Rev. 1 02-2021
29
MTEC.IR.WU.GB-1 Use and Maintenance Manual IR.WU series English
Emibyte IR.WU
Water chilled Close Control Units
As soon the customer will receive the unit is reccomanded to preform a visual inspection on the electric circuit to avoid a transport damage;
Particularly check every terminal screw, their tightening and the integrity of every cable isolation.
The conductors for the phases of the power supply wire must be connected to the free terminal in the input to the general switch of the unit,
WKHHDUWKFRQGXFWRUPXVWEH¿[HGWRWKHFRUUHVSRQGLQJWHUPLQDORUEDULGHQWLI\ZLWK3(
For UW L series the ventilation module supply wires must be connected to derivation box provided.
A user terminal board is available with free contacts designed for:
*HQHUDODODUP
8QLWUHPRWH212))
Inside of the electrical board are available a terminal where are positioned the digital and analogic signals for the unit operation; the terminal
FRQ¿JXUDWLRQFRXOGFKDQJHXQLWE\XQLWVRUHIHUWRWKHRQHUHSUHVHQWHGLQWKHZLULQJGLDJUDPDWWDFKHGWRWKHSUHVHQW0DQXDO
7KHXQLWGHYLFHVURWDWLRQSXPSIDQVFRPSUHVVRUVHWFDUHYHUL¿HGDQGKDUPRQL]HGGXULQJWKHIDFWRU\WHVWVSHUIRUPHGGLUHFWO\E\WKH
0DQXIDFWXUHUH[FHSWIRUWKHXQLWZLWKDVSHFLDOSRZHUVXSSO\RUWKHXQLWVFDQQRWEHVWDUWHG2QFHFRQQHFWLRQLVPDGHLWLVQHFHVVDU\WR
check if the phases are well connected, on this purpose make sure all electric devices rotation is right.
For three phases units if one component rotation is wrong is must be assumed that every component rotation is wrong, so two of three
phases must be inverted on the main switch terminal.
3.21.1 User terminal board connection
3.21.1 Phases sequence check
To avoid connection errors other conductors belonging to the main switch must not be disconnected, in addition
to the two involved in the operation.
If the main wire comes from the top of the uniti s advisable to make a bend break before plugging in into the
connection.
3.20 Power supply connection
7KHXQLWPXVWEHSRZHUHGZLWKDSROHVFDEOHSKDVHV17LIWKHSRZHUVXSSO\LV9SK+]RQUHTXHVWLVSRVVLEOHWRSURYLGH
WKHXQLWZLWKDVSHFLDOSRZHUVXSSO\UHIHUWR,GHQWL¿FDWLRQ7DJDQGZLULQJGLDJUDP
Connect three phases and the neutral wire to prepared terminals of the main switch and the earth one to its corresponding terminal; Use a
power supply cable of adequate section and as short as possible in order to avoid voltage drops.
3URWHFWWKHPDLQFDEOHZLWKDQDXWRPDWLFVZLWFKRIDSSURSULDWHVL]HDQGIHDWXUHVERWKVSHFL¿HGLQWKHZLULQJGLDJUDPDWWDFKHGWRWKH
present Manual.
The entrance of the power supply wire is indicated in the technical wiring of the unit attached to the present Manual, the entrance must be
adequately protected in accordance with local norms in force.