ELM EcoPro2 Скачать руководство пользователя страница 4

Set up Instructions

 

Choose a proper place for installation

 

Before you unpack and setup your EcoPro2, please ensure you have a flat, level surface on which to 

unpack, situate and operate the machine. There is the possibility that water may leak from the

 

machine if 

installed incorrectly, so keep any water sensitive material away from unit operational area. 

Use a correct power receptacle for the unit’s electric capacity. 

EcoPro2 Electric Capacity: 100-240V AC,50/60Hz,120W (Max)

 

Environmental conditions

 

Do not use the EcoPro2 in areas exposed to: 

• 

• 

• 

• 

• 

Direct sunlight 
Excessive humidity 
Dust 

Vibrations 
Corrosive or flammable gas 

Specifications

 

Unpacking Guide

 

The unit weighs 13

 

lbs

 

(6kg),

 

so please use caution when unpacking. 

Carefully lift the unit out of the box and set on a flat, stable location. 

If unit is accidently dropped, contact ELM USA. Do not attempt to use the machine until you check 

with ELM USA Service Department. 

Technical Support. 

,03257$17.HHSWKHVKLSSLQJFDUWRQDQGSDFNLQJPDWHULDOLQFDVHWKHPDFKLQHQHHGVWREHVKLSSHG

)RUVHUYLFLQJ

 

PLEASE NOTE THERE IS A $65 FEE FOR A REPLACEMENT BOX AND INSERTS

Operation ambient 

Temperature range 

40

 to 

9

5 degrees 

F

Operation ambient 

Humidity range 

15 to 85%  (Non-condensing) 

Power supply 

(50/60Hz) 

100 V AC to 240 VAC,120W 

Dimensions 

(W

 

*D *H inches) 

8*10 (13)*11.5 

(With bottles) 

Revision

 

#

 v

8.

2

.20

22

 

Содержание EcoPro2

Страница 1: ...Professional Disc Repair Machine Operation Manual Revision v8 2 2022...

Страница 2: ...It can over heat and a fire may result Do not alter bend or stretch the power cable forcibly or unplug by pulling on the cord Keep the power plug clean If the power plug is dirty clean it with a dry c...

Страница 3: ...9 Starting the EcoPro 10 Operating the Pumps Water Pump Compound Pump 11 11 12 12 Installing the Pads 13 Repairing Discs Choosing Disc Repair Mode Stopping the Repair 14 14 15 Increasing the Repair T...

Страница 4: ...humidity Dust Vibrations Corrosive or flammable gas Specifications Unpacking Guide The unit weighs 13 lbs 6kg so please use caution when unpacking Carefully lift the unit out of the box and set on a f...

Страница 5: ...Contents of Package Power Cable 4 pieces 5 KEY CARD located in key card slot of machine Pads Compound Bottle Water Bottle AC Adaptor and Bottle Holder EcoPro2 Machine Revision v8 2 2022...

Страница 6: ...ottle Back of Machine Water Bottle Cap Attaches the Water Bottle AC Inlet Connect the cable of AC Adapter 6 Polish Basin Pad Holders Place Pads properly Platen Table Disc placed label side down Splash...

Страница 7: ...er into The slits in the back and then slide the holder to the left to lock it in place 3 Secure the Bottle Holder by re installing and tightening the Bottle Holder Thumb Screw Prepare the Water and C...

Страница 8: ...to the Compound Bottle Cap BE CERTAIN TO REMOVE THE BLACK CAP AT THE END OF THE COMPOUND LINE This position is correct This position is INCORRECT The compound pump will not prime properly with the tu...

Страница 9: ...viewing from the front of the machine The KEY CARD should be inserted With arrow pointing down Be sure the KEY CARD is fully inserted into The KEY CARD slot by pushing it down and forward to lock it...

Страница 10: ...e Hatch opens automatically and then the LCD displays CD DVD and the Remaining time of the KEY CARD If the LCD displays No KEY CARD message turn OFF the Main Power Switch insert the KEY CARD to the KE...

Страница 11: ...to push water into the tubing and clear the air If the water still does not come out press Stop Remove the lid from the water bottle and use a can of compressed air to blow some air through the tubin...

Страница 12: ...ays Compound Pump ON and the Platen Table begins rotating clockwise to run the Compound Pump It may take several minutes for the compound to fill the lines and drip out of the nozzles 2 Press any butt...

Страница 13: ...middle of the pad over the center pin of the Pad Holder 2 Press the center of the Pad lightly after placing it into the Pad Holder to attach the Velcro If the pads have been used before make sure they...

Страница 14: ...rs to Blu ray discs When the machine is in standby the LCD displays CD DVD on the first line with CD DVD mode and BD with BD mode The remaining time of the KEY CARD is displayed on the second line CD...

Страница 15: ...he disc only after the Platen Table has stopped completely If there is compound residue left on the disc wipe it gently with a soft cloth All Blu ray discs will need to be wiped after repair to remove...

Страница 16: ...eaning the Pads The LCD will display a Clean Pads message after every 20 minutes of disc repairs Exchange the pads for a clean dry pair and press any button on the Operation Panel to clear the message...

Страница 17: ...lays Change KEY CARD message when the KEY CARD has no remaining time for d repair isc Turn OFF the Main Power Switch exchange the KEY CARD see page 9 for removal tips Add water to the Water Bottle and...

Страница 18: ...ning may be needed daily weekly or even monthly if there is minimal use 1 Hold onto the platen table assembly and lift it straight up to remove it from the machine 2 Take the polish tray out of the ma...

Страница 19: ...the machine align the groove in the base with the pin on the motor spindle IMPORTANT Once the platen table Assembly is in the machine rotate the platen gently until you feel it drops lightly then push...

Страница 20: ...tion Button 2 Install a clean dry set of pads After a Disc Repair Session 1 If needed clean the machine Spray inside with gentle cleaner like Windex and wipe out with soft cloth Lift out disc Platen a...

Страница 21: ...displays the remaining time on the KEY CARD Ready BD mode BD Water Pump operation Water Pump_ON Refer to pages 11 12 Compound Pump operation Compound USED FOR TROUBLE SHOOTING ONLY Refer to page 26 Co...

Страница 22: ...he same error occurs with new Pad contact Technical Support Error messages on the LCD Contents and Check Action No_Pad Contents There are no pads on the pad holder C Check Install or reposition the pa...

Страница 23: ...ages on the LCD Note and Action No KEY_CARD Turn OFF the Main Power Switch insert the KEY CARD to the KEY again Clean Pads The message appears after every 20 minutes of disc repairs to clear the alert...

Страница 24: ...ntains PRO KIT 800 min No compound PRO Pad 4 pieces 800 min KEY CARD 1 piece PRO KIT 800 min Compound 200ml 1 Bottle PRO Pad 4 pieces 800 min KEY CARD 1 piece EcoPro Pads Std Repair Pair EDR EC 227 ED...

Страница 25: ...EDR PRO C100C Under Splash Cover Part EDR PRO A400 Compound Tube Module Part EDR PRO C400C Water Bottle Cap Module Part EDR PRO F310A Compound Bottle Cap Mod ule Part EDR PRO F312A Pad Holder Velcro...

Страница 26: ...on The LCD displays Compound Pump Rev and the Platen Table begins rotating counter clockwise to run the Compound Pump in reverse so the compound will flow back into the bottle Let the Compound Pump ru...

Страница 27: ...ved the machine Model name of product Serial Number Description of Problem as much detail as possible ELM USA INC 1609 Barclay Blvd Buffalo Grove IL 60089 1 847 243 4150 WWW ELM USA COM 27 Revision v8...

Страница 28: ...intended for commercial use only The unit must be shipped freight prepaid or delivered at the consumer s expense to the nearestauthorizedrepaircenterineitheritsoriginalpackagingorsimilar package affor...

Отзывы: