Eureka Mignon MAGNIFICO User Handbook Manual Download Page 2

V

EN

 PRECAUTIONS AND SAFETY FEATURES 

EN

Machine design has taken into account all reasonable user safety precau-
tions;  nevertheless,  particular  conditions  of  installation  and/or  handling 
may create unforeseen situations beyond the installer's control which will 
require case-by-case evaluation of residual risks.
We recommend keeping the following in mind:

‡

  Always handle the machine with care to avoid the danger of its falling.

‡ 7KH SDFNLQJ PDWHULDOV FDUWRQ FHOORSKDQH VWDSOHV SRO\VW\UHQH HWF

can  cut,  wound  or  create  hazards  if  used  improperly  or  handled  care-
lessly.  Store  such  materials  out  of  reach  of  children  and  irresponsible 
persons.

‡ 7KLVV\PERORQWKHDSSOLDQFHRUSDFNDJHPHDQVWKDWWKHDSSOL

-

ance must not be considered as normal household refuse but 
that  it  must  instead  be  delivered  to  an  appropriate  collection 
centre  for  the  recycling  of  electric  and  electronic  appliances. 
Make sure that this appliance is disposed of correctly and you 
too will be making your contribution to the prevention of nega-
tive  effects  on  health  and  the  environment,  which  could  otherwise  be 
caused  by  inadequate  disposal.  Recycling  materials  helps  to  preserve 
our  natural  resources.  For  more  information  about  how  to  recycle  this 
product,  you  can  contact  your  local  council  office,  local  refuse  disposal 
service or the retailer from whom you purchased the appliance.

‡ %HIRUH FDUU\LQJ RXW DQ\ LQVWDOODWLRQ RU DGMXVWPHQW SURFHVV EH VXUH WR

have read and thoroughly understood the warnings in this manual.

‡ 7KHFRPSDQ\FDQQRWEHKHOGOLDEOHIRUDQ\GDPDJHWRSHRSOHRUSURSHUW\

resulting from failure to respect the instructions concerning safety, instal-
lation and maintenance contained in this manual.

‡

The  power  cord  of  this  appliance  must  never  be  replaced  by  the  user.  In 
case of damage, switch the appliance off and contact only the manufacturer 
or related after-sales service, otherwise a skilled personnel for replacement.

‡

  Should  you  decide  to  no  longer  use  this  type  of  appliance,  we  recom-

mend that you make it inoperative: unplug the appliance from the mains 
socket and cut off the power cord.

‡ $OO GHIHFWV DQGRU DQRPDORXV PDFKLQH EHKDYLRXU VKRXOG EH UHSRUWHG

immediately to authorized installation and/or maintenance personnel.

‡ %HIRUHFRQQHFWLQJWKHPDFKLQHFKHFNWKDWHOHFWULFDOSRZHUVXSSO\FRU

-

responds to the specifications on the data plate.

‡ ,QFDVHRILQFRPSDWLELOLW\EHWZHHQWKHSOXJDQGWKHVRFNHWKDYHWKHSOXJ

replaced with a suitable type by the manufacturer, his after-sales service, 
or by skilled personnel, who should also check that the section of the plug 
wires is suitable for the power absorbed by the appliance.

‡ $YRLGXVHRIPXOWLSOHSOXJDGDSWHUVDQGH[WHQVLRQFRUGV

‡ 7KHJURXQGZLUHPXVWEHFRQQHFWHGWKHHOHFWULFDOV\VWHPPXVWPHHWWKH

standards set by local safety laws and regulations.

‡ 7KHPDFKLQHPXVWEHLQVWDOOHGRQO\E\DXWKRUL]HGTXDOLILHGSHUVRQQHO

‡ &KHFNWKDWWKHPDFKLQHFRPSRQHQWVKDYHVXIIHUHGQRGDPDJH GXULQJ

shipping; in the case defects or anomalies are found, interrupt installation 
and request replacement.

Summary of Contents for Mignon MAGNIFICO

Page 1: ...LIBRETTO ISTRUZIONI USER HANDBOOK GEBRAUCHSANWEISUNGEN Istruzioni Originali Translation of the Original Instructions Übersetzung der Originalanleitungen PERFETTO SILENZIO MAGNIFICO SPECIALITA ...

Page 2: ...RFHVV EH VXUH WR have read and thoroughly understood the warnings in this manual 7KH FRPSDQ FDQQRW EH KHOG OLDEOH IRU DQ GDPDJH WR SHRSOH RU SURSHUW resulting from failure to respect the instructions concerning safety instal lation and maintenance contained in this manual The power cord of this appliance must never be replaced by the user In case of damage switch the appliance off and contact only...

Page 3: ...H DQG SHUIRUPLQJ PDFKLQH maintenance shall inform the manufacturer of any defects or damages GXH WR ZHDU WKDW PLJKW MHRSDUGL H WKH RULJLQDO VDIHW IHDWXUHV RI WKH machine 7KH LQVWDOOHU VKDOO EH UHVSRQVLEOH IRU FKHFNLQJ WKDW WKH PDFKLQH LV installed in tolerable environmental conditions such as to not to create health or safety hazards for those using the machine Q UHVSRQVLELOLW GHULYLQJ IURP FRPSRQ...

Page 4: ...HSDLUHG E WKH PDQX facturer his authorized after sales service or skilled personnel 1HYHU LQVHUW VSRRQV IRUNV RU RWKHU XWHQVLOV LQWR WKH SRXULQJ OLS 4 or into the coffee grain container 2 for any reason whatsoever while the appliance is operating OZD V VZLWFK RII WKH DSSOLDQFH EHIRUH UHPRYLQJ EORFNDJHV IURP WKH pouring lip 1HYHU SODFH WKH DSSOLDQFH LQ ZDWHU RU RWKHU OLTXLGV 6KRXOG D IRUHLJQ ERG VW...

Page 5: ...truito in conformità alle direttive To which this declaration relates following the provisions of the directives 2006 42 CE 2006 95 CE 2004 108 CE 2002 95 CE 2002 96 CE 2003 108 CE Ed è conforme alle direttive following the provisions of the directives UNI EN 12100 1 2 UNI EN ISO 13857 CEI EN 55014 1 2 CEI EN 61000 3 2 3 CEI EN 60335 1 CEI EN 60335 2 64 CEI EN 62233 EN 60704 1 1994 autorizziamo la...

Page 6: ... 1 XIII SILENZIO PERFETTO SPECIALITA MAGNIFICO 1 1 2 2 3 4 4 5 5 6 6 12 14 16 11 10 10 8 8 18 19 7 7 9 13 15 17 ...

Page 7: ...5 2 4 3 6 7 8 XIV ...

Page 8: ...1 Versione Italiana Pagina 2 English version Page 8 Deutsche Version Abb 14 ...

Page 9: ...0 Width mm 120 Depth mm 180 Noise factor dBA 73 3 APPLIANCE DESCRIPTION Fig 1 1 Container lid 2 Coffee bean container 3 Touch screen display 4 Dispensing spout 5 Grinding start button 6 Filter holder fork 7 Power ON switch 8 Grinding adjusting knob standard for SPECIALITA MAGNIFICO SILENZIO version 9 Grinding adjusting knob EASY SETTING for PERFETTO version 10 Coffee bean container for opening clo...

Page 10: ...nual shall invalidate the guarantee conditions and shall release the manufacturer from all responsibility the machine must be used only by adult responsible persons This manual must be preserved with care the manufacturer declines all responsibility for damages to persons or things or to the machine itself deriving from improper use or use in manners other than those described herein or in the cas...

Page 11: ...on 5 6 2 2 TIMED mode Enable this mode by setting the selection button 19 Fig 1 to T 7KH GLVSHQVLQJ WLPH IRU JURXQG FRIIHH LV VHW E DGMXVWLQJ WKH SRWHQWLRPHWHU 18 turning it to increase or reduce the amount of ground coffee Fig 1 LVSHQVLQJ ZLOO VWRS DV VRRQ DV WKH VHW WLPH LV RYHU 6 3 FUNCTIONING PERFETTO SPECIALITA MAGNIFICO 6HOHFW WKH VLQJOH GRXEOH GRVH XVLQJ WKH DSSRVLWH EXWWRQV 16 or 17 5HVW W...

Page 12: ...e countdown to zero are activated KHQ WKH GLVSHQVLQJ LV FRPSOHWH WKH JULQGLQJ WLPH JRHV EDFN WR WKH YDOXH VHW 7KH FRXQWHU RI VLQJOH RU GRXEOH GRVHV LV LQFUHDVHG E 6HOHFW WKH VLQJOH 16 or double dose 17 and press the buttons 14 and 15 to increase or reduce the dispensing time of the selected dose the time is shown in seconds on the display I WKH EXWWRQ 14 or 15 is kept pressed for some seconds the ...

Page 13: ...es 6LQJOH GRVH EXWWRQ 16 and double dose button 17 access to the count of the dispensed continuous doses On the display only the selected buttons remain on and the numbers of doses are shown in pairs progressively For instance if the dose total is 142536 the display shows the digits 14 25 and 36 each one for two seconds After the last digit pair it stops for 4 seconds and then the sequence restart...

Page 14: ...coffee bean container 2 removing the oily coat left by coffee beans by means of a clean cloth You should also clean the lid or pouring lip with a brush and a clean cloth if necessary If this operation is not completed there is a risk of the oily and aromatic part of the coffee from becoming rancid and spoiling the flavour of the next batch of coffee Use a damp cloth to clean the base 7 2 MAINTENAN...

Page 15: ...CONTI VALERIO S r l Via Luigi Longo 39 41 50019 Sesto Fiorentino FI ITALY Graphics and Printing by X Type Engineering S r l M24 01_03 2018 ...

Reviews: