Dolmar PC-6412 S Скачать руководство пользователя

Страница: 12 / 32

Denomination of components

(Illustration shows model PC-7314 S)

Handle

Filter cover for air

lter and spark plug cap

Cover

lock

Tubular

handle

Muf

Protection

hood

Grip

V-belt tension adjusting screw

Retaining

nuts

Stand

Carburetor adjustment opening

Identi

cation plate

Fuel tank with handle

Decompression

valve

Starter

grip

Air

intake

Combination Start/Stop (I/O) switch, choke

Stop knob for halfway throttle

Safety locking button

Throttle

lever

Tank cap (fuel)

Starter housing with starter

Cutting

disc

Disc

bolt

Spring

washer

Hold

opening

14 15

PC-7314 S

2007 123456

DOLMAR GmbH, 22045 Hamburg, Germany

394.100.101 Typ 394

EMI OFB

973108

Serial number

Year of manufacture

Identi

cation plate

(12)

Indicate when ordering spare parts

Содержание PC-6412 S

Страница 1: ...on manual carefully before putting the Power Cut into operation and strictly observe the safety regulations Keep this instruction manual Instruction Manual PC 6412 S PC 6414 S PC 7312 S PC 7314 S PC 8114 PC 8116 http www dolmar com ...

Страница 2: ...htweight tools Other advantages of the DOLMAR Power Cuts Sturdy construction and high reliability Maintenance free electronic ignition hermetically sealed to protect against dust and moisture Vibration damping with the DOLMAR 2 mass system D2M for tireless working even when guiding the Power Cut by hand Five stage air Þlter system for reliable working even under very dusty conditions Two options f...

Страница 3: ...t Read instruction manual and follow the warning and safety pre cautions Particular care and caution Forbidden Wear helmet and eye respiratory and hearing protection Wear protective gloves Wear respiratory protection Hazardous dust and or gas emission Fire hazard from ßying sparks No smoking No open Þre Direction of cutting wheel rotation Warning the max peripheral speed of the cutting disc is 80 ...

Страница 4: ...of alcohol drugs medica tion or other substances which may impair vision dexterity or judgement A Þre extinguisher must be available in the immediate vicinity when working in easily inßammable vegetation or when it has not rained for a long time danger of Þre Asbestos and other materials that can release toxins may be cut only with the necessary safety precautions and after notiÞcation of the prop...

Страница 5: ...g range of the cutting disc direction of sparks Fuel cannot be stored for an unlimited period of time Buy only as much as will be consumed in the near future When making up the gasoline oil mixture always put the oil in the mixing container Þrst and then the gasoline Use only approved and marked containers for the transport and storage of fuel Keep fuel away from children Putting into operation Do...

Страница 6: ...not allowed When starting the Power Cut it must be well supported and securely held The cutting disc must not be touching anything If the cutting disc is new test it by running it at least 60 seconds at top speed When doing this make sure that no persons or body parts are in the extended swing range of the disc in case it is defective and ßies apart When working with the Power Cut always hold it w...

Страница 7: ... Power Cut unattended Use the Power Cut at high speed as far as possible see Tech nical Data Only use the Power Cut during good light and visibility periods Be aware of slippery or wet areas and of ice and snow risk of slipping Never work on unstable surfaces Make sure that there are no obstacles in the working area risk of stumbling Always ensure that you have a safe footing Never cut above your ...

Страница 8: ...Instead always cut shallow around the whole piece Worn discs have a smaller diameter than new discs so that at the same engine speed they have a lower effective circumfer ential speed and therefore do not cut as well Cut I beams and L bars in steps see Figure 21 Cut bands and plates like pipes along the wide side with a long cut Whencuttingmaterialunderstress supportedmaterialormate rial in struct...

Страница 9: ...or moving it from place to place on a site 26 Never carry or move the unit with the engine on or the disc moving Carry the unit only by the tubular middle handle with the cut ting disc pointing behind you 26 Avoid touching the exhaust mufßer burn hazard When moving the Power Cut over longer distances use a wheelbarrow or wagon When transporting the Power Cut in a vehicle make sure it is securely p...

Страница 10: ...bility for accidents or damage occurring in association with the use of cutting discs or accessories other than original DOLMAR First aid For the event of a possible accident please make sure that a Þrstaidkitisalwaysimmediatelyavailablecloseby Immediately replace any items used from the Þrst aid box When calling for help give the following information Place of the accident What happened Number of...

Страница 11: ...s empty without cutting disc kg 9 7 9 9 9 8 10 Displacement cm3 81 81 Bore mm 52 52 Stroke mm 38 38 Max power kW 4 5 4 5 Max torque Nm 5 2 5 2 Idling speed 1 min 2 500 2 500 Clutch engagement speed 1 min 3 800 3 800 Engine speed limitation 1 min 9 350 145 9 350 145 Max spindle speed 1 min 4 300 3 750 Sound pressure level LpA eq per EN 1454 1 4 dB A 98 3 98 3 Sound power level LWA eq per EN 1454 1 ...

Страница 12: ...Decompression valve 15 Starter grip 16 Air intake 17 Combination Start Stop I O switch choke 18 Stop knob for halfway throttle 19 Safety locking button 20 Throttle lever 21 Tank cap fuel 22 Starter housing with starter 23 Cutting disc 24 Disc bolt 25 Spring washer 26 Hold opening 1 24 25 23 2 3 4 5 6 7 8 26 14 15 16 17 18 19 20 9 10 21 22 12 11 13 PC 7314 S 2007 123456 DOLMAR GmbH 22045 Hamburg Ge...

Страница 13: ...d with an adapter ring Make sure the cutting disc is installed so it turns in the right direction if a direction is marked on the disc PUTTING INTO OPERATION CAUTION Always turn off the engine and pull off the spark plug cap before doing any work on the Power Cut Always wear protective gloves CAUTION Start the Power Cut only after complete assembly and inspection Sequence For the the following wor...

Страница 14: ...s or Þre explosion hazard Fuel mixture The Power Cut is powered by a high performance two stroke engine It runs on a mixture of gasoline and two stroke engine oil The engine is designed for unleaded regular gasoline with a min octane value of 91 ROZ In case no such fuel is available you can use fuel with a higher octane value This will not affect the engine In order to obtain an optimum engine out...

Страница 15: ...ftime itwilldryout Variousskindeseasesmayresult In addition allergic reactions are known to occur Eyes can be irritated by contact with oil If oil comes into your eyes immediately wash them with clear water If your eyes are still irritated see a doctor immediately DOLMAR HP 100 high performance two stroke engine oil is available in the following sizes to suit your individual requirements 50 ml ord...

Страница 16: ...nd in such a way that the cutting disc is not touching anything 3 meters Move the protective hood 3 into the proper position for the work you intend to do see illustration Grasp the grip 2 The hood 3 can swing in both ways within its range of motion Caution Alwaysmakesurethatthestraightouteredgeoftheimpactplate 4 and the edge of the hood are parallel see arrows If this is not the case take the too...

Страница 17: ...st audible ignition CAUTION Do not pull out the starter cable more than approx 50 cm and lead it back by hand Depress decompression valve 5 again Put the combination switch 6 in position I Keep pulling the starter cable until the engine catches As soon as the engine is running press the throttle 9 to release the half throttle lock 7 allowing the engine to idle Warm starting As described under Cold...

Страница 18: ...ustment of the idling speed the following steps must be carried out Start the engine and run it until it is warm about 3 5 minutes Adjust the carburetor with the screwdriver 1 Order No 944 340 001 included with the Power Cut It has a lug that helps with adjustment Readjust the idling speed If the cut off disc is still turning when the engine is running unscrew the adjusting screw of the throttle v...

Страница 19: ... a DOLMAR service centre before being used again SERVICE Unscrew the screws 8 and remove the crankcase housing cover 9 Remove the old belt 10 or belt pieces NOTE The illustration shows the V belt for models PC 6412 7314 Clean out the inside of the drive arm with a brush Put in a new V belt NOTE Reassemble the crankcase housing cover 9 side piece 6 and cover 4 in the reverse order To tighten the V ...

Страница 20: ...d parts NOTE To install the cutting wheel see Mounting the cutting wheel Cleaning changing the air Þlter Turn the cover lock 11 to the Unlocked position and carefully remove the Þlter cover 12 There are two O rings 15 between the Þlter cover 12 and the air Þlter hood 14 Remove screws 13 and take off the cover 14 Clean the O ring 15 with a brush and inspect for damage Take the pre Þlter foam 17 out...

Страница 21: ...eplace the air Þlter insert every 100 operating hours Replace it immediately if there is a drop in power drop in speed or smoke in the exhaust Before installing the Þlter system check the intake opening to make sure no dirt particles have fallen in If they have remove them CAUTION Turn off the engine before cleaning the air Þlter Never clean out the air Þlter with compressed air Do not clean the p...

Страница 22: ...ery three months in order to ensure unimpeded fuel ßow to the carburetor Unscrew the tank cap 12 pull the retainer out of the open ing Empty fuel tank Use a wire hook to pull the suction out of the tank opening for replacement Caution Do not allow fuel to come into contact with skin Replacing the spark plug CAUTION Do not touch the spark plug or plug cap if the engine is running high voltage Switc...

Страница 23: ...n by the arrow Holdingthecabledruminyourlefthand straightenoutthetwistin the cable with your right hand pull the cable tight and hold Release the cable drum The drum s spring force will now wind the cable around the drum Repeat three times The starter grip must be upright on the starter housing NOTE With the cable pulled all the way out it must still be possible to turn the pulley another 1 4 turn...

Страница 24: ...g CAREFUL the spring can pop out If it does it can be put back in as shown in the diagram observe the direction of rotation Before installing the new return spring 4 in the starter hous ing grease it lightly with multipurpose grease Order No 944 360 000 Then position it and press it until the tabs 5 engage in the slots Do not grease the cable drum 2 or bearing journal Screw in bolt 3 but do not ti...

Страница 25: ... 8 to lever out the stop pin 9 as shown in the illustration until the protective hood 11 can be turned NOTE The turn stop 7 is deactivated when the stop pin 8 is removed This permits the hood 11 to be turned farther than the turn stop 7 Unscrew the grip 10 and turn the protective hood 11 as shown in the illustration Disengage the V belt 12 and remove the cutting attach ment NOTE The illustration s...

Страница 26: ...ghten by hand To tighten the V belt see Tightening the V belt Checking V belt tension Screw in and tighten the screw detail X only for PC 8116 Tighten the nuts 17 Þrmly with the combination wrench Replace the grip 18 as shown IMPORTANT When you reposition the cutting attachment the direction of rotation of the cutting wheel changes If a rotation direction is marked on the cutting disc make sure th...

Страница 27: ... to the trolley and Power Cut are very fast and simple Mains pressure water system 6 The mains pressure water system is designed to be mounted on the Power Cut It can be used with or without the trolley but is especially suitable for applications involving hand held stationarycutting Thewaterlinehasafast releaseconnection and can be fed either from a mains supply or from a pressure tank 7 The wate...

Страница 28: ...aler He will also have the spare part lists to determine the required spare part numbers and will be constantly informed about the latest improvements and spare part innovations Please bear in mind that if parts other than original DOLMAR spare parts are used this will automatically invalidate the DOLMAR product guarantee We will furthermore not accept any liability damages arising from the use of...

Страница 29: ...Engine is idling Air Þlter dirty wrong carburetor adjustment may be involved mufßer clogged exhaust channel in cylinder simultaneously clogged Guarantee DOLMAR guarantees the highest quality and will therefore reimburse all costs for repair by replacement of damaged parts resulting from material or production faults occurring within the guarantee period after purchase Please note that in some coun...

Страница 30: ...xtract from the spare parts list Use only original DOLMAR parts For repairs and replacement of other parts see your DOLMAR service centre PC 6412 S 6414 S PC 7312 S 7314 S PC 8114 PC 8116 32 31 29 30 22 28 ...

Страница 31: ...eturn spring in housing 15 923 208 004 2 Hexagonal nut M8 16 941 719 140 1 Universal wrench SW 13 19 17 940 827 000 1 Offset screwdriver T27 18 944 340 001 1 Screwdriver carburetor Accessories not delivered with the Power Cut Diamond cutting disc 22 966 221 020 1 Concrete Standard dia 300 20 mm 22 966 321 020 1 Concrete DiaDuran dia 300 20 mm 22 966 221 010 1 Asphalt Standard dia 300 20 mm 22 966 ...

Страница 32: ...orm 995 703 832 1 07 GB SpeciÞcations subject to change without notice DOLMAR GmbH Postfach 70 04 20 D 22004 Hamburg Germany http www dolmar com To Þnd your local distributor please visit www dolmar com ...

Результаты поиска

Содержание PC-6412 S

Отзывы:

Похожие инструкции для PC-6412 S

Бренды по названию

Популярные бренды

Dolmar PC-6412 S, Инструкция по эксплуатации

Результаты поиска

Содержание PC-6412 S

Отзывы:

Похожие инструкции для PC-6412 S

Бренды по названию

Популярные бренды