EN
Limestone cleaning
'DPDJHFDXVHGE\OLPHVFDOHLVQRWFRYHUHGE\ZDUUDQW\
&DUU\RXWWKHOLPHVFDOHFOHDQLQJRSHUDWLRQRQFHHYHU\PRQWKV&DUU\RXWWKHOLPHVFDOH
FOHDQLQJRSHUDWLRQRQFHDPRQWKLIWKHZDWHUXVHGLVYHU\KDUGDQGFDOFDUHRXV
In case of appliance malfunction due to the frequent use of hard and calcareous water, carry out
the limescale cleaning procedure.
Warning!
Carry out the scale cleaning operation in a ventilated room.
When cleaning the limescale, apply steam to a resistant surface or on a washable cloth.
Do not inhale the vapours emitted during the limescale cleaning process.
8QSOXJWKHSRZHUFRUGIURPWKHSRZHUVRFNHW
2 Open the water tank cap (G).
3 Fill the tank with a mixture of 1/3 white vinegar and 2/3 of fresh, clean water.
3ODFHWKHDSSOLDQFHVRWKDWWKHVWHDPLVQRWGLVSHQVHGRQDQ\REMHFWRUVXUIDFH
5 Connect the plug into the socket. The power-on indicator (K) will automatically light up, indicat-
ing that the appliance is turned on and that the boiler starts heating.
6 Leave the appliance into operation for at least one minute.
7XUQWKHVWHDPDGMXVWPHQWNQRE-WR³´
/HDYHRIIWKHDSSOLDQFHIRUDPLQXWH
Repeat until the release of steam is noticed.
Let the all the steam come out until there is no more solution in the tank. If necessary, repeat the
operation.
8QSOXJWKHSRZHUFRUGIURPWKHSRZHUVRFNHW
10 Fill the tank with fresh, clean water. Rinse and empty.
8VHWKHSURYLGHGPHDVXULQJFXS4DQGIXQQHO5WR¿OOWKHZDZLWKPORIIUHVK
still water, corresponding to one and a half measuring cup (Fig. 4).
12 Connect the plug into the socket. The power-on indicator (K) will automatically light up.
7XUQWKHVWHDPDGMXVWPHQWNQRE-FORFNZLVH
14 Deliver steam until consuming all the water in the tank.
If necessary, repeat the operation until no more limescale residue can be seen from the steam
ducts.
Immerse the accessories in a solution with water and vinegar to remove any limescale residue.
Fit the accessory on the appliance and dispense steam.
26