background image

0

4

    Using the Notebook PC

These are examples of the Notebook PC 

connected to a Wireless Network�

Desktop PC

PDA

Notebook PC

Access 

Point

Desktop PC

PDA

Notebook PC

Wireless LAN Connection (on selected models)

The optional built-in wireless LAN is a compact easy-to-use wireless Ethernet adapter. Implementing 

the IEEE 802.11 standard for wireless LAN (WLAN), the optional built-in wireless LAN is capable of 

fast data transmission rates using Direct Sequence Spread Spectrum (DSSS) and Orthogonal Frequency 

Division Multiplexing (OFDM) technologies on 2.4GHz/5GHz frequencies. The optional built-in wire

-

less LAN is backward compatible with the earlier IEEE 802.11 standards allowing seamless interfacing 

of wireless LAN standards.
The optional built-in wireless LAN is a client adapter that supports Infrastructure and Ad-hoc modes 

giving you flexibility on your existing or future wireless network configurations for distances up to 40 

meters between the client and the access point.

To provide efficient security to your wireless communication, the optional built-in wireless LAN comes with a 

64-bit/128-bit Wired Equivalent Privacy (WEP) encryption and Wi-Fi Protected Access (WPA) features.

Ad-hoc mode

The Ad-hoc mode allows the Notebook PC to con-

nect to another wireless device. No access point (AP) 

is required in this wireless environment.

(All devices must install optional 802�11 wireless LAN 

adapters�)

Infrastructure mode

The Infrastructure mode allows the Notebook PC 

and other wireless devices to join a wireless network 

created by an Access Point (AP) (sold separately) that 

provides a central link for wireless clients to com-

municate with each other or with a wired network.

(All devices must install optional 802�11 wireless LAN 

adapters�)

For security concerns, DO NOT connect 

to the unsecured network; otherwise, the 

information transmission without encryp-

tion might be visible to others.

Содержание X83Vb

Страница 1: ...Notebook PC Hardware User s Manual E4069 Aug 2008 ...

Страница 2: ... Using Battery Power 25 Battery Care 25 Powering ON the Notebook PC 26 The Power On Self Test POST 26 Checking Battery Power 27 Charging the Battery Pack 27 Power Options 28 Power Management Modes 29 Sleep and Hibernate 29 Thermal Power Control 29 Special Keyboard Functions 30 Colored Hot Keys 30 Microsoft Windows Keys 32 Keyboard as a Numeric Keypad 32 Keyboard as Pointers 32 Switches and Status ...

Страница 3: ...cted models 50 Windows Wireless Network Connection 51 Bluetooth Wireless Connection on selected models 52 Antenna Connections on selected models 53 Trusted Platform Module TPM on selected models 54 Fingerprint Registration on selected models 55 3G Watcher on selected models and in selected territories 57 Appendix Optional Accessories A 2 Optional Connections A 3 Bluetooth Mouse Setup optional A 4 ...

Страница 4: ... Contents ...

Страница 5: ...ok PC About This User s Manual Notes For This Manual Safety Precautions Preparing your Notebook PC Photos and icons in this manual are used for artistic purposes only and do not show what is actually used in the product itself ...

Страница 6: ...rmation on using the Notebook PC s components 5 Appendix Introduces you to optional accessories and gives additional information Notes For This Manual A few notes and warnings in bold are used throughout this guide that you should be aware of in order to complete certain tasks safely and completely These notes have different degrees of importance as described below IMPORTANT Vital information that...

Страница 7: ...e the battery DO NOT expose to strong magnetic or electrical fields DO NOT place on uneven or unstable work surfaces Seek servicing if the casing has been damaged DO NOT place or drop objects on top and do not shove any foreign objects into the Notebook PC DO NOT press or touch the display panel Do not place together with small items that may scratch or enter the Notebook PC DO NOT leave the Noteb...

Страница 8: ...ronic devices Most airlines will allow electronic use only between and not during takeoffs and landings Transportation Precautions To prepare the Notebook PC for transport you should turn it OFF and disconnect all external peripher als to prevent damage to the connectors The hard disk drive s head retracts when the power is turned OFF to prevent scratching of the hard disk surface during transport...

Страница 9: ...dapter IMPORTANT When opening do not force the display panel down to the table or else the hinges may break Never lift the Notebook PC by the display panel 3 Open the Display Panel 4 Turn ON the Notebook PC The power switch turns ON and OFF the Notebook PC or putting the Notebook PC into sleep or hiber nation modes Actual behavior of the power switch can be customized in Windows Control Panel Powe...

Страница 10: ...10 1 Introducing the Notebook PC ...

Страница 11: ...11 2 Knowing the Parts Basic sides of the Notebook PC Photos and icons in this manual are used for artistic purposes only and do not show what is actually used in the product itself ...

Страница 12: ...12 2 Knowing the Parts Top Side Refer to the illustration below to identify the components on this side of the Notebook PC The keyboard will be different for each territory 3 5 6 4 7 8 1 2 10 9 ...

Страница 13: ...C or putting the Notebook PC into sleep or hibernation modes Actual behavior of the power switch can be customized in Windows Control Panel Power Options Keyboard The keyboard provides full sized keys with comfortable travel depth at which the keys can be depressed and palm rest for both hands Two Windows function keys are provided to help ease navigation in the Windows operating system Display Pa...

Страница 14: ...ebook PC while it is in operation or recently been in operation High tempera tures are normal during charging or operation Do not use on soft surfaces such as beds or sofas which may block the vents DO NOT PUT THE NOTEBOOK PC ON YOUR LAP OR OTHER PARTS OF THE BODY TO AVOID INJURY FROM THE HEAT The bottom side may vary in appearance depending on model The battery pack size will vary depending on mo...

Страница 15: ...king card in order to wirelessly connect to network access points or other wireless networking devices 1 2 Battery Pack The battery pack is automatically charged when the Notebook PC is connected to an AC power source and maintains power to the Notebook PC when AC power is not connected This allows use when moving temporarily between locations Battery time varies by usage and by the specifications...

Страница 16: ...l cameras MP3 players mobile phones and PDAs This Notebook PC has a built in high speed memory card reader that can conveniently read from and write to many flash memory cards as mentioned later in this manual 2 3 Optical Drive Emergency Eject location varies by model The emergency eject is used to eject the optical drive tray in case the electronic eject does not work Do not use the emergency eje...

Страница 17: ...ower parallel bus used in the PC card slot Not compatible with previous PCMCIA cards SPDIF Output Jack This jack provides connection to SPDIF Sony Philips Digital Interface compliant de vices for digital audio output Use this feature to turn the Notebook PC into a hi fi home entertainment system Headphone Output Jack The stereo headphone jack 1 8 inch is used to connect the Notebook PC s audio out...

Страница 18: ...Notebook PC 1 2 1 2 2 0 USB Port 2 0 1 1 The USB Universal Serial Bus port is compatible with USB 2 0 or USB 1 1 devices such as keyboards pointing devices cameras hard disk drives printers and scanners connected in a series up to 12Mbits sec USB 1 1 and 480Mbits sec USB 2 0 USB allows many devices to run simultaneously on a single computer with some peripherals acting as additional plug in sites ...

Страница 19: ...rs Audio features are software controlled Infrared Port IrDA on selected models The infrared IrDA communication port allows convenient wireless data communication with infrared equipped devices or computers This allows easy wireless synchronization with PDAs or mobile phones and even wireless printing to printers If your office supports IrDAnetworking you can have wireless connection to a network ...

Страница 20: ...l connectors 1 2 3 4 5 DTV CATV HDMI 9 1 2 4 6 8 3 Power DC Input Thesuppliedpoweradapter convertsAC power to DCpowerfor usewith this jack Powersupplied through this jack supplies power to the Notebook PC and charges the internal battery pack To prevent damage to the Notebook PC and battery pack always use the supplied power adapter CAUTION MAY BECOME WARM TO HOT WHEN IN USE BE SURE NOT TO COVER T...

Страница 21: ...d lock that prevent the Notebook PC to be removed from a fixed ob ject Some may also include a motion detector to sound an alarm when moved Modem Port on selected models The RJ 11 modem port with two pins is smaller than the RJ 45 LAN port and supports a standard telephone cable The internal modem supports up to 56K V 90 transfers The built in connector allows convenient use without additional ada...

Страница 22: ...22 2 Knowing the Parts ...

Страница 23: ...ON the Notebook PC Checking Battery Power Powering Options Power Management Modes Special Keyboard Functions Switches and Status Indicators Photos and icons in this manual are used for artistic purposes only and do not show what is actually used in the product itself ...

Страница 24: ...r to power the Notebook PC or use the Notebook PC s adapter to power other electrical devices If there is smoke burning scent or extreme heat coming from the AC DC adapter seek servic ing Seek servicing if you suspect a faulty AC DC adapter You may damage both your battery pack s and the Notebook PC with a faulty AC DC adapter This Notebook PC may come with either a two or three prong plug dependi...

Страница 25: ...t the battery be used in a temperature range between 5 C and 35 C 41 F and 95 F You must also take into account that the Notebook PC s internal temperature is higher than the outside temperature Any temperatures above or below this range will shorten the life of the battery But in any case the battery pack s usage time will eventually decrease and a new battery pack must be purchased from an autho...

Страница 26: ... diagnos tic tests called the Power On Self Test POST The software that controls the POST is installed as a permanent part of the Notebook PC s architecture The POST includes a record of the Notebook PC s hardware configuration which is used to make a diagnostic check of the system This record is created by using the BIOS Setup program If the POST discovers a difference between the record and the ...

Страница 27: ...over the battery icon without power adapter Pointer over the battery icon with power adapter Right click the battery icon WARNING DO NOT leave the battery pack discharged The battery pack will discharge over time If not using a battery pack it must continued to be charged every three months to extend recovery capacity or else it may fail to charge in the future The battery stops charging if the te...

Страница 28: ...tebook PC Power Options The power switch turns ON and OFF the Notebook PC or putting the Notebook PC into sleep or hiberna tion modes Actual behavior of the power switch can be customized in Windows Control Panel Power Options For other options such as Switch User Restart Sleep or Shut Down click the arrowhead next to the lock icon Restarting or Rebooting After making changes to your operating sys...

Страница 29: ...re turned OFF Because RAM is volatile it requires power to keep refresh the data Click the Start button and the arrowhead next to the lock icon to see this option You can also use the keyboard shortcut Fn F1 to activate this mode Recover by pressing any keyboard key except Fn NOTE The power indicator will blink in this mode Power Management Modes The Notebook PC has a number of automatic or adjust...

Страница 30: ...el ON and OFF On certain models stretches the screen area to fill the entire display when using low resolution modes LCD MonitorIcons F8 TogglesbetweentheNotebookPC sLCDdisplayandan externalmonitorinthisseries NotebookPCLCD ExternalMonitor Both This functiondoesnotworkin256Colors selectHighColorinDisplayPropertySettings NOTE Must connect an external monitor before booting up Radio Tower F2 Wireles...

Страница 31: ...ace Bar This key toggles power savings between various power sav ing modes The power saving modes control many aspects of the Notebook PC to maximize performance versus battery time Applying or removing the power adapter will automatically switch the system between AC mode and battery mode You can see the current mode through the on screen display OSD Fn C Toggles Splendid Video Intelligent Techno...

Страница 32: ... located at the upper right hand corner of each key as shown in the figure When the numeric keypad is engaged by pressing Fn Ins Num LK the number lock LED lights up If an external keyboard is connected pressing the Ins Num LK on the external keyboard enables disables the NumLock on both keyboards simultaneously Todisablethenumerickeypadwhilekeepingthekeypad on an external keyboard activated press...

Страница 33: ... wireless LAN or Bluetooth on selected models ON or OFF with an on screen display When enabled the corresponding wireless indicator will light Windows software settings are necessary to use the wireless LAN or Bluetooth Bluetooth Key on selected models This is only applicable on models with internal Bluetooth BT The Bluetooth key toggles the internal Bluetooth ON and OFF An on screen display and r...

Страница 34: ...k PC is turned ON and blinks slowly when the Note book PC is in the Suspend to RAM Sleep mode This indicator is OFF when the Notebook PC is turned OFF or in the Suspend to Disk Hibernation mode Front Bluetooth Indicator This is only applicable on models with internal Bluetooth BT This indicator will light to show that the Notebook PC s built in Bluetooth BT function is activated Wireless LAN Indic...

Страница 35: ...t Number Lock Indicator Indicates that number lock Num Lk is activated when lighted Number lock allows some of the keyboard letters to act as numbers for easier numeric data input Capital Lock Indicator Indicates that capital lock Caps Lock is activated when lighted Capital lock allows some of the keyboard letters to type using capitalized letters e g A B C When the capital lock light is OFF the t...

Страница 36: ...creases the audio volume Fn Up Speaker Icon F12 Increases the audio volume Multimedia Control Keys on selected models The multimedia control keys allows for convenient controlling of the multimedia application The fol lowing defines the meaning of each multimedia control key on the Notebook PC CD Skip to Previous Track Rewind Audio Volume Down During CD play this button has two functions Track The...

Страница 37: ...cal drive Flash memory card reader Hard disk drive Memory RAM Connections Modem Connection on selected models Network Connection Wireless LAN Connection on selected models Bluetooth Wireless Connection on selected models Antenna Connections on selected models Trusted Platform Module TPM on selected models Fingerprint Registration on selected models 3G Watcher on selected models and in selected ter...

Страница 38: ...e touchpad Because the touchpad is electrostatic sensitive objects cannot be used in place of your fingers The touchpad s primary function is to move the pointer around or select items displayed on the screen with the use of your fingertip instead of a standard desktop mouse The following illustrations demonstrate proper use of the touchpad Moving The Pointer Place your finger in the center of the...

Страница 39: ...icking Tapping With the pointer over an item press the left button or use your fingertip to touch the touchpad lightly keeping your finger on the touchpad until the item is selected The selected item will change color The following 2 examples produce the same results Clicking Tapping Double Clicking Double Tapping Touchpad Usage Illustrations Dragging Dragging means to pick up an item and place it...

Страница 40: ...s or grease Do not touch the touchpad if your fingers are dirty or wet Do not rest heavy objects on the touchpad or the touchpad buttons Do not scratch the touchpad with your finger nails or any hard objects Automatic Touchpad Disabling Windows can automatically disable the Notebook PC s touchpad when an external USB mouse is at tached This feature is normally OFF to turn ON this feature select th...

Страница 41: ...ds Inserting an Expansion Card Be sure the ExpressCard is level when inserting 1 If there is an ExpressCard socket protector remove it using the Removing an Express Card instructions below 2 Insert the ExpressCard with the connector side first and label side up Standard ExpressCards will be flush with the Notebook PC when fully inserted 3 Carefully connect any cables or adapters needed by the Expr...

Страница 42: ...o obstructions that may get jammed under the drive s tray 3 Hold the disc by the edge and face the disc s printed side up Push down on both sides of the disc s center until the disc snaps onto the hub The hub should be higher than the disc when correctly mounted 4 Slowly push the drive s tray back in The drive will begin reading the table of contents TOC on the disc When the drive stops the disc i...

Страница 43: ...alanced CDs or CD print To decrease vibration use the Notebook PC on an even surface and do not place labels on the CD Listening to Audio CD The optical drives can play audio CDs but only the DVD ROM drive can play DVD audio Insert the audio CD and Windows automatically opens an audio player and begins playing Depending on the DVD audio disc and installed software it may require that you open a DV...

Страница 44: ... from devices such as digital cameras MP3 players mobile phones and PDAs This Notebook PC has a single built in memory card reader that can use many flash memory cards as shown in the example below The built in memory card reader is not only convenient but also faster than most other forms of memory card readers because it utilizes the internal high bandwidth PCI bus WARNING To prevent data loss u...

Страница 45: ... T Self Monitoring and ReportingTechnol ogy to detect hard disk errors or failures before they happen When replacing or upgrading the hard drive always visit an authorized service center or retailer for this Notebook PC IMPORTANT Poor handling of the Notebook PC may damage the hard disk drive Handle the Notebook PC gently and keep it away from static electricity and strong vibrations or impact The...

Страница 46: ...46 4 Using the Notebook PC Installing the Hard Disk Drive Hard Disk Drive Cont A B ...

Страница 47: ...lication performance by decreasing hard disk access The BIOS automatically detects the amount of memory in the sys tem and configures CMOS accordingly during the POST Power On Self Test process There is no hardware or software including BIOS setup required after the memory is installed This is only an example Installing a Memory Card Removing a Memory Card 3 This is only an example This is only an...

Страница 48: ... telephone line 1 is used by the modem and should have an RJ 11 connector on both ends Connect one end to the modem port and the other end to an analog telephone wall socket the ones found in residential buildings Once the driver is setup the modem is ready to use CAUTION For electrical safety concerns only use telephone cables rated 26AWG or higher see Glossary for more information Connections WA...

Страница 49: ...ps Full Duplex is supported on this Notebook PC but requires connection to a network switching hub with duplex enabled The software default is to use the fastest setting so no user intervention is required 1000BASE T or Gigabit is only supported on selected models Twisted Pair Cable The cable used to connect the Ethernet card to a host generally a Hub or Switch is called a straight through Twisted...

Страница 50: ...you flexibility on your existing or future wireless network configurations for distances up to 40 meters between the client and the access point Toprovideefficientsecuritytoyourwirelesscommunication theoptionalbuilt inwirelessLANcomeswitha 64 bit 128 bit Wired Equivalent Privacy WEP encryption and Wi Fi Protected Access WPA features Ad hoc mode The Ad hoc mode allows the Notebook PC to con nect to...

Страница 51: ...etwork icon 5 Select Show Wireless if you have many networks in your area 6 Select the wireless network you want to connect to 7 When connecting you may have to enter a password 8 After connection has been established Connected will be shown 2b Or double click the Wireless Console icon in the Notification area and select either the Wireless LAN Bluetooth or just the Blue tooth 1 Switch ON the Wire...

Страница 52: ...ect to the Internet You may also use it for SMS messaging Bluetooth enabled computers or PDAs You can wireless connect to another computer or PDA and exchange files share peripherals or share Internet or network connections You may also make use of Bluetooth enabled wireless keyboard or mouse 2b Or double click the Wireless Console icon in the Notification area and select either the Wireless LAN B...

Страница 53: ...Magnets in base allows attachment to me tallic surfaces such as partitions or cabinets Cable connection Connect the coaxial cable from a paid television ser vice roof mounted aerial antenna or indoor rabbit ears to the cable adapter Cable service connection can receive analog TV depending on paid services The provided adapter is necessary to change the coaxial plug to fit the slim Notebook PC Atta...

Страница 54: ...tiveness Each individual TPM must have an Owner before it is useful as a security device TPM Applications TPM is useful for any customer that is interested in providing an addition layer of security to the com puter system The TPM when bundled with an optional security software package can provide overall system security file protection capabilities and protect against email privacy concerns TPM h...

Страница 55: ...u how to setup the fingerprint registration 1 This wizard will automatically start whenTPM is enabled in BIOS see Appendix Click Next 2 Select Fingerprints and click Next 3 Select a finger on the diagram Swipe the corresponding finger on the scanner slowly You must swipe your finger multiple times for verification 4 Youmustregisteratleasttwofingerstodecrease the chance of problems ...

Страница 56: ...your finger multiple times for verification Youmustregisteratleasttwofingers to decrease the chance of any problems 6 Click Finish when done Fingerprint Registration on selected models cont 7 Right click the icon on the taskbar and select Settings and Options 8 Select General Options and Single Sign On and configure your preferences ...

Страница 57: ...ill be asked if you have set one Once your PIN has been verified searching for a 3G network will begin Once a 3G network has been discovered click Connect to make a wireless network connection Once connected the Connect button will show Disconnect instead Once connected a message will appear with the network name When you are in an area that prohibits wireless transmissions such as on an airplane ...

Страница 58: ...e pointer over this indicator shows the RSSI Received Signal Strength Indication in dBm An antenna with a line through it indicates no service is available Not in Service You are outside of the coverage area or have insufficient signal strength to maintain a GSM data connection Coverage The icon shows the fastest service available GPRS icon GPRS is the fastest service available in your current cov...

Страница 59: ...r is running the Watcher icon appears in the system tray indicating the connection status Watcher cannot detect the 3G modem Ensure that the 3G modem is powered on You do not have an active high speed connection You have an active high speed connection You have new unread SMS messages 3G or 3 G Short for third generation technology It is used in the context of mobile phone standards The services a...

Страница 60: ...60 4 Using the Notebook PC ...

Страница 61: ...re Recovery Glossary Declarations and Safety Statements Notebook PC Information Photos and icons in this manual are used for artistic purposes only and do not show what is actually used in the product itself There may be differences between your Notebook PC and the drawings shown in this manual Please accept your Notebook PC as being correct ...

Страница 62: ... systems no drivers are necessary USB Hub Optional Attaching an optional USB hub will increase your USB ports and allow you to quickly connect or disconnect many USB peripherals through a single cable USB Floppy Disk Drive An optional USB interface floppy disk drive can accept a standard 1 44MB or 720KB 3 5 inch floppy diskette WARNING To prevent system failures use Windows Safely Remove Hardware ...

Страница 63: ...ard will allow data entry to be more comfortable Attaching an external USB mouse will allow Windows navigation to be more comfortable Both the external USB keyboard and mouse will work simultaneously with the Notebook PC s built in keyboard and touchpad Printer Connection One or more USB printers can be simultaneously used on any USB port or USB hub ...

Страница 64: ...oth devices in Windows operating system 3 Select Add a Bluetooth Device on the taskbar menu 3c If launched from the Control Panel click Add from this screen 3b Or Launch Bluetooth Devices from the Windows Control Panel 2b Or double click the Wireless Console icon on the taskbar and select either the Wireless LAN Bluetooth or just the Bluetooth 2 Press FN F2 repeatedly until Bluetooth ON or WLAN Bl...

Страница 65: ...t of nearby Bluetooth devices will be shown Select the Bluetooth mouse and click Next 7 Select Don t use a passkey and click Next 9 Click Finish when adding is complete 10 You will see your device in the window You can also add or remove Bluetooth devices here 8 Wait while the Bluetooth mouse is being added Bluetooth Mouse Setup optional cont ...

Страница 66: ...luded as part of the factory pre install A recovery disc is optional and includes an image of the original operating system installed on the hard drive at the factory The recovery disc provides a comprehensive recovery solution that quickly restores the Notebook PC s operating system to its original working state provided that your hard disk drive is in good working order Contact your retailer if ...

Страница 67: ...reen select Boot Device Priority Security Setting 1 On the Security screen select Change Supervisor or Change User Password 2 Type in a password and press Enter 3 Re type the password and press Enter 4 Password is then set 1 Leave the password field blank and press Enter To clear the password 2 Password is then cleared ...

Страница 68: ... to allow the User Password to have in the BIOS setup utility User Access Level Save Changes If you want to keep your configuration settings you must save changes before exiting the BIOS setup utility If you want to restore default settings choose Load Manufacture Defaults You must then save changes to keep the manufacture default settings System BIOS Settings cont ...

Страница 69: ...the ATK0100 driver from the driver CD or download it from the ASUS website Hardware Problem Built in Camera The built in camera does not work correctly 1 Check Device Manager to see if there are any problems 2 Try reinstalling the webcam driver to solve the problem 3 If the problem is not solved update the BIOS to the latest version and try again 4 If the problem still exist contact your local ser...

Страница 70: ...a local service center for repair Mechanical Problem FAN Thermal Why is the cooling fan always ON and the temperature high 1 Make sure that the FAN works when the CPU temperature is high and check whether there is air flow from the main air vent 2 If you have many applications running see taskbar close them to decrease system load 3 The problem may also be caused by some viruses use anti virus sof...

Страница 71: ...ll them in Windows Safe Mode 3 Check your system for viruses 4 Update the BIOS to the latest version with WINFLASH in Windows orAFLASH in DOS mode These utilities and BIOS files can be downloaded from the ASUS website WARNING Make sure your Notebook PC does not loose power during the BIOS flashing process 5 If problem still cannot be solved use the recovery process to reinstall your entire system ...

Страница 72: ...elected BIOS information Check the model version and data c Click Flash to initialize the BIOS updating procedure d Click Exit when procedure completes e Reboot the system Assuming that you have successfully flashed the BIOS file press F2 to enter BIOS setup page when the ASUS logo appears during system boot up f After entering BIOS setup page go to Exit page and choose Load Manufacture Defaults T...

Страница 73: ...cking on the NIS icon in your system tray 2 Open Norton AntiVirus in Options menu 3 Click on Instant Messenger uncheck MSN Windows Messenger from Which Instant mes sengers to protect 5 NIS is damaged and need reinstalling NIS is located in the provided disc in the NIS200x folder x is the version number 6 The Start firewall when system is booted option is selected but it takes about one minute to s...

Страница 74: ...ms and Solutions Cont 9 Windows Firewall must be stopped before installing Norton Internet Security or Norton Personal Firewall How to stop Windows Firewall 1 Click Start and then Control Panel 2 You will have one of two control panels Click on the Security Center icon 3 Click on the Windows Firewall icon beneath the status updates 4 Click Off and then click OK 10 Why is the Privacy Control icon s...

Страница 75: ...amed RE COVERY The Recovery Partition is created at the fac tory and cannot be restored by the user if deleted Take your Notebook PC to an authorizedASUS service center if you have problems with the recovery process Using the Recovery Partition 1 Press F9 during bootup requires a Recovery Partition 2 Press Enter to select Windows Setup EMS Enabled 3 Read the ASUS Preload Wizard screen and click Ne...

Страница 76: ...com kb 937251 en us for more details Using the Recovery DVD 1 Insert the Recovery DVD into the optical drive Notebook PC needs to be powered ON 2 Restart the Notebook PC and press Esc on bootup and select the optical drive may be labeled as CD DVD using the down cursor and press Enter to boot from the Recovery DVD 3 Select a partition option and click Next Partition options Recover Windows to firs...

Страница 77: ...ter transfers data between computer components such as memory disks and the display adapter The BIOS instructions are built into the computer s read only memory BIOS parameters can be configured by the user through the BIOS Setup program The BIOS can be updated using the provided utility to copy a new BIOS file into the EEPROM Bit Binary Digit Represents the smallest unit of data used by the compu...

Страница 78: ...he slower parallel bus used in the PC card slot Not compatible with previous PCMCIA cards Hardware Hardware is a general term referring to the physical components of a computer system including pe ripherals such as printers modems and pointing devices IDE Integrated Drive Electronics IDE devices integrate the drive control circuitry directly on the drive itself eliminating the need for a separate ...

Страница 79: ...zardous diffuse reflections Personnel working with these lasers should wear appropriate protective eye wear during any operation of the laser Class 3B lasers have both admin istrative and physical controls to protect personnel Physical controls include limited access work areas Administrative controls include special warning signs posted outside the entrances to the laser work spaces and lights ou...

Страница 80: ...ta The TPM provides the ability to the PC or Notebook PC to run applications more secure and to make transactions and communication more trustworthy Twisted Pair Cable The cable used to connect the Ethernet card to a host generally a Hub or Switch is called a straight through Twisted Pair Ethernet TPE The end connectors are called RJ 45 connectors which are not compatible with RJ 11 telephone conn...

Страница 81: ...quire that all DVD movies be limited to a particular region usually coded to the region at which it is sold While DVD movie content may be released for multiple regions CSS design rules require that any system capable of playing CSS encrypted content must only be capable of playing one region Region Definitions Region 1 Canada US US Territories Region 2 Czech Egypt Finland France Germany Gulf Stat...

Страница 82: ...g if provided is by means of dual tone multifrequency signalling Network Compatibility Declaration Statement to be made by the manufacturer to the Notified Body and the vendor This declaration will indicate the networks with which the equipment is designed to work and any notified networks with which the equipment may have inter working difficulties Network Compatibility Declaration Statement to b...

Страница 83: ... Yes Norway Yes No Poland No Not Applicable Portugal No Not Applicable Spain No Not Applicable Sweden Yes No Switzerland Yes No United Kingdom Yes No This information was copied from CETECOM and is supplied without liability For updates to this table you may visit http www cetecom de technologies ctr_21 html 1 National requirements will apply only if the equipment may use pulse dialling manufactur...

Страница 84: ...Connect the equipment into an outlet on a circuit different from that to which the receiver is connected Consult the dealer or an experienced radio TV technician for help WARNING The use of a shielded type power cord is required in order to meet FCC emission limits and to prevent interference to the nearby radio and television recep tion It is essential that only the supplied power cord be used Us...

Страница 85: ...ration within 5 15 GHz and 5 25GHz frequency ranges and is restricted to indoor environments only FCC Caution Any changes or modifications not expressly approved by the party re sponsible for compliance could void the user s authority to operate this equipment The manufacturer declares that this device is limited to Channels 1 through 11 in the 2 4GHz frequency by specified firmware controlled in ...

Страница 86: ...tments in which the use of the 2400 2483 5 MHz band is permitted with an EIRP of less than 100mW indoors and less than 10mW outdoors 01 Ain Orientales 02 Aisne 03 Allier 05 Hautes Alpes 08 Ardennes 09 Ariège 11 Aude 12 Aveyron 16 Charente 24 Dordogne 25 Doubs 26 Drôme 32 Gers 36 Indre 37 Indre et Loire 41 Loir et Cher 45 Loiret 50 Manche 55 Meuse 58 Nièvre 59 Nord 60 Oise 61 Orne 63 Puy du Dôme 64...

Страница 87: ...red for UL1642 covering primary non rechargeable and secondary rechargeable lithium batter ies for use as power sources in products These batteries contain metallic lithium or a lithium alloy or a lithium ion and may consist of a single electrochemical cell or two or more cells connected in series parallel or both that convert chemical energy into electrical energy by an irreversible or reversible...

Страница 88: ...ded product lifetime through easy up grades and longer time availability of spare parts 6 Reduced solid waste through take back policy For more information on the EU Flower label please visit the European Union Eco label Hompage http europa eu int ecolabel ASUS recycling and takeback programs come from our commitment to the highest standards for protecting our environment We believe in providing s...

Страница 89: ...new products And the environment is protected from any uncontrolled release of harmful chemicals ASUS works with recycling vendors with the highest standards for protecting our environment ensuring worker safety and complying with global environmental laws Our commitment to recycling our old equipment grows out of our work to protect the environment in many ways For further information about ASUS ...

Страница 90: ... tilbage til leverandøren Danish VARNING Explosionsfara vid felaktigt batteribyte Använd samma batterityp eller en ekvivalent typ som rekommenderas av apparattillverkaren Kassera använt batteri enligt fabrikantens instruktion Swedish VAROITUS Paristo voi räjähtää jos se on virheellisesti asennettu Vaihda paristo aino astaanlaitevalmistajansousittelemaantyyppiin Hävitäkäytettyparistovalmistaganohje...

Страница 91: ...regulations for laser products on August 2 1976 These regulations apply to laser products manu factured from August 1 1976 Compliance is mandatory for products marketed in the United States Macrovision Corporation Product Notice This product incorporates copyright protection technology that is protected by method claims of certain U S A patents and other intellectual property rights owned by Macro...

Страница 92: ...A Appendix A 32 CTR 21 Approval for Notebook PC with built in Modem Danish Dutch English Finnish French German Greek Italian Portuguese Spanish Swedish ...

Страница 93: ...Appendix A A 33 ...

Страница 94: ...r ______________________________ Type _______________ BIOS Version _ __________________________________________Date _______________ Accessories _ _____________________________________________________________ Accessories _ _____________________________________________________________ Software Operating System _ __________Version _ ___________ Serial Number _______________ Software _ _______________...

Отзывы: