHYHVWLJLQJYDQGHWXLQKXLVZHOPRJHOLMNLV

0$66(

$

)(8,//(685

(&+(//(

1R'(3/$1

7,75(

5(9,6,21

1(3$6&+$1*(5/(&+(//(

0$7(5,$8

'$7(

6,*1$785(

120

&$66(5/(6
$1*/(69,)6

6$8),1',&$7,21&2175$,5(
/(6&27(66217(10,//,0(75(6
(7$7'(685)$&(
72/(5$1&(6
/,1($,5(6
$1*8/$,5(6

48$/

)$%

$335

9(5,)

$87(85

0pORQ/XF

ELEGANTO 2724 mit Seitendach 280 cm links

Содержание ELEGANTO 2724

Страница 1: ...air Licht grijs Light grey Lichtgrau Anthracite Antraciet Anthracite Granitgrau Granul StoneCoat StoneCoat Dekorputz Fu boden Innenwand Lochblech Bodenschwelle Rampe Tauch einer Reihe in Rot Zubeh r I...

Страница 2: ...te lesen Sie diese Anleitung sorgf ltig durch Sie enth lt die technischen Eigenschaften und alle Informationen die f r einen korrekten Betrieb erforderlich sind Die in dieser Publikation enthaltenen t...

Страница 3: ...4 Z24A K6LD J24 DAVR21 XPHL ZAPHL K6R JDA24 Z24C1 KT18 DAVL21 XOLC 27 ZAV K6S J24R ZC1PHL J21S SS6PH XPHA ZCVL 1x 2x 6x 1x 1x 1x 1x 1x 1x 1x 1x 1x 1x 1x 1x 1x 6x 1x 1x 2x 1x 1x 1x DR FD18 DA21 XPHA 21...

Страница 4: ...73 26 CP05 8x WP30 2x RK1 1x RK2 RK3 M21 2x SPB6 4x CP15 1x CP16 1x M24 2x TOOL3 TOOL2 W1 2x 1x 1x W3 TOOL1 W4 1x 1x 2x W2 BZ75 1x 20x DK 1x SD25 2x BZ30 12x SD18BL 40x SD18 400x M12 8x CP02g 2x CP01...

Страница 5: ...zentriert sein PP PP PP HWRQ SODDW HWRQ J P OHJDQWR 3 36 DV DUWHQKDXV PXVV DXI GHP XQGDPHQW HQWULHUW VHLQ 7KH JDUGHQ KRXVH PXVW EH FHQWHUHG RQ WKH IRXQGDWLRQ DEULV GH MDUGLQ GRLW rWUH FHQWUpH VXU OD G...

Страница 6: ...ELEGANTO 2724 mit Seitendach 280 cm links 6 02 2020 Composition Compositie Composition Zusammensetzung B C A H I J D...

Страница 7: ...7 02 2020 A Paroi Wand Wall Wand A Paroi Wand Wall Wand A Paroi Wand Wall Wand 24 6 J24R A ELEGANTO 2724 mit Seitendach 280 cm links...

Страница 8: ...Wand A Paroi Wand Wall Wand SD18 Tourner encadrement Kader omdraaien Turn Frame Rahmen umdrehen Le principe de la construction du mur POW Het principe van de opbouw van de wand POW The principle of bu...

Страница 9: ...9 02 2020 A Paroi Wand Wall Wand A Paroi Wand Wall Wand SD18 POW POW ELEGANTO 2724 mit Seitendach 280 cm links...

Страница 10: ...10 02 2020 ELEGANTO 2724 mit Seitendach 280 cm links A Paroi Wand Wall Wand SD18 A Paroi Wand Wall Wand Tourner encadrement Kader omdraaien Turn Frame Rahmen umdrehen POW POW...

Страница 11: ...11 ELEGANTO 2724 mit Seitendach 280 cm links 02 2020 A Paroi Wand Wall Wand SD18 A Paroi Wand Wall Wand SD18 F6 POW...

Страница 12: ...12 02 2020 ELEGANTO 2724 mit Seitendach 280 cm links A Paroi Wand Wall Wand SD18 CP02i SD18 CP05 A Paroi Wand Wall Wand...

Страница 13: ...13 ELEGANTO 2724 mit Seitendach 280 cm links 02 2020 A Paroi Wand Wall Wand A Paroi Wand Wall Wand CP01 SD18...

Страница 14: ...14 02 2020 ELEGANTO 2724 mit Seitendach 280 cm links A Paroi Wand Wall Wand SD18 A Paroi Wand Wall Wand SD18 CP05...

Страница 15: ...15 ELEGANTO 2724 mit Seitendach 280 cm links 02 2020 A Paroi Wand Wall Wand A Paroi Wand Wall Wand SD18 CP02g SD18 CP02i...

Страница 16: ...ELEGANTO 2724 mit Seitendach 280 cm links 16 02 2020 B Paroi Wand Wall Wand B A Paroi Wand Wall Wand WP30 SD18...

Страница 17: ...Wall Wand J21 B6 J21S Le principe de la construction du mur voir pages 8 11 POW Het principe van de opbouw van de wand zie pagina 8 tot en met 11 POW The principle of building the wall see pages 8 th...

Страница 18: ...ELEGANTO 2724 mit Seitendach 280 cm links 18 02 2020 B Paroi Wand Wall Wand F6 SD18 D Paroi Wand Wall Wand OL SD18...

Страница 19: ...19 ELEGANTO 2724 mit Seitendach 280 cm links 02 2020 A B Paroi Wand Wall Wand A B Paroi Wand Wall Wand SD18 CP01 CP05 CP02i...

Страница 20: ...d Wall Wand A2 A24 24 21 ELEGANTO 2724 mit Seitendach 280 cm links A B Paroi Wand Wall Wand 45 90 ONEOAT Option Dekorputz Plier les crochets 90 Hoekjes plooien op 90 Corners fold at 90 Ecken um 90 fal...

Страница 21: ...Seitendach 280 cm links 02 2020 21 A B Paroi Wand Wall Wand DA03 A B Paroi Wand Wall Wand Option Dekorputz Plier les crochets 90 Hoekjes plooien op 90 Corners fold at 90 Ecken um 90 falten 45 90 ONEOA...

Страница 22: ...2724 mit Seitendach 280 cm links 22 02 2020 A B Paroi Wand Wall Wand DAVR21 A2 45 rev tement int rieur binnenbekleding interior lining Innenverkleidung A B Paroi Wand Wall Wand Option Optie Option Opt...

Страница 23: ...2724 mit Seitendach 280 cm links 02 2020 DI21 DI21V DI03 A B Paroi Wand Wall Wand Option Optie Option Option rev tement int rieur binnenbekleding interior lining Innenverkleidung A B Paroi Wand Wall W...

Страница 24: ...all Wand 44 B6 A24 Le principe de la construction du mur voir pages 8 11 POW Het principe van de opbouw van de wand zie pagina 8 tot en met 11 POW The principle of building the wall see pages 8 throug...

Страница 25: ...25 ELEGANTO 2724 mit Seitendach 280 cm links 02 2020 C Paroi Wand Wall Wand SD18 CP02 CP02g CP01 SD18 C Paroi Wand Wall Wand CP01 SD18...

Страница 26: ...26 02 2020 ELEGANTO 2724 mit Seitendach 280 cm links C Paroi Wand Wall Wand F6 SD18 C Paroi Wand Wall Wand SD18 CP05 D18 CP05...

Страница 27: ...ELEGANTO 2724 mit Seitendach 280 cm links 02 2020 C Paroi Wand Wall Wand SD18 CP02i 27 C D Paroi Wand Wall Wand CP01 CP02g...

Страница 28: ...28 02 2020 SD18 C D Paroi Wand Wall Wand C D Paroi Wand Wall Wand A24 24 A2 21 ELEGANTO 2724 mit Seitendach 280 cm links CP01 CP05 CP02i...

Страница 29: ...t Seitendach 280 cm links 02 2020 C D Paroi Wand Wall Wand 45 90 ONEOAT 29 Option Dekorputz Plier les crochets 90 Hoekjes plooien op 90 Corners fold at 90 Ecken um 90 falten C D Paroi Wand Wall Wand A...

Страница 30: ...itendach 280 cm links 30 02 2020 C D Paroi Wand Wall Wand 45 90 ONEOAT C D Paroi Wand Wall Wand A2 DAVL21 TOOL3 Option Dekorputz Plier les crochets 90 Hoekjes plooien op 90 Corners fold at 90 Ecken um...

Страница 31: ...ing Innenverkleidung C D Paroi Wand Wall Wand Option Optie Option Option C D Paroi Wand Wall Wand Option Optie Option Option rev tement int rieur et plaque perfor e binnenbekleding en geperforeerde pl...

Страница 32: ...20 rev tement int rieur et plaque perfor e binnenbekleding en geperforeerde plaat interior lining and perforated plate Innenverkleidung und perforierte Platte C D Paroi Wand Wall Wand Option Optie Opt...

Страница 33: ...33 ELEGANTO 2724 mit Seitendach 280 cm links 02 2020 C D Paroi Wand Wall Wand F6 SD18 C D Paroi Wand Wall Wand SD18 CP02i CP02i...

Страница 34: ...ELEGANTO 2724 mit Seitendach 280 cm links 34 02 2020 A B C D Paroi Wand Wall Wand Wand A Wall A Wand A Paroi A A B C D Paroi Wand Wall Wand...

Страница 35: ...35 ELEGANTO 2724 mit Seitendach 280 cm links 02 2020 A B C D Paroi Wand Wall Wand A B C D Paroi Wand Wall Wand SD18 SPB6 SD18 CP02g CP05 CP02i...

Страница 36: ...ple donn pour un sous sol en b ton Fixer l abri de jardin dans les r gles de l art Voorbeeld is voor beton ondergrond Tuinhuisje fixeren volgens de regels van de kunst Example is for concrete substrat...

Страница 37: ...l Wand Option Optie Option Option rev tement int rieur binnenbekleding interior lining Innenverkleidung IG 2 090mm IK 2 070mm IG IK rev tement int rieur binnenbekleding interior lining Innenverkleidun...

Страница 38: ...ELEGANTO 2724 mit Seitendach 280 cm links 38 02 2020 H I J Paroi Wand Wall Wand CP15 CP16 J Paroi Wand Wall Wand SOL_Paal CP16 BZ30 H I J...

Страница 39: ...39 ELEGANTO 2724 mit Seitendach 280 cm links 02 2020 Wand A Wall A Wand A Paroi A J Paroi Wand Wall Wand SSP_OL SS6PH PP SD18 SOL_paal PP J Paroi Wand Wall Wand...

Страница 40: ...ELEGANTO 2724 mit Seitendach 280 cm links 40 02 2020 J Paroi Wand Wall Wand SD18 H Paroi Wand Wall Wand SOL_Paal CP15 BZ30...

Страница 41: ...41 ELEGANTO 2724 mit Seitendach 280 cm links 02 2020 Wand A Wall A Wand A Paroi A H Paroi Wand Wall Wand SSP_OL SS6PHK PP SD18 SOL_paal PP H Paroi Wand Wall Wand...

Страница 42: ...42 02 2020 H Paroi Wand Wall Wand SD18 I Paroi Wand Wall Wand SSP21 ELEGANTO 2724 mit Seitendach 280 cm links...

Страница 43: ...43 ELEGANTO 2724 mit Seitendach 280 cm links 02 2020 Wand A Wall A Wand A Paroi A I Paroi Wand Wall Wand SD18 H I J Paroi Wand Wall Wand XPHL XPHA XPHA21 XOLC_27...

Страница 44: ...44 02 2020 A Porte Deur Door T r UD18 FD18 A Porte Deur Door T r KT18 ELEGANTO 2724 mit Seitendach 280 cm links...

Страница 45: ...45 ELEGANTO 2724 mit Seitendach 280 cm links 02 2020 Wand A Wall A Wand A Paroi A A Porte Deur Door T r LL A Porte Deur Door T r K6R...

Страница 46: ...46 02 2020 A Porte Deur Door T r SD18B A Porte Deur Door T r SD16D ELEGANTO 2724 mit Seitendach 280 cm links...

Страница 47: ...47 ELEGANTO 2724 mit Seitendach 280 cm links 02 2020 X Y X Y...

Страница 48: ...ELEGANTO 2724 mit Seitendach 280 cm links 48 02 2020...

Страница 49: ...49 ELEGANTO 2724 mit Seitendach 280 cm links 02 2020 6X 6X...

Страница 50: ...endach 280 cm links 50 02 2020 Toit Dak Roof Dach Retirer le film erwijder folie Remove foil Folie entfernen Toit Dak Roof Dach ZC1PHL ZCVL Z24C1 SD18BL W1 Retirer la bande Tape verwijderen Remove tap...

Страница 51: ...51 02 2020 Toit Dak Roof Dach SD18 Toit Dak Roof Dach 2724L 2724L4 2724L 2724L2 2724L ELEGANTO 2724 mit Seitendach 280 cm links...

Страница 52: ...ELEGANTO 2724 mit Seitendach 280 cm links 52 02 2020 Toit Dak Roof Dach PP Toit Dak Roof Dach 1 2 2X...

Страница 53: ...n Fixer l abri de jardin dans les r gles de l art Voorbeeld is voor beton ondergrond Tuinhuisje fixeren volgens de regels van de kunst Example is for concrete substrate Fix the garden shed in accordan...

Страница 54: ...ELEGANTO 2724 mit Seitendach 280 cm links 54 02 2020 Angle Hoek Corner Ecke Angle Hoek Corner Ecke HOLSL...

Страница 55: ...55 02 2020 Angle Hoek Corner Ecke Toit Dak Roof Dach Z24C2 ZC2PHL BZ75 ELEGANTO 2724 mit Seitendach 280 cm links...

Страница 56: ...ELEGANTO 2724 mit Seitendach 280 cm links 56 02 2020 Toit Dak Roof Dach Z21B SD18 BZ75 Toit Dak Roof Dach 44 A ZAV ZAPHL SD18 BZ75...

Страница 57: ...ext rieure 10 C Voorbereiding zelfklevende tape 1 Oppervlak stof en vochtvrij maken 2 Bij 10 C is opwarmen ondergrond d m v warmtepistool F hn vereist Preparation of self adhesive tape 1 Make the sur...

Страница 58: ...ELEGANTO 2724 mit Seitendach 280 cm links 58 02 2020 Toit Dak Roof Dach A Toit Dak Roof Dach A...

Страница 59: ...59 ELEGANTO 2724 mit Seitendach 280 cm links 02 2020 Toit Dak Roof Dach Toit Dak Roof Dach A 2 1 2...

Страница 60: ...ELEGANTO 2724 mit Seitendach 280 cm links 60 02 2020 Wand A Wall A Wand A Paroi A E F G Paroi Wand Wall Wand M12 Ancrage Verankering Anchoring Verankerung...

Страница 61: ...61 ELEGANTO 2724 mit Seitendach 280 cm links 02 2020 Ancrage Verankering Anchoring Verankerung HPH L 2067mm Ancrage Verankering Anchoring Verankerung HA6 L 2080mm...

Страница 62: ...ELEGANTO 2724 mit Seitendach 280 cm links 62 02 2020 Ancrage Verankering Anchoring Verankerung LL L 2047mm Ancrage Verankering Anchoring Verankerung HA6 L 2080mm...

Страница 63: ...63 ELEGANTO 2724 mit Seitendach 280 cm links 02 2020 2X W4 SD25 H 1400 H 650 Drain Afwatering Drainage Drainage W3 W2 Drain Afwatering Drainage Drainage...

Страница 64: ...ELEGANTO 2724 mit Seitendach 280 cm links 64 02 2020 Toit Dak Roof Dach L90x4 L90x4 Toit Dak Roof Dach L55x4 L74...

Страница 65: ...65 ELEGANTO 2724 mit Seitendach 280 cm links 02 2020 Sol Vloer Floor Boden Option Optie Option Option T724 BF21 Rampe Oprijplaat Ramp Rampe Option Optie Option Option OS18...

Страница 66: ...atum der Beanstandung Name des H ndlers Ist das Haus von Finnhaus Monteuren aufgebaut worden JA NEIN Wenn nicht durch wen wurde das Haus aufgebaut Name Stra e Nr Telefonnummer Handy PLZ Ort Allgemeine...

Страница 67: ...im ffnen des Paketes besch digte Ware zum Vorschein bitte immer Fotonachweise erstellen und auf der Teileliste kenntlich machen damit wir Ihnen das richtige Ersatzteil zusenden k nnen Bitte anhand der...

Страница 68: ...deze publicatie Protect the environment To ensure waste is disposed of correctly the different materials must be separated according to the applicable regulations Copyright Telluria All rights reserve...

Отзывы: