background image

:HOOZRUWK$YH-DFNVRQ0,‡3K‡ZZZKHDWFRQWUROOHUFRP

'XHWRRQJRLQJSURGXFWLPSURYHPHQWVVSHFLILFDWLRQVDQGGLPHQVLRQVDUH

VXEMHFWWRFKDQJHDQGFRUUHFWLRQZLWKRXWQRWLFHRULQFXUULQJREOLJDWLRQV'HWHUPLQLQJWKH

DSSOLFDWLRQDQGVXLWDELOLW\IRUXVHRIDQ\SURGXFWLVWKHUHVSRQVLELOLW\RIWKHLQVWDOOHU

$GGLWLRQDOO\WKHLQVWDOOHULVUHVSRQVLEOHIRUYHULI\LQJGLPHQVLRQDOGDWDRQWKHDFWXDOSURGXFW

SULRUWREHJLQQLQJDQ\LQVWDOODWLRQSUHSDUDWLRQV

,QFHQWLYHDQGUHEDWHSURJUDPVKDYHSUHFLVHUHTXLUHPHQWVDVWRSURGXFWSHUIRUPDQFH

DQGFHUWLILFDWLRQ$OOSURGXFWVPHHWDSSOLFDEOHUHJXODWLRQVLQHIIHFWRQGDWHRIPDQXIDFWXUH

KRZHYHUFHUWLILFDWLRQVDUHQRWQHFHVVDULO\JUDQWHGIRUWKHOLIHRIDSURGXFW

7KHUHIRUHLWLVWKHUHVSRQVLELOLW\RIWKHDSSOLFDQWWRGHWHUPLQHZKHWKHUDVSHFLILF

PRGHOTXDOLILHVIRUWKHVHLQFHQWLYHUHEDWHSURJUDPV

03/2017

ZZZPDUVGHOLYHUVFRP

1900 Wellworth Ave., Jackson, MI 49203 • Ph. 517-787-2100 • www.marsdelivers.com

Содержание BG-101P

Страница 1: ...143M BGE 103M BGE 123M BGE 143M Heat Controller 1900 Wellworth Ave Jackson MI 49203 517 787 2100 www heatcontroller com OWNER S MANUAL Room Air Conditioner with R 410A BG 81M BG 101M BG 103M BG 121M BG 123M BG 143M BGE 103M BGE 123M BGE 143M www marsdelivers com Owner s Manual ...

Страница 2: ...here is a gas leak from another appliance May cause electric shock or fire due to excess heat generation May cause electric shock or fire due to heat generation Incorrect grounding may cause electric shock May cause fire and electric shock It may cause fire May cause explosion fire and burns May cause electric shock or fire due to heat generation May cause electric shock May cause failure of machi...

Страница 3: ... is danger of fire or electric shock Operation without filters may cause failure It contains contaminants and could make you sick Stop operation and close windows in storm or hurricane Do not use strong detergents wax or thinner use a soft cloth only Ensure that the outdoor support bracket is not damaged due to prolonged exposure Hold the plug by the head of the power plug when taking it out Disco...

Страница 4: ...ndow you will probably want to clean both sides of the glass first If the window is a triple track type with a screen panel included remove the screen completely before installation Be sure the air conditioner hasbeensecurelyandcorrectlyinstalledaccording to the installation instructions in this manual Save this manual for possible future use in removing or installing this unit When handling the a...

Страница 5: ... not change the plug on the power cord of the air conditioner Aluminum house wiring may present special problems consult a qualified electrician When handling unit be careful to avoid cuts from sharp metal edges and aluminum fins on front and rear coils Save Carton and these Installation Instructions for future reference The carton is the best way to store unit during winter or when not in use NOT...

Страница 6: ... sleeve as follows Clean interior do not disturb seals Wall sleeve must be securely fastened in wall before installing Air Conditioner Drive more nails or screws through sleeve into wall if needed Repair paint if needed 3 If not existing drill a 1 8 clearance hole for grounding screw through left side of wall sleeve in a clear area about 3 inches maximum back from front edge of sleeve using ground...

Страница 7: ...een shipped with the unit in the accessory kit FOR INCREASED EFFICIENCY UTILIZE THE PROVIDED LOUVERED REAR PANEL Installation of new grille provided with unit 1 Remove the existing grille 2 Place the grille included with the new air conditioner towards the rear of the sleeve 3 Mark through the hole positions 4 Drill through the sleeves flanges with a 1 8 drill bit 5 Attach the new grille with self...

Страница 8: ...gled 11 Seal Frame the unit as described on page 17 12 If you have difficulty with mounting the grill to the sleeve follow the instructions for direct mounting on Page 16 1 2 1 2 1 2 2 4 4 4 4 3 8 3 8 1 Emerson 15 Deep 1 Remove existing rear grille as shown on Page 6 of this manual and replace with provided louvered rear panel Install as shown here NOTE You may need to drill holes in flange of exi...

Страница 9: ...he ground wire does not become tangled 1 1 2 1 2 2 1 2 2 Cut Here 3 4 17 Tapered Spacer Block 1 Protection Paper Backing 12 1 2 2 1 2 1 2 1 2 5 4 4 4 4 3 8 3 8 4 The 2 1 2 section is placed in front of the rib on base with the tapered end facing the back of the sleeve Cut the remaining portion to 12 and placed behind the rib again sloping toward the rear of the sleeve This helps induce a rearward ...

Страница 10: ...ood seal making sure the ground wire does not become tangled 1 2 3 4 17 Tapered Spacer Block 1 Protection Paper Backing Cut Here 13 5 4 4 4 4 4 3 8 3 8 3 Install 13 section as shown with the tapered end from the back of the sleeve This helps induce a rear ward slope on the unit 4 Attach 1 1 x 3 8 x 25 long seal in the center at the top of the sleeve Remove the backing paper and press into position...

Страница 11: ...the cabinet 11 Slide the unit completely to the rear to ensure 1 2 5 4 4 4 4 4 3 8 3 8 5 Sears of Carrier 51S Series 18 5 8 Deep 1 Remove existing rear grille as shown on Page 6 of this manual and replace with provided louvered rear panel Install as shown here NOTE you may need to drill holes in flange of existing sleeve to match new rear grille 2 Install 2 tapered spacer blocks to the floor of th...

Страница 12: ...the ground wire does not become tangled 12 Seal Frame the unit as described on page 17 3 4 17 Tapered Spacer Block 1 Protection Paper Backing Cut Here 13 5 4 4 4 4 4 3 8 3 8 3 Install 13 section to the floor of the sleeve as shown This helps induce a rearward slope on the unit 4 Attach 1 1 x 3 8 x 25 long seal in the center at the top of the sleeve Remove the backing paper and press into position ...

Страница 13: ...elow 1 2 1 2 1 2 3 8 3 4 3 4 3 4 3 4 1 2 6 5 12 9 11 13 10 14 1 2 7 4 4 4 4 3 8 3 8 4 4 7 13 7 Whirlpool 23 Deep 1 Remove existing rear grille as shown on Page 6 of this manual and replace with provided louvered rear panel Install as shown here NOTE You may need to drill holes in flange of existing sleeve to match new rear grille 2 Place 2 1 x 1 1 2 x 14 seals against each side 3 Gently slide unit...

Страница 14: ...nit completely to the rear to ensure a good seal making sure the ground wire does 1 2 4 2 3 4 4 4 4 3 8 3 8 8 White Westinghouse Frigidaire Carrier 52F Series 16 17 1 2 Deep 1 Remove existing rear grille as shown on Page 6 of this manual and replace with provided louvered rear panel Install as shown here NOTE you may need to drill holes in flange of exist ing sleeve to match new rear grille 2 Atta...

Страница 15: ...hown on Page 6 of this manual and replace with provided louvered rear panel Install as shown here NOTE You may need to drill holes in flange of existing sleeve to match new rear grille 5 6 4 4 4 4 3 8 3 8 4 4 9 White Westinghouse or Frigidaire 22 Deep 1 Remove existing rear grille as shown on Page 6 of this manual and replace with provided louvered rear panel Install as shown here NOTE You may nee...

Страница 16: ...the sleeve 1 Attach the 2 seal pieces 1 X3 8 X14 as shown in Fig 1 2 Position the grille over the rear of the unit making sure that a The double set of screw holes are at the bottom b The fins of the grill are pointed away from the unit 3 Align the top of the grille with the top of the unit The overhang on each side is equal 4 If the unit has not been pre drilled some models carefully drill 4 1 8 ...

Страница 17: ...the 1 x1 x84 long stuffer seal between the wall sleeve and the unit A flat bladed screwdriver or putty knife is recommended 1 2 2 Assemble the trim frame by inserting top and bottom pieces into side pieces and snapping into place 3 Pull cord through trim frame then slide over unit until flush with wall INSTALLATION INSTRUCTIONS FINISHING INSTALLATION ...

Страница 18: ...due to refrigerant passing through evaporator during normal operation Pinging or Swishing Droplets of water hitting condenser during normal operation may cause pinging or swishing sounds Vibration Unit may vibrate and make noise because of poor wall or window construction or incorrect installation REMOTE SIGNAL RECEPTOR TEMP TIMER Fan Mode Sleep Timer Check Filter Energy Saver Follow Me Auto High ...

Страница 19: ...ture will be maintained for 6 hours before it returns to the originally selected temperature This ends the Sleep modeand the unit will continue to operate as originally programmed The Sleep mode program can be cancelled at any time during operation by pressing the Sleep button again Press Check filter button to initiate theis feature This feature is a reminder to clean the Air Filter for more effi...

Страница 20: ...ssor and possible circuit breaker tripping The fan will continue to run during this time The control is capable of displaying temperature in degrees Fahrenheit or degrees Celsius To convert from one to the other press and hold the Left and Right Temp Timer buttons at the same time for 3 seconds CAUTION Clean your air conditioner occasionally to keep it looking new Be sure to unplug the unit before...

Страница 21: ...in air conditioner TROUBLESHOOTING TIPS Before calling for service review this list It may save you time and expense This list includes common occurrences that are not the result of defective workman ship or materials in this appliance Solution Air conditioner does not start Wall plug disconnected Push plug firmly into wall outlet House fuse blown or circuit breaker tripped Replace fuse with time ...

Страница 22: ...oors windows registers Air conditioner turns on and off rapidly Noise when unit is cooling Water dripping INSIDE when unit is cooling Improper installation Tilt air conditioner slightly to the outside to allow water drainage Refer to installation instructions check with installer Dirty air filter air restricted Clean air filter Air movement sound This is normal If too loud set to a slower FAN sett...

Страница 23: ...Owner s Manual Room Air Conditioner with R 410A BG P BG M BGE M Series 23 THIS PAGE INTENTIONALLY LEFT BLANK ...

Страница 24: ...GDWD RQ WKH DFWXDO SURGXFW SULRU WR EHJLQQLQJ DQ LQVWDOODWLRQ SUHSDUDWLRQV QFHQWLYH DQG UHEDWH SURJUDPV KDYH SUHFLVH UHTXLUHPHQWV DV WR SURGXFW SHUIRUPDQFH DQG FHUWLILFDWLRQ OO SURGXFWV PHHW DSSOLFDEOH UHJXODWLRQV LQ HIIHFW RQ GDWH RI PDQXIDFWXUH KRZHYHU FHUWLILFDWLRQV DUH QRW QHFHVVDULO JUDQWHG IRU WKH OLIH RI D SURGXFW 7KHUHIRUH LW LV WKH UHVSRQVLELOLW RI WKH DSSOLFDQW WR GHWHUPLQH ZKHWKHU D VSH...

Отзывы: