Makita EK8100 Скачать руководство пользователя страница 21

21

Cleaning the protection hood

Over time, the inside of the protective hood can become caked 

with material residue (especially from wet cutting), which if 

allowed to accumulate can hinder the free rotation of the cut-

ting disc. For this reason the hood must be cleaned out from 

time to time.
Take off the cutting wheel with spring washer and remove the 

accumulated material from inside the hood with a strip of wood 

or similar implement.
Clean the shaft and all removed parts.

NOTE: To install the cutting wheel see ”Mounting the cutting 

wheel”.

Cleaning / changing the air filter

Turn the cover lock (11) counterclockwise to release it, and 

carefully remove the filter cover (12).
There is a gasket (15) between the filter cover (12) and the 

hood (14).

Remove screws (13) and take off the cover (14).
Clean the gasket (15) with a brush, and check for damage.

Take the pre-filter (foam, 17) out of the filter cover.
Pull the air filter insert (paper cartridge, 18) out of the cover.
Remove the inner filter (16) from the intake opening.

Note:
Do not allow dirt to get into the carburetor!
Switch the combination switch to ”Choke” or cover the carbu-

retor with a clean cloth.

Содержание EK8100

Страница 1: ...MAKITA 2 STROKE ENGINES WILL VOID YOUR ENGINE WARRANTY ATTENTION Suivez toujours les conseils de sécurité du présent manuel d emploi et de sécurité Une utilisation incorrecte de la tronçonneuse peut entraîner des blessures graves Lisez et comprenez ce manuel Conservez avec soin ce manuel ATTENTION LES CARBURANTS CONTENANT PLUS DE 10 D ÉTHANOL NE SONT PASAUTORISÉS POUR L UTILISATION DANS LES MOTEUR...

Страница 2: ... lightweight tools Other advantages of the MAKITA Power Cuts Sturdy construction and high reliability Maintenance free electronic ignition hermetically sealed to protect against dust and moisture This spark ignition system complies with the Canadian standard ICES 002 Vibration damping with the MAKITA2 mass system D2M for tireless working even when guiding the Power Cut by hand Five stage air filte...

Страница 3: ...ipped circular saw blades or any kind of wood cutting blades Never use damaged cutting discs Combination Choke Start Stop I O switch Starting procedure Press decompression valve Engine manual start Stop engine Warning Kickback Fuel and oil mixture First aid Recycling Do not touch hot surfaces Read operator s and safety manual and follow the warning and safety precautions Particular care and cautio...

Страница 4: ...tion or other substances which may impair vision dexterity or judgement A fire extinguisher must be available in the immediate vicinity when working in easily inflammable vegetation or when it has not rained for a long time danger of fire Asbestos and other materials that can release toxins may be cut only with the necessary safety precautions and after notification of the proper authorities and u...

Страница 5: ...ction of sparks Fuel cannot be stored for an unlimited period of time Buy only as much as will be consumed in the near future When making up the gasoline oil mixture always put the oil in the mixing container first and then the gasoline Use only approved and marked containers for the transport and storage of fuel Keep fuel away from children Putting into operation Do not work on your own There mus...

Страница 6: ...bed in this oper ator s manual 13 Always place your left foot in the rear handle and grasp the other handle firmly with thumb and fingers Other starting methods are not allowed WhenstartingthePowerCutitmustbewellsupportedandsecurely held The cutting disc must not be touching anything If the cutting disc is new test it by running it at least 60 seconds at topspeed Whendoingthis makesurethatnoperson...

Страница 7: ...zards electrical wires inflammable substances Clearly mark the work area for example with warning signs or by cordoning off the area When working with the Power Cut hold it firmly by the front and rear handles Never leave the Power Cut unattended Use the Power Cut at high speed as far as possible see Tech nical Data Only use the Power Cut during good light and visibility periods Be aware of slippe...

Страница 8: ... Instead always cut shallow around the whole piece Worn discs have a smaller diameter than new discs so that at the same engine speed they have a lower effective circumfer ential speed and therefore do not cut as well Cut I beams and L bars in steps see Figure 21 Cut bands and plates like pipes along the wide side with a long cut Whencuttingmaterialunderstress supportedmaterialormate rial in struc...

Страница 9: ...the unit with the engine on or the disc moving Carry the unit only by the tubular middle handle with the cut ting disc pointing behind you 26 Avoid touching the exhaust muffler burn hazard When moving the Power Cut over longer distances use a wheelbarrow or wagon When transporting the Power Cut in a vehicle make sure it is securely positioned in such a way that no fuel can leak out Always remove t...

Страница 10: ...KITA spares accessories or cutting discs increases the risk of accident We cannot accept any responsi bility for accidents or damage occurring in association with the use of cutting discs or accessories other than original MAKITA First aid For the event of a possible accident please make sure that a firstaidkitisalwaysimmediatelyavailablecloseby Immediately replace any items used from the first ai...

Страница 11: ... diameter in 0 8 0 8 1 0 5 Overall weight tanks empty without cutting disc lb 21 56 22 00 EK7300 EK7301 2 Circumference speed at max engine speed 3 Outside diameter arbor hole maximum permissible thickness of the composite wheels 4 Country specific 5 HD Displacement cu in cm3 4 9 81 Bore in mm 2 05 52 Stroke in mm 1 49 38 Max power operating speed hp kW 1 min 5 6 4 2 9 150 Max torque Nm 5 0 Idling...

Страница 12: ...Retaining nuts 10 Stand 11 Carburetor adjustment opening 12 Identification plate 13 Fuel tank with handle 14 Decompression valve 15 Starter grip 16 Air intake 17 Combination switch Choke Start Stop I O 18 Safety locking button 19 Throttle lever 20 Tank cap fuel 21 Starter housing with starter 22 Cutting disc 23 Disc bolt 24 Spring washer 25 Hold opening 1 2 3 4 5 6 7 8 25 9 10 12 11 13 14 24 23 17...

Страница 13: ...the machine See SAFETY INSTRUCTIONS Page 6 Unscrew screw 9 and remove the spring washer 8 Place the reduction sleeve and the cutting disc 5 on the arbour 7 Note A reduction sleeve is included in the scope of delivery It is used to fit the composite wheel to the machine Use only original MAKITA reduction sleeves CAUTION The arbor hole of the cutting disc must be an exact fit with the arbor or shaft...

Страница 14: ...h off the engine and disconnect the spark plug cap NOTE When using a protective hood for a maximum disk diam eter of 300 mm 12 always shorten hose 15 to 180 mm 7 To do this unscrew sleeve 16 and carefully pull tube 15 off coupling 17 and cut to 180 mm Then push the tube end back over the coupling and tighten the sleeve all the way Install the water connection as shown in figure Push clamp 22 aroun...

Страница 15: ... use fuel with a higher octane value This will not affect the engine In order to obtain an optimum engine output and to protect your health and the environment use unleaded fuel only Tolubricatetheengine useasyntheticoilfortwo strokeair coo led engines quality grade JASO FC or ISO L EGD which has to be added to the fuel Gasoline 50 1 The correct mixture ratio 50 1 WhenusingMAKITAsynthetictwo strok...

Страница 16: ...c two stroke engine oil 50 1 is available in the following sizes to suit your individual requirements 2 6 floz order number T 00745 6 4 floz order number T 00739 NOTE For preparing the fuel oil mixture first mix the entire oil quantity with half of the fuel required then add the remaining fuel Shake the finished mixture thoroughly before pouring it into the tank Caution Open the tank cap carefully...

Страница 17: ...erve the SAFETY INSTRUCTIONS on page 3 and 4 Start the Power Cut only after complete assembly and inspection Move at least 3m 10 feet away from the place where you fuelled the Power Cut Make sure you have a good footing and place the Power Cut on the ground in such a way that the cutting disc is not touching anything 3 meters Move the protective hood 3 into the proper position for the work you int...

Страница 18: ...hrottle lock NOTE If the Power Cut is mounted on the trolley do not operate the gas lever throttle on the side of the trolley Pull the starter cable out slowly until you feel resistance piston is now just before top dead center Press in the decompression valve 5 Pull starter cable quickly and firmly until you hear the first ignition but to a max of 3 5 pulls Important Do not pull the starter cable...

Страница 19: ...ngly the holes for the two screws are sealed shut For correct adjustment of the idling speed the following steps must be carried out Starttheengineandrunituntilitiswarm about3 5minutes Adjust the carburetor with the screwdriver 1 included with the Power Cut It has a lug that helps with adjustment Readjust the idling speed If the cut off disc is still turning when the engine is running unscrew the ...

Страница 20: ...ired by a MAKITA service center before being used again SERVICE Unscrew the screws 8 and remove the crankcase housing cover 9 Remove the old belt 10 or belt pieces NOTE The illustration shows the V belt for models EK7300 7301 Clean out the inside of the drive arm with a brush Put in a new V belt NOTE Reassemble the crankcase housing cover 9 side piece 6 and cover 4 in the reverse order To tighten ...

Страница 21: ...ed parts NOTE To install the cutting wheel see Mounting the cutting wheel Cleaning changing the air filter Turn the cover lock 11 counterclockwise to release it and carefully remove the filter cover 12 There is a gasket 15 between the filter cover 12 and the hood 14 Remove screws 13 and take off the cover 14 Clean the gasket 15 with a brush and check for damage Take the pre filter foam 17 out of t...

Страница 22: ...roughly NOTE The pre filter must be cleaned daily or several times daily if working under dusty conditions If cleaning is not possible on site have spare pre filters on hand Replace the pre filter at least every 25 operating hours To insert the pre filter in the filter cover 4 position it so it fits the space in the cover and then press it in 5 The pre filter must fit completely and cover all part...

Страница 23: ...etainer out of the opening Empty fuel tank Use a wire hook to pull the suction out of the tank opening for replacement Caution Do not allow fuel to come into contact with skin Replacing the spark plug CAUTION Do not touch the spark plug or plug cap if the engine is running high voltage Switchofftheenginebeforestartinganymaintenancework A hot engine can cause burns Wear protective gloves The spark ...

Страница 24: ...UTION Do not let the knots or the cable ends protrude from the outside of the cable pulley Pull knot 22 into the cable grip 23 Guide the cable into the recess 24 on the cable drum and use the cable to turn the drum two turns in the direction shown by the arrow Holding the cable drum in your left hand straighten out the twist in the cable with your right hand pull the cable tight and hold Release t...

Страница 25: ...ings are delivered already tensioned in the housing CAREFUL the spring can pop out If it does it can be put back in as shown in the diagram observe the direction of rotation Before installing the new return spring 4 in the starter housing grease it lightly with multipurpose grease Order No 944 360 000 Then position it and press it until the tabs 5 engage in the slots Do not grease the cable drum 2...

Страница 26: ...ool 8 toleveroutthestoppin 9 asshown in the illustration until the protective hood 11 can be turned NOTE The turn stop 7 is deactivated when the stop pin 8 is removed This permits the hood 11 to be turned farther than the turn stop 7 Unscrew the grip 10 and turn the protective hood 11 as shown in the illustration Disengage the V belt 12 and remove the cutting attachment NOTE The illustration shows...

Страница 27: ... IMPORTANT When you reposition the cutting attachment the direction of rotation of the cutting wheel changes If a rotation direction is marked on the cutting disc make sure the disc turns in the right direction Replacing cleaning the spark arrester screen CAUTION Do not use sharp or pointed objects for screen cleaning Damaged or misformed screen wires may result The spark arrester screen should be...

Страница 28: ...nting to the trolley and Power Cut are very fast and simple Mains pressure water system 6 The mains pressure water system is designed to be mounted on the Power Cut It can be used with or without the trolley but is especially suitable for applications involving hand held stationarycutting Thewaterlinehasafast releaseconnection and can be fed either from a mains supply or from a pressure tank 7 The...

Страница 29: ... dealer He will also have the spare part lists to determine the required spare part numbers and will be constantly informed about the latest improvements and spare part innovations Please bear in mind that if parts other than original MAKITA spare parts are used this will automatically invalidate the MAKITA product guarantee We will furthermore not accept any liability damages arising from the use...

Страница 30: ...arantee All repairs covered by the guarantee must be performed by a MAKITA service center Malfunction System Observation Cause Cutting disc does not start turning Clutch Engine runs Damage to clutch Cutting disc runs in idle Carburetor Cutting disc runs Incorrect idle speed clutch blocked clutch Engine does not start or Ignition system Ignition spark Malfunction in fuel supply system com only with...

Страница 31: ...31 Extract from the spare parts list Use only original MAKITA parts For repairs and replacement of other parts see your MAKITA service center EK7300 EK7301 EK8100 32 31 29 30 22 28 19 24 25 26 27 4a ...

Страница 32: ...crew M8x25 4 1 V belt for EK7300 EK7301 4a 1 V belt for EK8100 5 1 Suction head 6 1 Tank cap compl fuel 8 1 Inner filter 9 1 Air filter insert paper cartridge 10 1 Pre filter foam 11 1 Spark plug 12 1 Starter cable ø 4 0x1000 mm 13 1 Starter grip 14 1 Return spring in housing 15 2 Hexagonal nut M8 16 1 Universal wrench SW 13 19 17 1 Offset screwdriver T27 18 1 Screwdriver carburetor 19 1 Spark arr...

Страница 33: ...ent contacter leur médecin et le fabricant du dispositif avant de mettre la machine en service SeulementpourEK7300 7301 Lapériodedeconformitérelative aux émissions indiquée sur le label de conformité à la régle mentation relative aux émissions indique le nombre d heures de service pendant lesquelles le moteur s est avéré répondre aux exigences d émissions nationales Catégorie C 50 heures B 125 heu...

Страница 34: ...er des disques à découper défectueuses Commutateur combiné Starter Marche Arrêt E S Démarrage Appuyer sur la soupape de décompression Démarrer le moteur Arrêter le moteur Attention Rebond kickback Mélange carburant Premier secours Recyclage Ne touchez pas les surfaces chaudes Lire instructions d emploi et suivre les consignes de sécurité et d avertissement Danger et attention particulirs Interdit ...

Страница 35: ...l alcool de drogues de mé dicaments ou d autres substances risquant d affecter la vue l aptitude ou les réflexes Avoir un extincteur sous la main en cas de travaux dans un végétation facilement inflammable ou par temps de sécheresse Danger d incendie Le découpage de l amiante ou de substances susceptibles de dégager des gaz toxiques ne doit être effectué qu après en avoir faitlademandeetsouslasurv...

Страница 36: ...s de projection des étincelles du disque à découper Les carburants ne peuvent pas être stockés infiniment N ache ter que la quantité nécessaire couvrant un temps de marche prévisible Lorsquevouseffectuezlemélangeessence huile remplird abord l huile et ensuite l essence dans le bac de mélange Ne transporter et ne stocker le carburant que dans des nourrices agrées et portant les indications nécessai...

Страница 37: ...découpeuse que selon les instructions indiquées dans la notice d emploi 13 Poser toujours le peid droit gauche la poignéeetentourerlapoignéeaveclepouce D autrestechniques de lancement ne sont pas autorisées Lorsdelamiseenroute lamachinedoitêtresolidementmaintenue et supportée Pour cela le disque à découper doit être libre Si le disque à découper est neuf il doit être testé avant le premier découpa...

Страница 38: ...t par exemple des panneaux d avertissement ou des barrages quelconques Utilisez la découpeuse en la tenant correctement par la poignée avant et arrière Ne jamais laisser la découpeuse sans aucune surveillance Faire fonctionner la découpeuse si possible à haut régime cf Caractéristiques techniques Ne travailler que sous de bonnes conditions de visibilité et d éclairage Faire particulièrement attent...

Страница 39: ...ntdécoupésencoupant verticalement Manipuler les tubes de grand diamètre comme les barres massives Pour éviter de tenir de travers et pour un meilleur contrôle du découpage ne pas laisser le disque trop pénétrer dans le matériau Toujours tronçonner à plat tout autour Les disques à découper usées de faible diamètre ont au même régimemoinsdevitessepériphériqueetcoupentparconséquent moins bien Tronçon...

Страница 40: ...r ou le disque est en marche Ne porter la découpeuse que par la poignée étrier Le disque à découper est orienté vers l arrière 26 Ne jamais entrer en contact avec le pot d échappement risque de brûlure Utiliser une brouette ou un chariot pour le transport sur une distance assez longue Si la découpeuse est transportée par un véhicule automobile s assurer que celle ci soit dans une position sûre pou...

Страница 41: ... n étant pas d origine MAKITA il faut s attendre à un risque d accident important MAKITA ne pourra être tenu responsable en cas d accidents ou de dommages avec des disques à découper ou accessoires n étant pas d origine Premier secours On devra toujours disposer sur le lieu de travail d une boîte de secours pour le cas d un éventuel accident Les produits prélevés doivent immédiatement être remplac...

Страница 42: ...roche in 0 8 0 8 1 0 5 Poids de la découpeuse réservoirs vides sans disque lb 21 56 22 00 EK7300 EK7301 2 Vitesse périphérique pour régime max 3 Diamètre extérieur trou de réception épaisseur max autorisée des disques 4 En fonction du pays 5 HD EK8100 Cylindrée cu in cm3 4 9 81 Alésage in mm 2 05 52 Course in mm 1 49 38 Puissance max vitesse de rotation nominale hp kW 1 min 5 6 4 2 9 150 Couple ma...

Страница 43: ...e du carburateur 12 Plaque signalétique 13 Réservoir avec protége main 14 Soupape de décompression 15 Poignée de lancement 16 Orifice d aspiration d air 17 Commutateur combiné Starter Marche Arrêt E S 18 Bouton de blocage pour mi gaz 19 Levier d accélération 20 Couvercle du réservoir à essence 21 Boîtier du démarreur avec dispositif de lancement 22 Disque à découper 23 Vis de fixation du disque à ...

Страница 44: ...près l avoir monté sur la décou peuse voirCONSIGNESDESECURITEpage37 Dévisser la vis 9 et retirer le disque de contrainte 8 Poser le douille de réduction et disque à découper 5 sur l arbre 7 Note La découpeuse est livrée avec une douille de réduction permettant d adapter le disque à l appareil N utiliser que des douilles de réduction d origine MAKITA ATTENTION Le diamètre intérieur du disque à déco...

Страница 45: ...tre le moteur hors tension et de retirer la cosse de bougie pendant tous les travaux effectués sur la tron çonneuse ATTENTION Il est obligatoire de réduire le tuyau 15 à 180 mm 7 en cas d utilisation d un capot de protection pour un diamètre de disque maximal de 300 mm 12 Pour cela desserrer l écrou raccord 16 retirer le tuyau 15 du raccord 17 avec précaution et le raccourcir à 180 mm Ensuite réap...

Страница 46: ...é d octane minimum de 89 R M 2 Si un tel type de carburant n était pas disponible on peut aussi utiliser un carburant d un degré d octane plus élevé Le moteur n en subit aucun dommage Pour un fonctionnement optimal ainsi que pour la protec tion de la santé et de l environnement utilisez toujours un carburant sans plomb Le graissage du moteur est réalisé par une huile moteur à deux temps synthétiqu...

Страница 47: ... temps de MAKITA 50 1 peut être livrée selon les besoins dans des bidons aux contenances suivantes 2 6 flz N de commande T 00745 6 4 flz N de commande T 00739 REMARQUE Pour fabriquer le mélange essence huile il faut toujours mélanger préalablement le volume d huile prévu dans la moitié du volume d essence puis y ajouter le volume d essencerestant Avantdeverserlemélangedansl appareil bien le mélang...

Страница 48: ...ativement les INSTRUCTIONS DE SÉCU RITÉ de la page 33 et 34 La découpeuse ne peut être mise en marche qu après le montage complet Démarrer le moteur au moins 3 m 10 pieds de l endroit du réservoir Prendre une position sure et poser la découpeuse de ma nière à ce que le dispositif de découpage ne soit tourné dans votre direction 3 mètres Mettre le capot de protection 3 en position optimale cf Figur...

Страница 49: ...e cordon de lancement plus d environ 50 cm et le ramener lentement à la main Y enfoncer la vanne de décompression 5 Appuyer maintenant sur le bouton combiné 6 en position moyenne I Tirer de nouveau sur le cordon de lancement rapidement et fortement Dès que le moteur tourne empoigner la poignée la touche de blocage de sécurité 8 est appuyée par la pomme de la main et presser légèrement le levier d ...

Страница 50: ...er spécialisé MAKITA Les perçages des deux vis de réglage sont par conséquent couverts Lesopérationssuivantessontnécessairespourunréglage correct du régime de ralenti Démarrez le moteur et laissez le tourner jusqu à ce qu il soit chaud env 3 à 5 min Utiliser le tournevis 1 Il possède un talon soudé servant au réglage Corrigez le réglage du régime de ralenti Si le disque à découper tourne avec le m...

Страница 51: ...ant toute remise en marche SERVICE Desserrer les vis 8 et enlever le couvercle du carter d em brayage 9 Enlever l ancienne courroie 10 ou les restes de courroie NOTE Le dessin montre la courroie trapézoïdale des mo dèles EK7300 7301 Nettoyer l intérieur du bras de transmission au moyen d un pinceau Mettre en place une nouvelle courroie NOTE Montageducouvercleducarter moteur 9 del entretoise latéra...

Страница 52: ...oyer remplacer le filtre à air Tourner le verrouillage du couvercle 11 dans le sens inverse desaiguillesetretireravecprécautionlecouvercledufiltre 12 Un joint 15 se trouve entre le couvercle du filtre 12 et le capot 14 Dévisser les vis 13 et retirer le capot 14 Nettoyer le joint 15 avec un pinceau et vérifier s il n est pas endommagé Nettoyer le pré filtre mousse 17 du couvercle du filtre Retirer ...

Страница 53: ...yé plusieurs fois par jour en cas de fort dégagement de poussières Si un nettoyage n est pas possible sur place préparer le pré filtre de réserve Rem placer le pré filtre au plus tard au bout de 25 heures de service En l insérant dans le couvercle du filtre 4 aligner le pré filtre sur le logement du couvercle et l enfoncer dans le couvercle du filtre 5 Le pré filtre doit à fleur à tous les endroit...

Страница 54: ...ir carburant Tirer la crépine d aspiration à travers la bouche du réservoir au moyen d un crochet en fil métallique Attention Eviter tout contact du carburant avec la peau 0 5 mm 7 8 ATTENTION N utilisezcommerechangequelesbougieBOSCHWSR 6F CHAMPION RCJ 6Y oder NGK BPMR 7A Remplacement de bougie ATTENTION Les bougies d allumage ou la fiche de la bougie ne doivent pas être touchés le moteur en march...

Страница 55: ...nroulement 21 ATTENTION Le nœud ou l extrémité du cordon de lancement ne doit pas dépasser la surface du tambour d enroulement Insérer le noeud 22 dans la poignée de lancement 23 Introduire le cordon dans l évidement 24 sur le tambour d enroulement et tourner deux fois le tambour d enroulement avec le cordon dans le sens de la flèche Tenir le tambour d enroulement de la main gauche démêler le cord...

Страница 56: ...ts de rappel de remplacement sont fournis tendus dans le carter ATTENTION le ressort de rappel peut sauter Une fois enlevé le ressort de rappel peut être réinséré comme suit respecter le sens de rotation Graisser légèrement le nouveau ressort de rappel 4 avant de le monter dans le carter du démarreur avec de la graisse multi usage réf 944 360 000 puis remettre le ressort de rappel 4 en place et le...

Страница 57: ...rous 5 Desserrerlavisdetension 3 danslesensinversedesaiguilles jusqu à ce que l extrémité de la vis 4 soit visible dans la fente Dévisser et enlever la vis détail X uniquement sur le modèle EK8100 Dévisser les écrous 5 et enlever le couvercle 6 Retirer le boulon de butée 8 en le levant avec la clé univer selle 9 comme montré sur la figure jusqu à ce que le capot de protection 11 puisse être tourné...

Страница 58: ...la poignée 18 comme décrit sur la Figure ATTENTION Après chaque modification de montage du dispositif de coupe le sens de rotation du disque de découpe change Observer le sens de rotation du disque à découper si indiqué sur le disque à découper 25 26 Changement nettoyage du pare étincelles ATTENTION N utilisez pas d objets coupants ou pointus pour nettoyer le pare étincelles car vous pourriez endo...

Страница 59: ... facile à effectuer La conduite d eau au réseau réservoir 6 La conduite d eau sous pression est conçue pour être montée sur la découpeuse Celle ci peut être utilisée en relation avec le chariot de guidage La conduite d eau sous pression convient particulièrement lorsque vous travaillez avec la découpeuse de manière stationnaire Au moyen d un accouplement de rupture rapide l eau peut être alimentée...

Страница 60: ...ne sont pas d origine de MAKITA vous perdez tout droit à la garantie de l organisation MAKITA Au cas où des pièces non d origine provoqueraient de détériorations nous n assurerons pas les frais qui en découleraient Page Généralités Découpeuse dans Nettoyer l extérieur et vérifier si elle n est pas détériorée l ensemble En cas de détériorations faire effectuer immédiatement les réparations par un s...

Страница 61: ...ctuer par le vendeur spécialiste MAKITA Recherche de pannes Panne Système Observation Origine La découpeuse ne démarre pas Embrayage Moteur tourne Panne au niveau de l embrayage Disque à découper tourne Carburateur Disque à découper tourne Réglage du ralenti incorrect au ralenti Accouplement embrayage bloqué Courroie Tension de courroie trop faible courroie usée trapézoïdale Moteur ne démarre pas ...

Страница 62: ...èces de rechange N utilisez que des pièces de rechange d origine MAKITA Pour les réparations et la rechange pour d autres pièces votre atelier spécialisé MAKITA est compétent EK7300 EK7301 EK8100 32 31 29 30 22 28 19 24 25 26 27 4a ...

Страница 63: ...ration 6 1 Bouchon de réservoir complet essence 8 1 Filtre intérieur 9 1 Cartouche de filtre à air cartouche en papier 10 1 Pré filtre mousse 11 1 Bougie 12 1 Cordon de lancement ø 4 0x1000 mm 13 1 Poingnée de lancement 14 1 Ressort de rappel dans carter 15 2 Ecrou hexag M8 16 1 Clé combinée Ouverture 13 19 17 1 Tournevis coudé T27 18 1 Tournevis carburateur 19 1 Pare étincelles Accessoires non co...

Страница 64: ...iques connus par l Etat de Californie pour provoquer le cancer des défauts de naissance ou autres dommages de reproduction ATTENTION Certaines poussières produites pendant le décapage au sable le sciage l affûtage le perçage et pendant d autres travaux de coupe de matériaux contiennent des substances chimiques qui peuvent causer le cancer des difformités de naissance ou d autres conséquences ultér...

Отзывы: