Chevrolet Sail U-VA 2014 Скачать руководство пользователя страница 121

Passenger Compartment Fuse Block

HEX0125

F14

SP

ARE

CIGAR POWER

CENTRAL DOOR LOCK

F14

10A

DOME LAMP 

RR Fog

Vehicle Maintenance 117

F18

15A

DLC, ROOM LAMP 

Содержание Sail U-VA 2014

Страница 1: ... ...

Страница 2: ......

Страница 3: ...equipped with the most advanced technology technicians specially trained by us and genuine spares Needless to say they are also committedtoensureyourcompletesatisfaction So pleasecontactaChevroletretailerforanyservicingneed andmakesurethatonlygenuinesparesareusedforyourcar This Manual will familiarize you with the operation and maintenance of your new vehicle It will also provide you with importan...

Страница 4: ......

Страница 5: ...Doors and Windows 15 Seats and Restraints 29 Storage 45 Instruments and Controls 49 Lighting 67 Climate Control System 71 Driving and Operating 83 Vehicle Maintenance 99 Technical Data 147 Service and Warranty 151 Service Network 181 ...

Страница 6: ... always refers to the direction of travel such as left right frontandback The vehicle display screens may notsupportyourspecificlanguage Certain functions and configura tions described in this Manual do not apply to all models but are dependentonthespecificmodel The Manual contains the latest information available at the time of printing General Motors India Pvt Ltd is responsible for revision and...

Страница 7: ...ignify an item of equipment that is not included on all vehicles Such items include engine options model variations specific to onecountry andoptionalequipment All information illustrations and specifications in this Manual are based on the latest product information availableatthetimeofpublication General Motors India Pvt Ltd reserves the right to change specifications or designs at any time with...

Страница 8: ...4 Foreword ...

Страница 9: ...e the same key to unlock the rear compartment Turn key clockwise to unlocktherearcompartment Seat Position Lift the adjustment lever slide the seat back and forth as required Release the lever Initial Driving Information 5 Seat Adjustment 5 Adjust Front Head Restraints 6 Safety Belts 6 Rear View Mirror Adjustment 7 Instrument Panel Overview 8 Exterior Lighting 9 Horn 11 Windshield Washer Wiper Sys...

Страница 10: ...e release buttonandtakeouttheheadrestraint To lower a head restraint push the release button and push the head restraint down to the desired position andthenreleasethebuttonandsecure Pull out the safety belt strap and insert it into the buckle The belt strap must not be twisted and must be worn fitted closely against the body The seatback shouldnotbeexcessivelyreclined To release the safety belt p...

Страница 11: ...r rear view mirror with day and night adjustment modetopreventdazzling Interior Rear View Mirror Select the corresponding exterior rear viewmirrorandadjustitsposition See Exterior Rear View Mirrors on page23 HEX0006 REAR VIEW MIRROR ADJUSTMENT Exterior Rear View Mirrors Day Night 7 Introduction ...

Страница 12: ...INSTRUMENT PANEL OVERVIEW HEX0008 4 3 6 8 9 10 11 12 14 2 5 7 13 1 15 19 17 16 18 17 5 20 21 8 Introduction ...

Страница 13: ...ch 21 Headlamp rangeadjustmentswitch EXTERIOR LIGHTING Twistthecombinationswitch leverto OFF Turnalllightsoff Parkinglights Headlights Front Fog Lights Your vehicle may be equipped with frontfoglights While the headlights are on parking light or low beam position turn the ring in the middle of the combination switch control lever to ON to turn on the front foglights Turn the ring to OFF position t...

Страница 14: ...l lever back from high beam position Leverup Leftindicator Leverdown Rightindicator Press the switch to turn on or turn off thehazardwarningflashers HEX00013 Headlight Flash High Beam and Low Beam HEX00011 Turn and Lane Change Signal Hazard Warning Flashers ODO ODO HEX00014 10 Introduction ...

Страница 15: ...t high speed Pull the control lever towards you as shown in the picture to wash the windshield HEX0017 1 HORN HEX00015 Windshield Wipers Windshield Washer System WINDSHIELD WASHER WIPER SYSTEM OFF INT LO HI Press the switch on the steering wheelpadtosoundthehorn HEX0016 1 OFF INT LO HI OFF INT LO HI 11 Introduction ...

Страница 16: ...ck the brake function at low speed especially when the brake is wet CLIMATE CONTROL Press the button to operate the rear windowdefrostfunction Indicator light on the button will illuminate Press the button again to turn off therearwindowdefrostfunction To change gears fully depress the clutch pedal move the gearshift lever into gear according to the gear position marked on gear knob and slowly rel...

Страница 17: ...parking the vehicle on level ground or on a slope engage first gear before turning OFF the ignition switch When the vehicle is parked on an uphill slope turn the frontwheelsawayfromthecurb When parking the vehicle on a downhill slope engage reverse gear Starting Engine with the Ignition Switch Turn key to position1 whileturn ing the steeringwheel slightlyfrom left to right to release the steering ...

Страница 18: ...before turning OFF the ignition switch Turn the front wheels towardsthecurb Turn OFF the engine and ignition switch Closethewindows Lockthevehicle Note The engine cooling fan may continue to runaftertheengineisshutdown ...

Страница 19: ...Button 26 Manual Windows 26 Sun Visors 27 Eachnewvehiclecomeswithtwokeys Please keep one key as the backup key The key number is imprinted on the key number label For security purpose please keep your key number label in a safe place rather than inside your vehicle In addition the key number should be recorded in a safe place outsidethevehicle Unauthorized key copies can be preventedbytheseprecaut...

Страница 20: ...ndthehornwillsound Unlock Button Press to unlock doors The hazard warning lamps willflashtwice REMOTE KEYLESS ENTRY HEX0163 Unlock Button LED Lock Button Note The transmitter operating range depends ontheenvironmentalconditions Note Lock and Unlock buttons are disabled whilethekeyisintheignitionswitch Only one key is provided with RKE transmitter The spare key provided is withoutRKEtransmitter Not...

Страница 21: ...oticeably diminished it is an indicationthatanewbatteryisneeded 1 Remove the screw from the back of thetransmittercover 2 Openthetransmittercover HEX0164 Note Replace with CR1616 battery or equivalent 3 Pull the transmitter out of the cover and remove the label carefully then keepitinthecleanplace 4 Remove the old battery Prevent the circuit board from contacting other components 5 Install the new...

Страница 22: ...astes Caution DOOR LOCKS Caution Do not leave children or pets alone in thevehicle Serious injuries could occur The children could operate the power windows or other controls and could evenmakethevehiclemove Do not leave children in the vehicle with the ignition key This can lead to seriousinjuryoraccidents Caution When leaving an unattended vehicle you must lock all the doors and take awayyourkey...

Страница 23: ...s equippedwithachildsafetylock The child safety lock is intended to prevent the rear doors from being accidentally opened by passengers especially children pulling the door handlesfrominside HEX0024 Caution When the child safety lock is set at LOCK position do not pull the door handlefrominsidethevehicle The handle could be damaged otherwise To open the door from outside or inside pullthedoorhandl...

Страница 24: ...or You can activate the central locking system from the driver s door This system will allow you to lock or unlock all the doors at once by using your key from outside or the driver s door lock knob frominside Automatic Locking If this feature is equipped all the doors will be automatically locked once the vehicle starts moving The tailgate or the fuel filler cap cannot be locked automatically as ...

Страница 25: ...ions DOORS Tailgate Release Lever You can open the tailgate by pulling the tailgate release lever which is mounted on the floor to the right of the driver seat HEX0027 1 Warning Exhaust gases can enter the vehicle if it is driven with the tailgate or trunk hatch open or with any objects that pass through the seal between the body and the trunk hatch or tailgate Engine exhaust contains carbon monox...

Страница 26: ...EX0029 Warning Only perform engine compartment checkswhentheignitionisOFF The cooling fan may start operating eveniftheignitionisOFF Caution The following precautions must be observed Before driving pull and check the front edge of the hood to ensure thatthehoodis securelylocked Do not pull the hood release handle whilethevehicleis in motion Do not drive the vehicle with the hood open An open hood...

Страница 27: ...hicle pull the mirrors towards the vehicle Push out to return the mirrors totheiroriginalposition Warning Always keep your mirrors properly adjusted and use them while driving to increase your visibility of objects and other vehicles around you Do not drive while either outside rearviewmirrorisfoldedback Caution Do not operate mirror continuous whiletheengineisnotrunning Thiswilldischargethebatter...

Страница 28: ...ndow switches to operate the front power windows in below sequence fromlefttoright Leftfrontwindow switch Rightfrontwindow switch Power Windows INTERIOR REAR VIEW MIRROR The interior rear view mirror can be manuallyadjustedinfourdirections Interior rear view mirror can be adjusted to day night mode to reduce glaring from the following vehicles Use the adjustment lever to adjust day andnightmode HE...

Страница 29: ...can be struck by passing objects Keep all partsofbodyinsidevehicle Children can operate and become entrappedinpowerwindows Do not leave your keys or unattended childreninyourcar Serious injury or death can occur frommisuseofpowerwindows Pull the switch to raise the window Press the switch to lower the window Release the switch when the window reachesadesiredposition Caution Leaning out of the vehi...

Страница 30: ...r panel Be sure there is no object in the opening beforeclosingthewindows HEX0160 Caution Leaning out of the vehicle can lead to injuriescausedbypassingobjects Do not lean any part of your body out ofthevehicle Caution The unattended vehicle could be stolenwiththewindows open Close all the windows before leaving thevehicle Note The rear windows cannot be fully opened Warning Leaving children helpl...

Страница 31: ...theroadway trafficorotherobjects SUN VISORS Your vehicle is equipped with sun visors to protect the driver and passengersfromdazzling The sun visors can be folded down or swivelled to the side to prevent dazzling The passenger side sun visor has vanity mirror 27 Keys Doors and Windows ...

Страница 32: ...28 Keys Doors and Windows ...

Страница 33: ... drive with the head restraint set totheproperposition Removed or improperly adjusted head restraints can result in serious head and neck injuries in case of a collision Make sure that the head restraints are properlyadjusted beforedriving 30045 The center of the head restraint should be at eye level of the occupants If this is not possible for extremely tall people set to highest position and set...

Страница 34: ...recommended rake is around25degrees Set the seat at a desired position where the driver has a clear view in all directions and of all display instruments The distance between the head and the headlining should be at least the widthofonehand Thighs should be comfortably supportedontheseat Adjust the seatback to ensure that Do not sit nearer than 25cm 10in to the steering wheel to permit safe airbag...

Страница 35: ...t while thevehicleismoving Adjust the driver seat only when the vehicleisnotmoving Warning Things you put on this seatback can strike and injure people in a sudden stop or turn or in a crash Remove or secureallitemsbeforedriving Warning Sitting in a reclined position when the vehicle is in motion can be dangerous Even when buckled up thesafetybeltscannotdotheirjob The shoulder belt will not be aga...

Страница 36: ... fold the rear seatbacks to their originalposition 1 Lift the rear seatbacks to push them to their original position and then lock the seatbacks Be sure the safetybeltisoutoftheway 2 Pull the seatbacks forward again to makesuretheyarelockedfirmly Caution When the rear seats are occupied make sure that the rear seatbacks are in the rearmost position and locked beforedriving Do not pull the release ...

Страница 37: ...injuredintheeventofacollision Warning Improper use of a safety belt can cause serious injury Do not modify the safety belt Do not add any device which would affect the operation of thesafetybelt Warning Before you close the door make sure the safety belt is out of the way Otherwise the belt and or the vehiclebodycouldbedamaged 33 Seats and Restraints Safety Belt Care Keepbeltscleananddry Warning D...

Страница 38: ...ot place anything e g a handbag or a mobile phone between the safety beltandyourbody Warning Never put the safety belt against hard objects or fragile items inside your pockets 34 Seats and Restraints Seat Belt Release HEX0041 To release the safety belt push the red buttononthebuckle The belt will retract automatically Guide the safety belt as it retracts to prevent the latch plate from damaging i...

Страница 39: ...e buckle into the locking ring at the other end Press the red button to releasethesafetybelt BeltForceLimiter Fitted to the front seat belt the belt force limiter can reduce the pressure on the body through the controlled release of the safety belt in case of collision accident Lap Belt 35 Seats and Restraints Front Seat Belt Pretensioner Warning Improper operation such as removal or installation ...

Страница 40: ...ohotbeforeplacingachildthere Be sure that if children are too small to be well restrained by the safety belt system that they are secured in anappropriatechildrestraint The child restraint suitable for ISOFIX universal category can be used The child restraint is not equipped with vehicle Child restraints can only be used in rear seatingpositions There are no anchor brackets available for front sea...

Страница 41: ...p The top strap anchor brackets are located at the joint between the left and right rear seatbacks on the rear compart ment floor Floor mat have a notch above itself you can open the floor matfromthenotchtouse 37 Seats and Restraints 6 Push and pull the child restraint in different directions to make sure it issecure 7 Make sure the child restraint is not toohotbeforeplacingachildthere If you have...

Страница 42: ... up against or very close to any airbag when it inflates can be seriously injured or killed Do not sit unnecessarily close to any airbag as you would be if siting on the edge of the seat or leaning forward Safety belts help keep you in position before and during a crash Always wear a safety belt even with airbags The driver should sit as far back as possible while still maintaining control of the ...

Страница 43: ...ing posture for adults and teenagersisasshown HEX0045 Right posture All passengers including the driver should always fasten safety belts so that the risk of injury during collisionscanbeminimized Airbags normally do not inflate on Always fastensafetybelts a rear or side impact In these kinds of collisions passengers who do not wear safety belts will not be protected by protective devices thusresu...

Страница 44: ... be thrown onto your face and your upper body when the airbag is inflated resultinginseriousinjury Children and pets must not sit on passenger s laps Anything that may hurt the passenger when the airbag is being inflated should not be placedonhisorherlap Do not install any non geniune accessories on the steering wheel or instrument panel since they may hinder the airbag from being inflated interfe...

Страница 45: ...lated Contact your CHEVROLET retailer when your carneedsscrapping If you sell the car inform the new Caution If your car is severely damaged and the airbag is not inflated or your car is not severely damaged but the airbag is activated this does not necessarily mean there is a fault with theairbagsystem Collision sensors detect the rate of change of speed in an axial direction ratherthantheextento...

Страница 46: ... to inflate in moderate to severe frontal or near frontal crashes to help reduce the potential for severe injuries mainly to the driver s or outboard front passen ger s head and chest However they are only designed to inflate if the impact exceeds a predetermined deployment threshold Deployment thresholds are used to predict how severe a crash is likely to be in time for the airbags to inflateandh...

Страница 47: ...ws down What MakesanAirbagInflate In a deployment event the sensing system sends an electrical signal triggering a release of gas from the inflator Gas from the inflator fills the airbag causing the bag to break out of the cover and deploy The inflator the airbag and related hardware are all part of the airbag module Frontal airbag modules are located inside the steering wheelandinstrumentpanel 43...

Страница 48: ...bag inflation does not prevent the driver from seeing out of the windshield or being able to steer the vehicle nor does it prevent peoplefromleavingthevehicle Caution If an airbag covering is damaged opened or broken the airbag may not work properly Do not open or break the airbag coverings If there are any opened or broken airbag covers have the airbag covering and or airbag module replaced For t...

Страница 49: ...ormation 48 Glove Box Glove box can be opened by pulling the handle Closethegloveboxwithafirmpush 45 Storage Instrument panel storage compartment is located on right side of the instrument panel Pull the handle to open the storage compartment To close the compartment firmly push thedoor HEX0046 1 0 1 2 3 HEX0047 1 Warning Keep the door of glove box closed while driving to reduce the risk of injury...

Страница 50: ... a burn to the driver could lead to loss of controlofthevehicle To reduce the risk of personal injury in the event of sudden stop or collision do not place uncovered or unsecured bottles glasses cans etc in the cup holder while the vehicle is inmotion The front cup holders are located in the storage recesses on the inner panels of thefrontdoors The rear cup holders are located in the rearpartofthe...

Страница 51: ...front seat passenger s door and the rear doors Passengers can use the grips for assistance in entering exiting the vehicle or for hand holds during the vehicleinmotion Caution Hanging items on your vehicle s assist grips can obstruct the driver s view Do not hang anything on the assist grips unless they are equipped with acoathook Obstructing the driver s view can lead to an accident resulting in ...

Страница 52: ...ove theupperedgeoftheseatback Do not place any objects on the instrumentpanel Luggage must not impede the operation of the pedals parking brake or gear shift The driver s movements must not be restricted Do not put any loose objects in the vehicle Do notdrivewiththetailgateopen Driving with a roof load increases the sensitivity of the vehicle to cross winds and has a detrimental effect on vehicle ...

Страница 53: ...Fuel Level 58 ABS Warning Light 58 49 Instruments and Controls Warning Light for Airbag 59 Warning Light for Brake System 60 Warning Light for Battery Charging System 61 Warning Light for Engine Oil Pressure 62 Malfunction Indicator Light 62 Door Ajar Light 63 Engine Coolant Temperature Warning Light 64 FrontFogLightIndicator 64 Driver Seat Belt Warning Light 64 Turn Signal Hazard Warning Flashers...

Страница 54: ...ration LO Wiping continuously at low speed HI Wiping continuously at high speed Steering Wheel Adjustment For vehicleswithatiltwheel 1 Hold the steering wheel and pull the leverdown 2 Move the steering wheel up or down 3 Pull the lever up to lock the steering wheelinplace Do not adjust steering wheel unless vehicleisstationary Caution If strong impact delivers to steering column axle direction whe...

Страница 55: ...Less than clear vision for the driver can lead to an accident resulting in personal injury and damage to your vehicleorotherproperty Do not operate the windshield wipers when the windshield is dry or obstructed as with snow or ice Using the wipers on an obstructed wind shield can damage the wiper blades wipermotor andglass Check that wiper blades are not frozen to windshield before operating in co...

Страница 56: ...te window is dry or frozenwithiceandsnow When the wiper is used with obstacles on the window glass the wiper blades wiper motor and window maybedamaged In freezing weather conditions first check whether the blade is frozen onto the window before using the wiper The wiper motor may be damaged when the wiper is used with itsbladefrozen Caution Tailgate Window Wiper Washer System To use the tailgate ...

Страница 57: ... way When the cigarette lighter is ready to useitwillautomaticallypopout Depending on vehicle model an accessory power outlet may be equippedhereonsomevehicles Only when the ignition switch is in ACC ACCESSORY or ON position theaccessorypoweroutletcanbeused Cigarette Lighter Accessory Power Outlet HEX0052 1 The 12V accessory power outlet can be used to plug in electrical equipment suchascellphoneo...

Страница 58: ...one please keep to the speedlimit HEX0027 1 km h 54 Instruments and Controls Caution Overheating the cigarette lighter can damage the heating element and the lighteritself Do not hold the lighter in while it is heating This can cause the lighter to overheat Trying to operate malfunctioning cigarette lighter can be dangerous If the heated cigarette lighter does not pop out pull it out and consult a...

Страница 59: ...the last reset To reset the trip odometer press and hold the mode selection button under the speedometer until it is reset to zero Press the mode selection button briefly to switch between odometer and trip odometer HEX0055 ODO ODO Caution It is prohibited by law to operate the odometerillegally Tachometer The digital tachometer displays the engine speed in revolutions per minute rpm Drive in a lo...

Страница 60: ...ning in the tank the top up quantity may be less thanthespecifiedtankcapacity Movement of the fuel within the fuel tank causes the fuel gauge display to change when you brake accelerate or turn X1000r min F E 56 Instruments and Controls Before refueling switch off engine and any external heaters with combustion chambers Switch off anymobilephone Vaporised fuel can be ignited by electromagnetic wav...

Страница 61: ...HEX0058 Instrument Cluster 57 Instruments and Controls ODO km h X1000r min F E ...

Страница 62: ...t should go off If it does not have thevehicleserviced Caution Do not let your vehicle run out of fuel This can damage the catalytic converter When this warning light illuminates please fill the fuel tank as soon as possible See Fuel on page 93 See Diesel Fuel SystemBleedingonpage96 ABS Warning Light HEX0060 If the vehicle is equipped with ABS when the ignition switch is turned ON the ABS warning ...

Страница 63: ...rned ON the airbag warning light will illuminate briefly This shows that the indicator light bulb and airbag systems are functioningproperly HEX0061 Caution If the airbag warning light flashes or stays on when driving it indicates a fault in the airbag system The airbag system will be disabled and cannot be triggered when an accident occurs Consult your CHEVROLET retailerfornecessaryrepair If an a...

Страница 64: ...lisions resulting in personal injury and damage to your vehicle or other property If the parking brake is fully released and the brake system warning light still illuminates it indicates that the brake fluid level in its fluid reservoir is too low To rectify this please perform the followingsteps 1 Carefully drive the vehicle away fromthecarriagewayandstop 2 Checkthebrakefluidlevel 3 Add the recom...

Страница 65: ... and the ignition switch is turned ON even if the warning light is working correctly consult your CHEVROLET retailer to have the vehicle s brake system checked These situations indicate that your vehicle s brake system may have a fault If the vehicle s brakes are not kept in good working condition this may lead to collisions resulting in personal injury and damage to your vehicleorotherproperty HE...

Страница 66: ... low can also damage the engine The repairs would not be covered by the vehicle warranty Check the oil level as soon as possible Add oil if required but if the oil level is within the operating range and the oil pressure is still low have the vehicle serviced Always follow the maintenance schedule for changingengineoil If the oil level is too low add specified engineoiltoasuitablelevel If the leve...

Страница 67: ...icle will switch to an emergency operation program so that you can continue to drivethevehicle However at this time you should drive to your CHEVROLET retailer as soon aspossible If the MIL illuminates for a while then extinguishes itself it is normal It does notmeanthatthesystemhasafault This light comes on when a door is open or not securely latched Before driving checkthatalldoors areproperlycl...

Страница 68: ...em Stop the vehicle and turn off the engine to avoid damage to theengine HEX0067 HEX0068 Front Fog Light Indicator When the front fog lights are on the indicatorlightilluminates SeeFrontFog Lightsonpage69 Driver Seat Belt Warning Light HEX0070 When the ignition switch is ON the safety belt warning light will illuminate briefly This means that the system is carryingoutaself test Thereafter unless t...

Страница 69: ...ndicators are essential for safedriving If the bulb in the turn signal light or hazard warning flasher is blown it mustbereplacedimmediately If these indicators are not kept in good working condition this may lead to accidents resulting in personal injury and damage to your vehicleorotherproperty Caution If the flashing time is shorter than normal it indicates that the turn signal light bulbs have...

Страница 70: ...ing it indicates the need for draining of the water separator Please visit the nearest CHEVROLET retailerforthewaterdraining Water in Fuel Indicator Light Illuminates when the ignition is ON and stays on for a short time or may go off right away The waiting time will vary according to the engine coolant temper ature When the glow plugs are sufficiently heated for cold starting the light will go ou...

Страница 71: ...eadlamps and all the abovelightsilluminate Exterior Lighting 67 Headlight Switch 67 High Beam 68 Headlamp Flash 68 Misted Lamp Covers 68 Hazard Warning Flashers 69 Turn and Lane Change Signal 69 Front Fog Lights 69 Reverse Lights 69 Headlamp Range Adjustment 70 Interior Lighting 70 Reading Light 70 Rear Compartment Light 70 When the ignition switch is turned to LOCK or ACC ACCESSORY position the h...

Страница 72: ...when you approach on coming vehicles or whenothervehiclesareahead High beam headlamps can tempor arily blind other drivers which could resultinacollision ODO To make the headlamps high beam flash pull the combination switch lever towards you and release When you release it the lever will return to the normalposition If you pull the combination switch lever towards you and hold the headlamp highbea...

Страница 73: ...turn to the normal position 69 Lighting Front Fog Lights While the headlights are on parking light or low beam position turn the ring in the middle of the combination switch lever to ON to turn on the front fog lights Turn the ring to OFF position to turnoff thefrontfoglights ODO HEX0013 1 Hazard Warning Flashers Press the switch to turn on or turn off thehazardwarningflashers HEX0014 Reverse Ligh...

Страница 74: ...losed INTERIOR LIGHTING HEX0073 ON OFF ON OFF 0 1 2 3 HEX0169 Headlamp Range Adjustment The headlamp range adjustment knob is locatedattherightofinstrumentpanel To adapt headlamp range to the vehicle load to prevent dazzling turn knob to requiredposition 0 Driver sseatoccupied 0 Frontseatsoccupied 1 Allseatsoccupied 2 All seats occupied and load in the luggagecompartment 3 Driver s seat occupied a...

Страница 75: ...ribution Mode Selector 74 Recirculation Mode Button 76 Air Conditioning System 77 Air Conditioning Button 78 Cool Air 78 Warm Air 79 Ventilation 79 Rear Window Defroster Button 80 Defrosting and Demisting 81 Maintenance 82 Air Intake 82 A C Mesh Filter 82 Air Conditioning Regular Operation 82 71 Climate Control System ...

Страница 76: ...72 Climate Control System AIR VENTS 1 1 2 4 4 5 5 3 1 Sideairvent 2 Windshielddefrostervent 3 Centerairvents 4 Floorvent 5 Frontsidewindowdefrostervent 6 A CControlpanel 6 ...

Страница 77: ...o the side windows especially to the area near the exterior rear view mirrors 73 Climate Control System 1 Temperaturecontrolselector 2 Fancontrolselector 3 Airdistributionmodeselector CONTROL PANEL AC 4 5 3 1 6 2 HEX0097 4 Air conditioning A C button 5 Recirculationbutton 6 Rearwindowdefrosterbutton Sideairvent You can direct airflow to the front passenger area or to the side windows throughthetwo...

Страница 78: ...he amount of airflow by turning the fan speed control knob Turn the knob clockwise to increase fan speed or counterclockwise to decrease fanspeed You can set the fan speed control knob between1to4 asdesired Air Distribution Mode Selector Turn the knob to the desired mode according to the desired airflow direction The air distribution selector can be set tooneofthefivepositionsasfollows Temperature...

Страница 79: ...ing through the center and side vents Most of the air flows through the floor vents with a small amount of air through the windshield and front window defroster vents as well as side vents Front mode This mode directs airflow through the centerventsandsidevents Dualmode Floormode HEX0101 1 HEX0102 1 HEX0103 1 ...

Страница 80: ...rculationwillstart Press the button again to switch to fresh air mode The indicator light on the buttonwillturnoff Floor defrosting mode This mode directs airflow through the windshield defroster vent front window vents floor vents and side vents Defrosting mode Recirculation Mode Button AC Note In this mode air conditioning system wouldautomaticallyswitchonthecom pressor and switch off the recirc...

Страница 81: ...s is normal because your cooling system removes moisture from the air Note Because the compressor of the air conditioning system shares the engine power you may notice a slight drop in engine power and performance when the compressor is operating Warning Driving with recirculation mode for prolonged period of time can make you sleepy Periodically turn to the outsideairmodeforfreshair The exchange ...

Страница 82: ...s the air conditioning A C button again The indicator light on the button turns off to indicate that the air conditioningstopsworking The air conditioning system will turn on automatically when the vehicle is started if it was working when the enginewas shutdownlasttime Cool air Maximizecooling For quick cooling in hot weather or after the vehicle has been exposed to direct sunlight for an extende...

Страница 83: ...selector to the maximum position in theredareatoobtainwarmair 5 Turn the fan control selector to the maximumspeed Normalheating 1 Turn off the air conditioning A C Theindicatorlightturnsoff 2 Turn off the recirculation The indicatorlightturnsoff 3 Turn the air distribution selector to floormode ordualmode 4 Turn the temperature control selector to the red area to obtain warmair 5 Turn the fan cont...

Страница 84: ...trunning Vehicleisnotstarted There is a build up of snow or ice ontherearwindow Operating the rear window defroster under these conditions could drain thebattery This can damage your vehicle requiring the replacement of some parts To turn on the defroster switch ON the ignition and then press the rear window defroster button The indicator light on thebuttonwillturnon The defroster will turn off ap...

Страница 85: ...system will automatically control the compressor operation and air recirculation mode Indicated by the A C indicator light on and recirculationindicatorlightoff 4 In order to keep the windshield clean and direct warm air to the floor turn the air distribution selector to the floor defrosting position Then the air conditioning system will automatically control the compressor operation and air recir...

Страница 86: ...time of year Operation with cooling is not possible when outside temperature islow Service For optimal cooling performance it is recommended to annually check the climatecontrolsystem Functionalityandpressuretest Heatingfunctionality Leakagecheck Checkofdrivebelts Cleaning of condenser and evapo ratordrainage Performancecheck Caution Use onlycorrectrefrigerant Warning Climate control systems are s...

Страница 87: ... Fuel System Bleeding 96 Engine Exhaust 96 Catalytic Converter 97 Driving and Operating 83 Punctureduringdriving When driving turn on the hazard flashers if a tire is punctured Hold the steering wheel firmly lift your foot off the accelerator pedal and slow the vehicle gradually Press the brake pedal gently and drive the car into a safe area tochangethetire Faultsduringdriving When a fault occurs ...

Страница 88: ...safe placeandtakethefollowingmeasures Run the engine at idle and then move the gear shift lever into neutral Applytheparkingbrake Turnoff theairconditioning Open the hood to ventilate the enginecompartment Warning If steam or coolant escapes from the engine do not open the hood otherwise you may be scalded by the steamorcoolant If the coolant level does not drop while the engine is idling switch o...

Страница 89: ...t the snow clearing work Keep a safe distance from other cars avoidunnecessarybraking Frequent cleaning of the snow surrounding the vehicle can protect the exhaust pipe from being blocked Driving and Operating 85 Driving with Diesel Engine Vehicle The turbocharger element rotate very fast If the oil supply to running parts stops the turbocharger system may be seriously damaged The owner should be ...

Страница 90: ...tch has the following positions LOCK ACC ON andSTART LOCK To lock the steering wheel remove the key and turn the steering wheel clockwiseuntilitislocked In order to operate the key while unlocking the steering wheel turn the steering wheel from left to right gently and then turn the key to the ACC position 86 Driving and Operating Operate the engine above idle only after normal engine oil pressure...

Страница 91: ...OFF position Otherwise the driver will lose control over the car and the brake booster will not function properly which will lead to vehicle damage andinjury Caution Do not operate the key through the steeringwheel Otherwise the steering wheel may turn suddenly causing the driver to lose control over the vehicle and lead tovehicledamageandinjury Driving and Operating 87 Caution When the engine is ...

Страница 92: ...ingformorethan10seconds If the engine does not start please waitfor10secondsandtryagain This can prevent damages to the startermotorandbatterydischarge formorethan3minutes Excessive temperature can damage the exhaust system catalytic converter Do not idle the engine at high rpm Caution 88 Driving and Operating Immobilizer Operation The immobilizer system provides an additional theft deterrent to y...

Страница 93: ...he vehicle is parked on an upward or a downward slope and meanwhiledepress thefoot braketo reducetheforceapplied After running at high engine speeds or with high engine loads operate the diesel engine briefly at a low load or run in neutral for about 1 to 2 minutes at idle speed before switching off in order to protect the turbocharger Turn off the engine and ignition switch Turn the steering whee...

Страница 94: ...ar wheels A dual circuit brake system is used If one brake circuit is ineffective the other circuit can still be used to stop the vehicle but the braking distance will increase and depressing the brake pedal willalsorequireagreaterforce Caution If one of the brake circuit fails depressing the brake pedal will be difficult and the braking distance will also increase Contact your CHEVROLET retailer ...

Страница 95: ...a safe speed make sure that there is enough space behind andtobothsidesofyourvehicle 3 Depress the brake carefully until performancereturnstonormal Anti lock Braking System Your vehicle may be equipped with this function The Anti lock Braking System is an advanced electronic brake system which helps to prevent slip and skidding This system can help to bypass obstacles when braking suddenly and pro...

Страница 96: ...g brake on This can cause your rear brakes to overheat or wear out prematurely You may have to replace them and you could damage other parts of your vehicle Caution Caution Do not park or operate your vehicle overcombustiblematerials They could touch hot exhaust parts underyourvehicleandignite HEX0110 1 Parking Brake The parking brake acts on the rear wheels The parking brake lever is positioned b...

Страница 97: ...el fuels such as rape seed oil or bio diesel Aquazole and similar diesel water emulsions Diesel fuels must not be diluted with fuels used on petrol engines The flow and filterability of diesel fuel are temperature dependent When temperatures are low refuel with diesel fuelwithguaranteedwinterproperties Caution Use of fuel that does not comply to EN 590 or similar can lead to engine powerloss incre...

Страница 98: ...If the fuel filler door does not open in cold weather tap the door lightly Then trytoopenitagain Note Fuel is a flammable and explosive material No smoking No open flames or sparks If you can smell fuel in your vehicle have the cause of this remedied immediately by a CHEVROLET retailer Danger Before adding fuel switch off the engine and any external combustion heatingdevice Turn off cell phones Wh...

Страница 99: ...ng sound wait until it stops before unscrewing the cap The fuel filler doorisintheleftrearquarterpanel 4 Open the cap The cap is tethered to thevehicle If you can smell fuel in your vehicle have the cause of this remedied immediately by a CHEVROLET retailer Danger Caution Be sure to use the correct fuel diesel corresponding to your vehicle when refueling If you fill petrol in your diesel powered v...

Страница 100: ...mes or sparks Follow the operating and safety instructions of the filling station whenrefueling Remove static electricity on your hands by touching something able to release static electricity when touching or opening fuel cap or refueling nozzle Caution Wipe off any overflowing fuel immediately Danger Fuelfillercap Only a genuine fuel filler cap provides full functionality Diesel engined vehicles...

Страница 101: ...t be seen or smelled Exposure to CO can cause unconsciousness and even death Exhaustmayenterthevehicleif Ÿ The vehicle idles in areas with poor ventilation parking garages tunnels deep snow that may block underbodyairflowortailpipes Ÿ The exhaust smells or sounds strangeordifferent Ÿ The exhaust system leaks due to corrosionordamage Ÿ The vehicle exhaust system has been modified damaged or imprope...

Страница 102: ...converter during engine operating and it can be possible to touch the catalytic converter after cooling down the catalytic converter because the catalytic converter is very hot so the skin i e hand or body can be burned cooling down condition cool down over two hours under ambient temperatureafter enginestop 98 Driving and Operating ...

Страница 103: ...e Parking Brake Travel 114 Fuses 115 Fuse Blocks 116 Passenger Compartment Fuse Block 117 Engine Compartment Fuse Block 118 Bulb Replacement 119 Headlights 119 Parking Lights 120 Front Turn Signal Lights 120 Front Fog Lights 121 Side Turn Signal Lights 121 Reverse Lights Tail Lights Stoplights Rear Turn Signal Lights 121 Central High Mounted Stoplight 122 License Plate Light 123 Dome Light 123 Rea...

Страница 104: ...rosionprotection Adjust tire pressure to the value specifiedforfullload Park the vehicle in a dry well ventilated place For manual transmission engage first or reverse gear Prevent the vehicle fromrolling Do notapplytheparkingbrake Open the hood close all doors and lockthevehicle Caution Never modify your vehicle It may affect the performance durability and safety of the vehicle and the warranty m...

Страница 105: ...eel is Regularly check the interior exterior and engine compartment of the vehicle toensuresafetyandreliability Vehicle Maintenance 101 Radio Frequency Identification RFID Tag This vehicle is equipped with Radio Frequency Identification RFID tag which can be used for Electronic Toll Collection ETC or any other applica tions as decided by the Regulatory authority from time to time The RFID tag is l...

Страница 106: ...ne LDV 102 Vehicle Maintenance 1 Airfilter 2 Engineoilfillercap 3 Brake Clutchfluidreservoir 4 Coolantreservoir 5 Fuse andrelayblock 6 Battery 7 Windshieldwasherfluidreservoir 8 Power steeringfluidreservoir 9 Engineoildipstick HEX0113 SMARTECH 3 ...

Страница 107: ...l on the dipstick Make sure the oil is not contami nated 7 Check the oil level by using the oil dipstick The level should be betweentheMIN andMAX limits 8 Add engine oil of the same grade as recommended if the level is below the lower limit Bring the level up to butnotabovetheupperlimit The engine oil filler cap is located on the cylinder head cover See the Engine Compartment Overview on page102 C...

Страница 108: ...you use has the ACEA A3 B4rating Choosing the Right Oil Viscosity HEX0117 SAE 5W 30 is the recommended engineoilforyourvehicle When choosing an oil consider the range of temperature your vehicle will be operated in before the next oil change Then select the recommended oilviscosityfromthechart 104 Vehicle Maintenance HEX0116 ...

Страница 109: ...filter each time you change the engine oil Under severe conditions you must change the oil and filter more fre quently than is recommended in the standardmaintenanceschedule Caution Use of unauthorized or low quality engine oil or chemical engine treatments additives can damage the engine and void your vehicle warranty Severe conditions include but are not limitedto Frequentcoldstarting Frequent d...

Страница 110: ...lain water alcohol or methanol antifreeze in coolant system Use only General Motors India Pvt Ltd recommended coolant available withyour CHEVROLETretailer The engine may overheat or even catchfire Do not dispose of used engine oil and filterwithyourhouseholdwaste See your local authorized waste managementfacility Used engine oil and filter contain harmful elements that may be unhealthy to you and ...

Страница 111: ... either an indication of a leak in the brake clutch system or a normal indication caused by usual brake pad lining wear Consult your CHEVROLET retailer to determine if the system needs repair and add fluid after work is done on your hydraulic brake clutch system if it is required If the brake clutch fluid level is low the brake system warning light will come on See Warning Light for Brake Systemon...

Страница 112: ...r immediately Caution Brake fluid can catch fire if spiltontheengine Wipeoff thetopofthereservoir If the engine catches fire it could cause personal injuries and damage toyour vehicleandotherproperty clutch 4 Refitthecap Caution Do not dispose of used brake fluidwithyourhouseholdwaste Use your local authorized waste managementfacility Used brake clutch fluid and their containers are hazardous They...

Страница 113: ... fluid should be added according to the instructionsinthisManual This job requires special skills and equipment In order to prevent personal injury or vehicle damage we suggest you to have this work done at your CHEVROLETretailer Note Use of the incorrect fluid may damage the vehicle Always use the fluid listed inFluidChartonpage150 Warning An overflow of the fluid may cause the fluid to burn or d...

Страница 114: ...nded to use special ready to use washer fluid If concen trated washer fluid is to be used please add water to dilute the fluid according to instructions of the manufacturer Do not use plain water The minerals or foreign substances in plain water can clog the pipes of the windshield washer If the air temperature is likely to fall below freezing use windshield washer fluid which has sufficient anti ...

Страница 115: ...her containing siliconeresintothewindshieldglass Otherwise stripes will appear on the glass and the driver s vision will be affected Do not use solvents gasoline kerosene or paint thinners to wash the wipers These substances are corrosive and could damage the wipers and painted surfaces Caution Do not run the wiper blades on dry dusty glass always spray water from windshield nozzle before switchin...

Страница 116: ...rly the drive belt should be in good condition andshouldbeadjustedproperly Replace the drive belt if it is worn cracked orfrayed Caution The engine could be started unexpectedly if the key is left in the ignition Do not leave the key in the ignition whilecheckingthedrivebelt Moving engine parts can cause serious injuries while the engine is running BATTERY Your vehicle is equipped with a battery t...

Страница 117: ...ry cables to the wrong terminals can result in injury and damage to the vehicle and other property Note Always reconnect the positive terminal first always disconnect the negative terminalfirst Battery Maintenance To extend the life of your vehicle battery dothefollowing Keepthebatterymountedsecurely Keep the top of the battery clean anddry Keep the terminals and connections clean tight and coated...

Страница 118: ...ly the parking brake and count the notch clicks If the number of clicks or the force you feel you are applying differs from the above specification consult your CHEVROLET retailer toadjusttheparkingbrake 114 Vehicle Maintenance Warning Keep smoking materials away from the battery to avoid flames or sparks when the battery is checked because theexplosivegascouldbeoccurred If the battery explodes it...

Страница 119: ...etal can cause a short circuit damage the electrical system or start a fire Seriousinjurycouldoccur 4 Identify the reason for the fuse blowingandsolvetheproblem 5 Replace the fuse with a new one of the correct rating See the layout of fuseblockslaterinthissection Caution Using a fuse substitute or a fuse of the wrong type or rating can damage the electrical system or even start a fire Be sure to u...

Страница 120: ...gebox The passenger compartment fuse HEX0123 1 0 1 2 3 Passengercompartmentfuseblock Enginecompartmentfuse block is located next to the coolant reservoir The engine compartment fuse block 116 Vehicle Maintenance Caution Spilling liquid on any electrical component on the vehicle may damage it Always keep the covers onanyelectricalcomponent ...

Страница 121: ...Passenger Compartment Fuse Block HEX0125 F14 SPARE CIGAR POWER CENTRAL DOOR LOCK F14 10A DOME LAMP RR Fog Vehicle Maintenance 117 F18 15A DLC ROOM LAMP ...

Страница 122: ...EAD LP EF12 15A FRT O2 SNSR EF13 15A RR O2 SNSR EF14 30A MAIN RELAY EF15 10A ECU EF16 15A INJECTOR EF17 15A ECU2 EF20 15A TCM EF21 30A ELE PUMP EF25 10A H_LP LO LH EF26 10A H_LP HI LH EF27 10A H_LP LO RH EF28 10A H LP HI RH J Case fuse JEF1 30A PWR WINDOW JEF2 40A BLOWER MTR JEF3 40A COOLING FAN JEF4 40A ABS JEF5 30A ACC ING1 JEF6 30A ING2 START JEF7 30A BATT TO IP 118 Vehicle Maintenance FUEL HEA...

Страница 123: ...acement 1 Openthehood 2 Disconnect the wiring harness connectorfrombehindthebulb 3 Turn and remove the upper end of the windshield washer reservoir Only for the bulb on the left hand side 4 Removetheheadlightcap 5 Release the spring that retains the bulb 6 Removethebulb HEX0127 7 Install a replacement bulb of the samerating See Bulb Specifications on page 124 8 Reinstallthebulbretainingspring 9 Re...

Страница 124: ...e panel it is recommended to have the bulb replaced at your CHEVROLETretailer Front Turn Signal Lights Bulb replacement HEX0129 1 Openthehood 2 Remove the wheel arch panel and thenremovethefrontbumper 3 Removetheheadlightassembly 4 Turn the front turn signal light bulb socketcounterclockwise 5 Pull the front turn signal light bulb socketoutofthelighthousing 6 Pull the bulb straight out of the sock...

Страница 125: ... bulb of the samerating 5 Insert the socket into the lamp and turnitclockwise 6 Refitthewheelarchpanel Reverse Lights Tail Lights Stoplights and Rear Turn Signal Lights Bulb replacement HEX0131 1 Open the tailgate remove the tailgatetrimpanelnexttothelights 2 Remove one tail light nut in the tailgate trim panel and two tail light screws next to the tailgate and removethetaillightassembly 3 Turn th...

Страница 126: ...taining screws pull out the wiring harness plug and remove the high mounted stoplight assembly 2 Pry the lens remove two screws andthenremovethebulbsocket 3 Pull the bulb base out of the bulb socket 4 Pull the bulb straight out of the socket 5 Install a new bulb See Bulb Specificationsonpage124 Bulb replacement Central High Mounted Stoplight HEX0132 6 Reinstallthesocket 7 Reinstall the bulb socket...

Страница 127: ...ght assembly from the housing 2 Replace the bulb See Bulb Specifi cationsonpage124 3 Reinstallthelightassembly ON OFF Bulb replacement License Plate Light 1 Remove the license plate light as semblydirectlywithyourhands 2 Turn the bulb socket counterclock wisetoremoveitfromthehousing 3 Pullthebulboutofthesocket 4 Replace the bulb See Bulb Specificationsonpage124 5 Turnthebulbsocketclockwisetore fit...

Страница 128: ... x 2 5W x 2 21 5W x 2 21W x 2 21W x 2 5W x 2 5W x 4 10W x 1 10W x 1 Note H4 60 55W W5W WY21W H8 35W WY5W P21 5W P21W PY21W W5W W5W 12V10W 12V10W Bulb HEX0136 2 1 3 4 5 Bulb specifications in some models can be different from the above table See the wattageprintedonthebulbbeforereplacingburntbulbs Warning The same rating of the bulb to be used during replacement and any usage of higher wattage bulb...

Страница 129: ...essure should comply with the specifications in this Manual to ensure optimal ride comfort safety and performance The tire pressure label is onthedriver sdoorframe Use a calibrated tire pressure gauge to check the tire pressure when the tires are cold Tighten the valve caps after checking Caution Tire pressure should be checked whenthetiresarecold The readings will not be correct when the tires ar...

Страница 130: ...eadtopersonalinjuries If your tires or wheels have been damaged or abnormal wear is detected consult your CHEVROLET retailer Your vehicle is equipped with radial tires General Motors suggests you to use a tire of the same size pattern tread wear temperature and speed rating for replacement Caution Using a tire of a size different from the original tires can cause interfer ence between the tire and...

Страница 131: ...res To make your tires last longer and to avoid uneven tread wear 1 Have the tires rotated according to the maintenance schedule in the Manual 2 Maintainapropertirepressure 3 Inspectthetightnessofwheelnuts Caution Always use the recommended wheels and recommended wheel nuts Otherwise you could lose control of the vehicle and cause a collision resulting in personal injury or damage to your vehicle ...

Страница 132: ...ires can affect driving performance Please note the precautions on the spare tire labeling where applicable Replace the defectivetireassoon aspossible Changing awheel Observe the following instructions whenchangingawheel Never position yourself below a vehicle when it is supported by a jack Never let the engine continue to run or start the engine while changing a wheel Only use the jack when chang...

Страница 133: ...oosen them com pletely HEX0142 8 Insert the jack into the position indicated by the arrows where thereisahalfcirclenotch G6D5002A 9 The jack should be placed at a jacking point nearest to the tire you want to change The jack lift head indicated by the arrow should be placed around the vertical lugs and insertedintothenotchofthelugs Vehicle Maintenance 129 ...

Страница 134: ...lat tire in the rear compartment together with the tools and jack that are properly packaged 18 Have the tire fixed as soon as you can Reinstall it on the vehicle after balancing Toolpackingsteps 1 Place the wheel wrench and jack handleintothespecifiedposition 2 Put the jack into the tool bag facing upward 3 Bundleupthetoolbagtightly 4 Store the tool bag in the spare wheel compartment Place it in ...

Страница 135: ...inpersonalinjury You can start vehicle that has a discharged battery by transferring electrical power to it from a battery in anothervehicle JUMP STARTING THE ENGINE After the tool bag is packed place the warning triangle properly according to the picture Warning triangle is providedatthetimeofvehicledelivery HEX0147 HEX0161 Vehicle Maintenance 131 ...

Страница 136: ...ystems of both vehicles could be damaged and serious injuriescouldoccur Preparationbeforejump starting 1 Applytheparkingbrakefirmly 2 Shiftthetransmissionintoneutral 3 Turnoffallelectricalaccessories Caution Turn off the audio system before jump starting Otherwise it could be damaged Caution When connecting the cable make sure it is not near any engine parts thatwillmove Otherwise you could be inj...

Страница 137: ... jumper cables where the spare wheel is stored 4 Turn off the electrical devices on the vehicle as possible e g lights blowers audio system and drive the discharged vehicle for 20 minutes This can recharge the battery 5 If discharging reoccurs consult yourCHEVROLETretailer There is a mark on the battery housingortheterminal Caution Do not connect the negative terminal when finally connecting to th...

Страница 138: ...evehicle Failure to observe the above warningscouldresultininjuries Towing yourvehiclewith awheellift HEX0149 1 Turn on the hazard warning flashers 2 Turn the ignition key to the ACC ACCESSORYposition 3 ShiftthetransmissionintoNeutral 4 Releasetheparkingbrake TOWING THE VEHICLE HEX0148 If vehicle towing is needed contact your CHEVROLET retailer or a professionaltowingservice 134 Vehicle Maintenanc...

Страница 139: ...t hook under the vehicle When the front hook is used in towing you can only use a tow rope not a rigid towing bar HEX0151 Caution If your vehicle must be towed from the rear use a towing dolly under the frontwheels Do not have your vehicle towed from the rear with the front wheels touchingtheground Otherwise the transmission could be badlydamaged HEX0150 5 Tow your vehicle with the front wheelsoff...

Страница 140: ...nto the hole by pushing it towards the driver side and then press the passenger side to firmly closeit Caution When towing the vehicle with a tow rope thevehiclecanbedamaged Toreducedamage Use the towing hook only if no other towingequipmentisavailable Onlytowthevehiclefromthefront Keep the tow rope clear of the bumper Pull on the tow rope to make sure it is securely fixed to the towing hooks at b...

Страница 141: ...ct CHEVROLET retailer toseekassistance Caution If your vehicle gets stuck in sand mud or snow you will need to rock yourvehicleout Before rocking the vehicle check that there are no physical objects or peoplearoundthevehicle The vehicle could move forward or back suddenly The people around it could be injured and objects could be damaged Towing Hook for Shipping HEX0162 The towing hook for shippin...

Страница 142: ...damage to the transmissionandotherparts Do not press the accelerator pedal while shifting or before the transmis sion is shifted into forward or reverse gear Do not let the engine run at too high speedandavoidspinningthewheels Do not use the following cleaners when cleaning the interior and exterior of the vehicle unless otherwise specified in the stain removal instructions for fabric cleaning Lau...

Страница 143: ...sidethevehicle Use a clean wet cloth to clean the vinyl plasticandleathertrimsregularly Use proper cleaners to clean the dusts blemishesorstainsonthetrims Open the doors for proper ventilation when using cleaners or other chemicals forinteriorofthevehicle Caution Do not let color fading fabrics come into contact with the vehicle interior trims unless both materials are completelydry In order to pr...

Страница 144: ...ter a collision The safety belts may not have to be replaced if your CHEVROLET retailer finds that the safety belts are not damaged and work properly Glass Surface Caution Abrasive cleaners can scratch the glass and damage the rear window defrostergrid Do not use abrasive cleaners on the rearwindowglass Otherwise the driver s vision will be affected Keeping the window glass clean can help to reduc...

Страница 145: ...s are designed for operation under normal andnaturalconditions Caution The antenna can be damaged by automaticvehiclewashers Turn off the sound system and retract theantenna Remove the antenna rod or roof antenna Polishingand waxing Regular polishing can remove the residual materials on the vehicle surface High quality automotive wax should be used after polishing for best protection Protecting th...

Страница 146: ...liability Although some parts in the engine compartment and underneath the vehicle may become rusty on surface the reliability or functionality of these partswillnotbeaffected Metalsheetdamage If the vehicle body needs to be repaired or replaced make sure that the workshop uses proper anticorrosive materials to restore the corrosion resistanceproperties Sedimentofforeignsubstances The following su...

Страница 147: ...ified by the local laws or have them disposed of by the sellers who have supplied these materials and have a legal obli gationtodisposeofthemproperly Do not mix these materials with the household waste or discharge them intothedrains These hazardous materials can per manently damage the environment if notdisposedofproperly General Information SERVICE AND MAINTENANCE ServiceInformation In order to ...

Страница 148: ...ne Coolant 3 Fuel Filter Fuel Line and Connections Air Cleaner Element 2 Chart Symbols I Inspect these items and their related parts If necessary correct clean replenish adjust rotate or replace R Replace or change 1 If a vehicle is operated under severe conditions short distance driving extensive idling or driving in dusty conditions change engine oil and the filter every 7 500 kms or 6 months wh...

Страница 149: ... and go traffic or driving in dusty conditions Kilometers or time in months whichever comes first 6 months 7500 1 Year 15000 1 5 Years 22500 2 Years 30000 2 5 Years 37500 3 Years 45000 3 5 Years 52500 4 Years 60000 4 5 Years 67500 5 Years 75000 5 5 Years 82500 6 Years 90000 6 5 Years 97500 7 Years 105000 I I I I I I I I I I I I I I I I I I I I I I I I I R I I I I I I I I I I I I I I I I I I I I I ...

Страница 150: ...y rotate and balance wheels A C Mesh Filter As and when required or as suggested by CHEVROLET retailer As and when required or as suggested by CHEVROLET retailer Kilometers or time in months whichever comes first 6 months 7500 1 Year 15000 1 5 Years 22500 2 Years 30000 2 5 Years 37500 3 Years 45000 3 5 Years 52500 4 Years 60000 4 5 Years 67500 5 Years 75000 5 5 Years 82500 6 Years 90000 6 5 Years ...

Страница 151: ...ata Vehicle Identification Number VIN This number is the legal identifier for yourvehicle The vehicle identification number is engravedonthetopofthebulkhead VEHICLE IDENTIFICATION VIN Plate Location The vehicle identification number VIN plate is attached to the top of the frontendupperpanel HEX0153 1 SMARTECH ...

Страница 152: ...TCDI 69 7 x 82 4 1248 16 5 1 57 4 4000 205 1750 50 12 65 148 Technical Data Brakes Service brake Auto slack adjuster ABS Front brakes Rear brakes Hydraulic vacuum assisted diagonal circuit with auto slack adjuster Rear brakes Optional Disc Drum Gear Box Drive system No of gears Gear ratios 1st 2nd 3rd 4th 5th Reverse Front axle ratio Front wheel drive 5 forward 1 reverse 3 727 1 960 1 323 0 946 0 ...

Страница 153: ... 1462 1457 168 Overall length mm Overall width mm Overall height mm Wheel base mm Front wheel track mm Rear wheel track mm Ground clearance mm Vehicle Dimensions Vehicle Weight Kerb weight kg Gross vehicle weight kg 1124 1519 14 x 5 5J alloy 14 x 5 5J steel 175 70 R14 84T Radial tubeless McPherson strut Twist axle Font suspension type Rear suspension type Wheel Tires Wheel rim size Tire size type ...

Страница 154: ... Steering Fluid Classification ACEA A3 B45W 30 BOT 303 Mod Ethylene Glycol based long life coolant DOT 4 Dexron VI Capacity 3 2 L 1 9 L 7 L 0 48 L 1 0 L 150 Technical Data TIRE AND SEATING INFORMATION TIRE FRONT REAR SIZE 175 70 R14 84T COLD TIRE PRESSURE 235 kPa 34 psi 235 kPa 34 psi OCCUPANTS TOTAL 5 FRONT 2 REAR 3 175 70 R14 84T SPARE 175 70 R14 84T 235 kPa 34 psi ...

Страница 155: ...ection and Vehicle Delivery 159 Owner s Statement of Acceptance 161 Chevrolet Service 163 Maintenance Record Sheet 169 Battery 171 Separate Corrosion Protection Service 172 Body Inspection Record 173 Emission Warranty 175 Annexure I 179 Annexure II 180 151 Service and Warranty ...

Страница 156: ...d or re manufacturedpartswithaviewtocorrectinganydefectcoveredbythiswarranty 2 WHATIS COVERED Time and distance limits for New Vehicle Warranty coverage Warranty Type Warranty Limits Other Warranties A General B Rust Through Three 3 years or 1 00 000 kms whichever is earlier from the date of delivery by a CHEVROLET retailer or the date of first registration of the motor vehicle whichever occursfir...

Страница 157: ...ification without prior notice Service outside the municipal limits specified abovewillbeprovidedafterchargingtheactualtoandfrotravelingandincidentalexpenses asprevailingfromtimetotime Necessary care and caution is taken in manufacturing of the vehicle however General Motors India Pvt Ltd shall not be liable for any loss or damage caused to any article property death or disability caused to any hu...

Страница 158: ...an the one mentioned in the Owner s Manual Exceeding specified capacities suchasloadingweight passenger speed useasacommercialvehicleandrpmlimitations f Damagecausedbydrivingthevehicleundersevereconditions suchasun pliableorwater loggedroads inracesorrallies g Damage caused by natural disasters including but not restricted to earthquakes storms floods fire and accidents The owners are recommendedt...

Страница 159: ...similarnature o Damage caused by running vehicle on adulterated fuel lubricants or fuel lubricants other than those specified by General Motors IndiaPvt Ltd WHATIS NOTCOVERED Adjustments cleaning inspection orrequiredperiodicmaintenance Partsdesignatedasrequiringperiodicreplacement WarrantyrepairnotperformedbyaCHEVROLETretailer Charges or fees for telephone tow transportation charges of the vehicl...

Страница 160: ...ne oil Transmission oil Power steering fluid Brake Clutch fluid Coolant Grease Washer fluid Battery fluid Gasoline Diesel Air conditioner refrigerant Other lubricants etc No warranty repair shall be made if it is found that the vehicle identification number like chassis engine number odometer or the warranty service booklet have been tampered with This list is neither exclusive nor exhaustive and ...

Страница 161: ...trationregardlessofthedistancetraveled b Tyres This warranty is covered by the tyre manufacturer The coverage period is one year Please check with your CHEVROLET retailerfordetails c Audio Radio Acc This warranty is covered by the audio radio Acc manufacturer The coverage period is one year Please check withyourCHEVROLETretailerfordetails 6 MAKING THE WARRANTY EFFECTIVE The warranty goes into effe...

Страница 162: ...t Sail U VAin different cities in a phased manner The CHEVROLET retailer responsible for delivering your Sail U VA is qualified to provide all Sail U VA related services within the city where he is located As other CHEVROLET retailers become operational to handle the Sail U VA they will also be able to provide similar Sail U VArelated services IN ORDER FOR THE WARRANTY ON YOUR VEHICLE TOAPPLY IT I...

Страница 163: ...t free condition Accompanying this appropriately filled out service booklet Owner s Manual are the toolkitandyourvehicledocuments You have been informed of the service intervals and necessary service checks including under extreme operating conditions andinparticularwithregardtooilchangingofdieselengines City date CHEVROLETRetailer s ASO s StampandSignature 159 Service and Warranty ...

Страница 164: ...160 Service and Warranty ...

Страница 165: ...d in an orderly and proper operating condition including Keys Service booklet Owner s Manual and tool kit I have read and understood the terms and conditions pertaining to the New VehicleWarrantyand agreetoabideby thesame I have been informed of the service intervals and necessary servicechecks includingunderextremeoperatingconditions Dateofdelivery City date Nameandsignatureofcustomer 161 Service...

Страница 166: ...162 Service and Warranty ...

Страница 167: ...that the vehicle has been inspected and delivered to my satisfaction Customer s Signature DearCustomer We are confident that you and your family would be enjoying thesafeandcomfortabledriveoftheChevroletSailU VA We would like to undertake a thorough check up of the vehicle at 1000 kms or 30 days whichever occurs earlier This will also allow us to re emphasize the salient features of theSailU VAtoy...

Страница 168: ...ectricalChecks Malfunctionindicatorlamp Charginglamp Oilpressurelamp Glow pluglamp Parkingbrakelamp indicator High beam Turn signal Hazard indicator allothertelltalelamp Cigarettelighter reardefogger Checklightingsystem Horn Radio OutsideMirrors High Lowbeam Hazardsignal Turnsignal Flashtopass signal Front Rearfoglamps Taillamps Stop lamp Reversing lamp Trunk lamp Dynamic Evaluation Steering funct...

Страница 169: ...edtomysatisfaction Customer s Signature Labourfree Partsarechargeable Retainwithjobcard CHEVROLETInspection 1stServiceCheck6months 7500kmswhicheveroccursearlier VIN ______________________________________________ Regn No __________________________________________ Deliverydate _______________________________________ Dateofservice _____________________________________ kms ____________________________...

Страница 170: ...ertifythatthework hasbeencarriedoutasperthe schedule ServicingRetailer s ASO stamp date DeliveringRetailer s stamp date Iherebycertifythatthework hasbeencarriedoutasperthe schedule ServicingRetailer s ASO stamp date 166 Service and Warranty ...

Страница 171: ...edtomysatisfaction Customer s Signature Labour Partsarechargeable Retainwithjobcard CHEVROLETInspection 3rd Service Check 1 5 years 22500 kms whichever occurs earlier VIN ______________________________________________ Regn No __________________________________________ Deliverydate _______________________________________ Dateofservice _____________________________________ kms ______________________...

Страница 172: ...ertifythatthework hasbeencarriedoutasperthe schedule ServicingRetailer s ASO stamp date DeliveringRetailer s stamp date Iherebycertifythatthework hasbeencarriedoutasperthe schedule ServicingRetailer s ASO stamp date 168 Service and Warranty ...

Страница 173: ...EET Repair category Free Service Paid Service Running Repair Accident Repair R O No Repair Category Details of Repair Done Name of Servicing Retailer Service Adv Sign Retailer Stamp Repair Date kms 169 Service and Warranty ...

Страница 174: ...nty MAINTENANCE RECORD SHEET Repair category Free Service Paid Service Running Repair Accident Repair R O No Repair Category Details of Repair Done Name of Servicing Retailer Service Adv Sign Retailer Stamp Repair Date kms ...

Страница 175: ... the vent hole In case of any drop in electrolyte level add pure distilledwater NEVERADDACID Batteryiswarrantedforaperiodofoneyearonly Liability under this warranty is limited to defects arising out of faulty material or workmanship developing under proper use and NOT whenthebatteryismerelydischarged Defects arising out of faulty vehicle electrical systems negligent maintenance incorrect charging ...

Страница 176: ...pected for damage as part of the regular annual inspection or 15 000 kms service The customer is informed of any damage detected and measures to rectify this damage Any damage discovered is also indicated in the followingcorrosionprotectiondiagram Confirmation of the inspection is indicated by a stamp and dated signature accompanied by indication of the vehicle mileage on thefollowingverificationd...

Страница 177: ... subjected to an inspection by CHEVROLET retailer once ayear Any resultingwork issubjecttoacharge Check up 1 year after initial registration Check up date Odometer reading Damage found 1 Outer body Yes No 2 Under body Yes No 3 Engine compartment Yes No Retailer stamp signature Damage repaired Yes No Remarks General Motors India Pvt Ltd 173 Service and Warranty ...

Страница 178: ...ranty the vehicle must be subjected to an inspection by CHEVROLET retailer once ayear Any resultingwork issubjecttoacharge Check up 2 year after initial registration Check up date Odometer reading Damage found 1 Outer body Yes No 2 Under body Yes No 3 Engine compartment Yes No Retailer stamp signature Damage repaired Yes No Remarks General Motors India Pvt Ltd ...

Страница 179: ...mponents as mentioned in Annexure II 2 The period of the vehicle s warranty shall commence from the date of thevehiclesale 2 1 Warranty period 1 00 000 kms or 3 years whichever occurs earlier fromdateofthevehiclesale 3 The warranty claim will be accepted only after examination carried out by CHEVROLET retailers leading to a firm conclusion that none of the original settings specifications have bee...

Страница 180: ...ndia Pvt Ltd will not be responsible for any fines penalties that may be charged by Statutory or Regulatory authorities on account of failure of the vehicle to comply with the in use emission standards on the vehicle not meeting any such given legal regulatory requirement during inspectionbysuchauthorities 11 Emission Warranty will be appli cable irrespective of the change of ownership of the vehi...

Страница 181: ...r the service schedule described in the mainte nance chart given in the Owner s Manual 3 Avehicle which has been subjected to abnormal use abuses neglect and improper maintenance or has metwithanaccident 4 Use of such replacement parts which are not specified and approved by General Motors India Pvt Ltd 5 If the vehicle or parts thereof have been altered tampered with or modified or replaced in an...

Страница 182: ...vers only compliance with the emission standard as specified in sub rule 2 of Rule 115 of CMVR It does not cover any other performance of these parts or routine test and consequent maintenance or adjust ments to establish compliance to the in use emission standard as applicable to the state in which the vehicleisregisteredandisinuse 178 Service and Warranty ...

Страница 183: ...m normal production tolerance in design material or workmanship in a deviceorsystemwhichaffectsanyparameter performance orcomponentbelongingtoemissioncontrolsystem 7 Product Warranty The manufacturer warranty as provided by General Motors India Pvt Ltd which covers failure of various partsandsystemsaspertheOwner sManual3years 1 00 000kms whicheverisearlier 8 Emission Warranty Warranty for emission...

Страница 184: ...eSensor 9 Injectors 10 HighPressurePump 11 ExhaustGas Re circulationValve 12 FuelPump CatalyticConverter is covered only for emission related failures as provided under the warranty statement Replacementsif any shall notbeapplicablefor breakageandnoiseproblems Note All the above mentioned parts are covered only if the car fails to meet the prescribed Emission norms Any other performance problemssh...

Страница 185: ... are authorized to carry out Periodic Maintenance Free Paid Minor Running Repair Only Authorized Service Center North Zone 182 West Zone 188 South Zone 193 East Zone 199 International 202 181 Service Network The list of authorized Retailers ASC are mentioned herein as of May 2014 For any change in authorized Retailers ASC please visit www chevrolet co in ...

Страница 186: ...all New Delhi 110 015 Tel 011 41238888 8826292810 8826292815 L Arya Automobiles Showroom Plot No 193 Metro Pillar No 543 Main Rohtak Road Mundka New Delhi 110041 Tel 011 8743030301 302 Fax 011 28342887 Workshop KH 82 21 2 22 2 Phirni Road Udyog Nagar Industrial Area Near Mundka Metro Pillar No 547 New Delhi 110 041 Tel 011 28342884 L Go Auto Pvt Ltd Showroom A 231 Okhla Industrial Area Phase 1 New...

Страница 187: ...ector 2 Kurukshetra 136 118 Telefax 01744 231050 HISSAR L Ashwani Automotors Showroom Workshop 9 km Stone OP Jindal Marg Hissar 125 044 Tel 01662 220710 11 12 JHAJJAR L Shailesh Automobiles Showroom Workshop Tehsil Road Jhajjar Haryana 124 001 Tel 9253660066 9254171300 JIND L Lekh Raj Motors Pvt Ltd Showroom Workshop Safidon Road opp Brahmin Dharamsala Jind Tel 9992900082 KAITHAL L Lekh Raj Motors...

Страница 188: ...hop Opp Cambridge International School Saidmubarak Amritsar Road Batala 143505 Tel 01871 241024 BHATINDA L Padam Cars Pvt Ltd Showroom Workshop GonianaRoad 8thMileStone NH 10 Bhatinda 151005 Tel 0164 27601111 9216350205 Telefax 0164 2760153 CHANDIGARH L Padam Motors Pvt Ltd Showroom 182 2 Industrial Area Phase 1 Chandigarh 160002 Tel 0172 5212900 Workshop 185 Industrial Area Phase 1 Chandigarh 160...

Страница 189: ...howroom Workshop 300 Mtr From Bharat Petrol Pump Khair By Pass Road Aligarh 202001 Tel 8938802229 8938802214 ALLAHABAD L Eldee Motors Showroom Eldee Enclave 2 S P Marg Civil Lines Allahabad 211 001 Tel 0532 2560743 44 Workshop Kanodia Mill Compound 1 Luker Ganj Allahabad 211 001 Tel 0532 2616368 AGRA L Kalyan Auto Sales Showroom Workshop Opp Bhagwati Dhaba Near New Sabji Mandi Sikandra Agra 282 00...

Страница 190: ...d Tel 0120 3008600 605 631 632 635 636 Fax 0120 3008643 45 48 49 50 Workshop 2 58 3 Site 04 Sahibabad Ghaziabad 200300 Tel 0120 4558765 JHANSI L Sri Venkateshwar Autocare Pvt Ltd Showroom Workshop Jhansi Kanpur Road Goramachhiya Jhansi 284001 Tel 0510 2371144 6450158 KANPUR L Cross Road Auto Pvt Ltd Showroom 40 Government Industrial Estate Opp Sindhi Colony Fazal Ganj Kanpur 208 012 Tel 0512 22212...

Страница 191: ...otors Workshop Industrial Area Kiccha Bypass Road B 27 Rudrapur 263153 Tel 05944 243836 JAMMU L K C Motors Showroom Workshop NH 1 Byepass Road Jammu 180 004 Tel 0191 2465769 59 2460829 Fax 0191 2476660 RS PURA L K C Motors Showroom Workshop Bagha Marh RS Pura Jammu Tel 01923 252809 Fax 01923 252809 SRINAGAR L K C Motors Showroom Workshop By Pass Road Hyderpora Srinagar 190 014 Tel 0194 2443188 187...

Страница 192: ...orkshop NH 8A Kandla Port Road Gandhidham 370 201 Tel 02833 654370 653317 9825611692 GODHRA L Shree Gopinathji Agencies Showroom Workshop Moonlight Cinema Compount Vavdi Godhra 389 001 Tel 02672 645828 265270 265271 GANDHI NAGAR L Gallops Motors Pvt Ltd Showroom Workshop Near Nigam Petrol Pump Rajshree Cinema Road Sector 21 Gandhinagar 382 010 Tel 0232 30516107 HIMMATNAGAR L Gallops Motors Pvt Ltd...

Страница 193: ...65 2681050 2681060 BHOPAL L Super Cars Ltd Showroom Workshop Plot No 21 Sector G Govindpura Industrial Area J K Road Bhopal 462 021 Tel 0755 4028400 4228201 Fax 0755 4228203 L Varenayam Motors Showroom Workshop 189 Angoori Bagh Jinsi Road Bhopal 462008 Tel 0755 2575288 299 300 Fax 0755 2579918 CHHINDWARA L Sunshine Motors Showroom Workshop College Road Lalbagh Chhindwara 480001 Tel 0716 244125 244...

Страница 194: ...2 27780801 40708888 Fax 022 40708899 27780805 Showroom 2 264 265 Vaswani Chambers Opp Old Passport Office Pravhadevi Mumbai 400 025 Tel 022 434594444 24221711 12 Fax 022 24222713 Workshop 2 C o Bharat Tiles Marbles Ltd Jaibhimnagar Dharukhana Road Reay Road East Near Sujala Hotel Mumbai 400 010 Tel 022 64560303 23774514 15 16 Fax 022 23774505 Workshop 3 Plot No D 238 A TTC Industrial Area MIDC Shi...

Страница 195: ...n Showroom Modi House Opp to LIC Building Naupada Eastern Express Highway Thane West Thane 400 602 Tel 022 67610000 Fax 022 67610209 Workshop Pioneer Estate Corporation 133 134 Pokhran Road No 2 Opp Oswal Park Thane West 400601 Tel 022 66040000 Fax 022 66040102 L Angel Auto World Pvt Ltd Showroom Workshop 1 Grishma garden Gokhivare Vasai East Thane Mumbai Vasai 401208 Tel 0250 6453030 6061777 Show...

Страница 196: ... Sakri Bilaspur Tel 07752 217934 217935 RAIPUR L Vardhaman Motors Showroom Workshop 9 1 Mahoba Bazar GE Road NH 6 Kumhari Dist Durg Raipur 492 001 Tel 7489177999 7883221999 Showroom 2 Ashoka Millenium Ring Road Raipur 492 0011 Tel 7714030104 7712410008 STATE CHATTISGARH 192 Service Network ...

Страница 197: ...amabad RTC X Road Hyderabad 500020 Tel 040 27668678 27668761 Fax 040 27668632 Workshop 3 Plot No 21 Mini Industrial Estate Hafeezpet Road Kondapur Hyderabad 500049 Tel 040 31906677 Workshop 4 Plot No 37 Survey No 45 Vignan Junior College Road Kundapur Hyderabad 500081 Tel 040 31906699 L Orange Auto Pvt Ltd Showroom 1 6 3 249 3 Abhinandan Towers Road No 1 Banjara Hills Hyderabad 500 034 Tel 040 665...

Страница 198: ...ara Hosur Main Road Bangalore 560 068 Tel 080 43574357 Fax 080 43574353 Workshop 2 Sy No 26 Hanumareddy Layout Chinnapanahalli Main Road Marathahalli Post Bangalore 560037 Tel 9663388812 L Trident Automobiles Pvt Ltd Showroom Workshop SY No 18 1B Old No 18 1C Nayanda Halli Grama Kengeri Hobli Bangalore 560038 Tel 080 67149191 292 67149001 Showroom Workshop 2 No 122 1 C Shankar Reddy Layout Kalyana...

Страница 199: ...an Motors Showroom Workshop 118 A Chungam Junction West Hill Calicut 673005 Tel 0495 2383680 81 2383770 71 Fax 0495 3041100 2381909 COCHIN L Geeyem Motors Pvt Ltd Showroom Workshop 11 336 NH 47 Bye Pass Nettor P O Ernakulam Cochin 682 304 Tel 0484 2703245 49 3097100 3097101 Fax 0484 2703244 Showroom 2 33 2440B Geetanjali Junction NH Byepass Chakkaraparambu Cochin 682 032 Tel 0484 2343146 CHALAKKUD...

Страница 200: ...Ltd Showroom 14 3 A1 Guruvayoor Road Puzhakkal Ayyanthole P O Thrissur 680 003 Tel 0487 2388945 46 2388851 52 Fax 0487 2388851 Workshop Near Boating Station Puzhakkal Post Office Thrissur 680553 Tel 0487 2225100 2225101 TRIVENDRUM L Deedi Motors Pvt Ltd Showroom Workshop Erumalathopu N H Bye Pass Road Venpalvattom Anayara P O Trivendrum 695 029 Tel 0471 2556006 3257777 2558599 2558499 Fax 0471 255...

Страница 201: ...di Madurai 625018 Tel 0452 2669617 3091917 Fax 0452 2669618 Workshop Plot No 64 68 Thiruvalavayanallur Post National Highway No 7 Opp Arokya Milk Processing Unit Nagari Madurai 625 221 Tel 0452 2463612 13 14 NAGERCOIL L A R A S Motors P Ltd Showroom Workshop 2 86 Tirunelveli Main road Ozhuginasery Nagercoil 629 001 Tel 04652 644664 Showroom 04652 272443 Workshop NAMAKAL L Thriive Cars Showroom 5 5...

Страница 202: ...araj Karz Showroom Workshop Pudukottai Bye Pass Road Thanjavur Tel 04362 226452 VELLORE L Sayar Cars Showroom Workshop S F No 3004 New By Pass Road Near Collectorate Vellore 632004 Tel 0416 2222017 198 Service Network ...

Страница 203: ...urnea 854326 Tel 9234323211 BOKARO L Power Motors Showroom Workshop N 1 City Centre Sector 4 Bokaro Steel City Bokaro 827004 Tel 0654 2 233555 232977 Fax 06542 232988 DHANBAD L Sorabh Automobiles Showroom Indramani Palace Opp Flair Bajaj Saraidhela Dhanbad 826001 Tel 0326 2201366 Workshop Tilakraidih Govindpur Road Dhanbad 826001 Tel 9470580855 HAZARIBAGH L Laxmi Auto Showroom Workshop Zulu Park R...

Страница 204: ... Asansol 713 339 Telefax 0341 2343704 705 HOWRAH L Priti Motor Udyog P Ltd Showroom NH 6 Bombay Howrah Highway Howrah Workshop Khejurtala Kolkata Truck Terminal Khejurtala NH 6 Howrah 711403 Tel 033 65002070 71 72 KOLKATA L OSLAutotech Pvt Ltd Showroom 2 1A Sarat Bose Road Lansdowne Towers Kolkata 700 020 Tel 033 66270400 Workshop 49 E Topsia Road South Kolkata 700 046 Tel 033 66270500 L Speed Aut...

Страница 205: ...port Road Agartala Tripura West 799 001 Tel 0381 2342566 SHILLONG L DH Royal Cars Showroom Workshop Parkview Fire Brigade Shillong 793 014 Tel 0364 2520481 2520477 GANGTOK L GEN X Motors Showroom 5th Mile Jhordhara Tadong Gangtok 737 102 Tel 03592 202515 Fax 03592 203171 Workshop C o Garima Enterprise P S Road Gangtok 737 101 Tel 03592 202515 AIZAWL L Highland Showroom Workshop A L Road Zemabawk A...

Страница 206: ...oad Colombo 10 Sri Lanka Tel 0094777410407 BHUTAN L Global Trade Showroom Lkahilham Changgankha Thimphu Bhutan Workshop Post Box No 1037 Olarongcchu Thimphu Bhutann NEPAL m SPG Automobiles Pvt Ltd Workshop GPO Box 2544 Khumaltar Lalitpur Kathmandu Nepal Tel 00977 1 4100543 202 Service Network ...

Страница 207: ......

Страница 208: ... 0 1 2 3 4 4 5 6 0 1 0 7 4 5 3 2 0 4 3 0 0 8 3009 3 3 0 4 4 ...

Отзывы: