background image

Caution

Do  not  tow  with  a  sling-type 
equipment.

Only use wheel-lift or vehicle carrier 
equipment.

Emergency Towing

If towing service is not available in an 
emergency, the vehicle may be towed 
temporarily by securing a cable to the 
front hook under the vehicle. When the 
front hook is used in towing, you can 
only use a tow rope, not a rigid towing 
bar.

HEX0151

Caution

If your vehicle must be towed from 
the rear, use a towing dolly under the 
front wheels.

Do not have your vehicle towed from 
the  rear  with  the  front  wheels 
touching the ground.

Otherwise, the transmission could be 
badly damaged.

HEX0150

5. Tow  your  vehicle  with  the  front 

wheels off the ground.

Vehicle Maintenance 133

Содержание Sail U-VA

Страница 1: ...Operation Safety and Maintenance Owner s Manual Owner s Manual ...

Страница 2: ...No Battery Make Address Tyre Make Tyre Location Fr RH Fr LH Rr RH Rr LH Spare Batch Code Delivery Date Battery Batch Code Sl No Registration No Regn Date Color Code No Key No City Selling Dealer s Name Address Pin Code Pin Code Selling Dealer s Stamp Owner s Name ...

Страница 3: ......

Страница 4: ......

Страница 5: ......

Страница 6: ...always refers to the direction of travel such as left right frontandback The vehicle display screens may notsupport yourspecificlanguage Certain functions and configura tions described in this Manual do not apply to all models but are dependentonthespecificmodel The Manual contains the latest information available at the time of printing General Motors India Pvt Ltd is responsible for revision and...

Страница 7: ...gnify an item of equipment that is not included on all vehicles Such items include engine options model variations specific to onecountry andoptionalequipment All information illustrations and specifications in this Manual are based on the latest product information availableatthetimeofpublication General Motors India Pvt Ltd reserves the right to change specifications or designs at any time witho...

Страница 8: ...4 Foreword ...

Страница 9: ...e the same key to unlock the rear compartment Turn key clockwise to unlocktherearcompartment Seat Position Lift the adjustment lever slide the seat back and forth as required Release the lever Initial Driving Information 5 Seat Adjustment 5 Adjust Front Head Restraints 6 Safety Belts 6 Rear View Mirror Adjustment 7 Instrument Panel Overview 8 Exterior Lighting 9 Horn 11 Windshield Washer Wiper Sys...

Страница 10: ...e release buttonandtakeouttheheadrestraint To lower a head restraint push the release button and push the head restraint down to the desired position andthenreleasethebuttonandsecure Pull out the safety belt strap and insert it into the buckle The belt strap must not be twisted and must be worn fitted closely against the body The seatback shouldnotbeexcessivelyreclined To release the safety belt p...

Страница 11: ...r rear view mirror with day and night adjustment modetopreventdazzling Interior Rear View Mirror Select the corresponding exterior rear viewmirrorandadjustitsposition See Exterior Rear View Mirrors on page23 HEX0006 REAR VIEW MIRROR ADJUSTMENT Exterior Rear View Mirrors Day Night 7 Introduction ...

Страница 12: ...INSTRUMENT PANEL OVERVIEW HEX0008 4 3 6 8 9 10 11 12 14 2 5 7 13 1 15 19 17 16 18 17 5 20 8 Introduction ...

Страница 13: ...indshieldwiperswitch 19 Steeringwheeladjustmentlever 20 Power rear view mirror adjustment switch EXTERIOR LIGHTING Twist thecombinationswitch leverto OFF Turn alllightsoff Parkinglights Headlights Front Fog Lights Your vehicle may be equipped with frontfoglights While the headlights are on parking light or low beam position turn the ring in the middle of the combination switch control lever to ON ...

Страница 14: ...l lever back from high beam position Leverup Leftindicator Leverdown Rightindicator Press the switch to turn on or turn off thehazardwarningflashers HEX00013 Headlight Flash High Beam and Low Beam HEX00011 Turn and Lane Change Signal Hazard Warning Flashers ODO ODO HEX00014 10 Introduction ...

Страница 15: ... high speed Pull the control lever towards you as shown in the picture to wash the windshield HEX0017 1 HORN HEX00015 Windshield Wipers Windshield Washer System WINDSHIELD WASHER WIPER SYSTEM OFF INT LO HI Press the switch on the steering wheelpadtosound thehorn HEX0016 1 OFF INT LO HI OFF INT LO HI 11 Introduction ...

Страница 16: ...s and rear view mirrorsareinthecorrectposition Check the brake function at low speed especially when the brake is wet CLIMATE CONTROL HEX0018 Press the button to operate the rear window defrostfunction Indicator light on the button will illuminate Press the button again to turn off therearwindow defrostfunction To change gears fully depress the clutch pedal move the gearshift lever into gear accor...

Страница 17: ...slope turn the frontwheelsawayfromthecurb When parking the vehicle on a downhill slope engage reverse gear before turning OFF the ignition switch Turn the front wheels towardsthecurb Starting Engine with the Ignition Switch Turn key to position 1 while turning the steering wheel slightly from left to right to release the steeringwheellock Manual transmission operate clutch Do notpress acceleratorp...

Страница 18: ...14 Introduction ...

Страница 19: ...Button 26 Manual Windows 26 Sun Visors 27 Eachnewvehiclecomeswithtwokeys Please keep one key as the backup key The key number is imprinted on the key number label For security purpose please keep your key number label in a safe place rather than inside your vehicle In addition the key number should be recorded in a safe place outsidethevehicle Unauthorized key copies can be preventedbytheseprecaut...

Страница 20: ...tion Lock Button Press to lock doors The hazard warning lamps will flashonceandthehornwillsound Unlock Button Press to unlock doors The hazard warning lamps willflashtwice REMOTE KEYLESS ENTRY HEX0163 Unlock Button LED Lock Button Note The transmitter operating range depends on the environmental conditions Note Lock and Unlock buttons are disabled whilethekeyisintheignitionswitch Only one key is p...

Страница 21: ...ement If the LED fails to illuminate or the range is noticeably diminished it is an indicationthatanewbatteryisneeded 1 Remove the screw from the back of thetransmittercover 2 Openthetransmittercover HEX0164 Note Replace with CR1616 battery or equivalent 3 Pull the transmitter out of the cover and remove the label carefully then keepitinthecleanplace 4 Remove the old battery Prevent the circuit bo...

Страница 22: ...S Caution Do not leave children or pets alone in thevehicle Serious injuries could occur The children could operate the power windows or other controls and could evenmakethevehiclemove Do not leave children in the vehicle with the ignition key This can lead to seriousinjuryoraccidents Caution When leaving an unattended vehicle you must lock all the doors and take awayyourkey Your vehicle could be ...

Страница 23: ...s equippedwithachildsafetylock The child safety lock is intended to prevent the rear doors from being accidentally opened by passengers especially children pulling the door handlesfrominside HEX0024 Caution When the child safety lock is set at LOCK position do not pull the door handlefrominsidethevehicle The handle could be damaged otherwise To open the door from outside or inside pullthedoorhandl...

Страница 24: ...or You can activate the central locking system from the driver s door This system will allow you to lock or unlock all the doors at once by using your key from outside or the driver s door lock knob frominside Automatic Locking If this feature is equipped all the doors will be automatically locked once the vehicle starts moving The tailgate or the fuel filler cap cannot be locked automatically as ...

Страница 25: ...ions DOORS HEX0026 UNLOCK Tailgate Release Lever You can open the tailgate by pulling the tailgate release lever which is mounted on the floor to the right of the driver seat HEX0027 1 Warning Exhaust gases can enter the vehicle if it is driven with the tailgate or trunk hatch open or with any objects that pass through the seal between the body and the trunk hatch or tailgate Engine exhaust contai...

Страница 26: ... handle located inthelowerrightofinstrumentpanel HEX0029 HEX0031 To close the hood 1 While holding the hood to prevent it from falling remove the hood support rod from the recess and press itfirmlyintothefixingclip 2 Be sure that no one s hands and any part of the body are close to the engine compartment and the hood edgeonthevehiclebody 3 Lower the hood allowing it to drop fromaheightofabout30cm ...

Страница 27: ...will obstructthedriver svision Driving with an open hood could lead to collisions that will damage your vehicle and other property and causecasualties EXTERIOR REAR VIEW MIRRORS Warning Only perform engine compartment checkswhen theignitionis OFF The cooling fan may start operating eveniftheignitionisOFF Folding Mirrors Manually fold the outside mirrors in to prevent damage when going through an a...

Страница 28: ...window switches to operate the front power windows in below sequence fromlefttoright Leftfrontwindow switch Rightfrontwindow switch Power Windows INTERIOR REAR VIEW MIRROR The interior rear view mirror can be manuallyadjustedinfourdirections Interior rear view mirror can be adjusted to day night mode to reduce glaring from the following vehicles Use the adjustment lever to adjust day andnightmode ...

Страница 29: ... can be struck by passing objects Keep all partsofbodyinsidevehicle Children can operate and become entrappedinpowerwindows Do not leave your keys or unattended childreninyourcar Serious injury or death can occur frommisuseofpowerwindows Pull the switch to raise the window Press the switch to lower the window Release the switch when the window reachesadesiredposition Caution Leaning out of the veh...

Страница 30: ... on the door panel Be sure there is no object in the opening beforeclosingthewindows HEX0160 Caution Leaning out of the vehicle can lead to injuriescausedbypassing objects Do not lean any part of your body out ofthevehicle Caution The unattended vehicle could be stolenwiththewindows open Close all the windows before leaving thevehicle Note The rear windows cannot be fully opened Warning Leaving ch...

Страница 31: ...adway trafficorotherobjects SUN VISORS HEX0034 Your vehicle is equipped with sun visors to protect the driver and passengers fromdazzling The sun visors can be folded down or swivelled to the side to prevent dazzling The passenger side sun visor has vanity mirror 27 Keys Doors and Windows ...

Страница 32: ...28 Keys Doors and Windows ...

Страница 33: ...aints 36 Securing a Child Restraint 37 Airbag System 38 Correct Seating Position 39 Front Airbag System 42 HEAD RESTRAINTS Head Restraint Position Warning Only drive with the head restraint set totheproperposition Removed or improperly adjusted head restraints can result in serious head and neck injuries in case of a collision Make sure that the head restraint are properlyadjusted beforedriving 30...

Страница 34: ... the pedals Seats for passengers should be slid back as faras possible Lean your shoulders against the seatbackasmuchas possible It is advised to sit right back on the the steering wheel is within easy reachwitharmsslightlybent When turning the steering wheel keep your shoulders against the seatback The seatback should not be angled too far back The maximum recommended rake is around25degrees Set ...

Страница 35: ...ver After the adjustment lean back against the backrest to make sure that the seatback has been locked in an appropriateposition Do not lean against the seatback when makingadjustments Warning If either seatback is not locked it could move forward in a sudden stop or crash That could cause injury to the person sitting there Always push and pull on the seatbacks to be sure theyarelocked Warning You...

Страница 36: ...le is moving When braking suddenly or in an accident unsecured passengers or cargo on the folded seatbacks could be impacted inside the vehicle or ejectedfromthevehicle resultingin serious injuries HEX0037 To fold the left and right rear seatbacks formuchmorerearcompartmentspace 1 Pull the release knob on the top of therearseabacks 2 Fold the rear seatbacks forward It may need to move the front se...

Страница 37: ...t you must wear it correctly and position yourselfcorrectlywithinyourseat Warning Wearing a safety belt improperly couldcauseserious injury Make sure the seatback is in the uprightposition Wear your safety belt closely against the body Do not wear your shoulder belt under your arm around your neck over an inside shoulder or behindyourback Warning If a hard or breakable object is between a safety b...

Страница 38: ...spected and any necessary replacements madeas soon as possible Three Point Seat Belt Pull the seat belt out of the retractor guide it across the body without any twists andthenbucklethebelt During driving the lap belt can be tightened by pulling the shoulder sectionwithforce HEX0039 Warning You could be seriously injured if your belt is buckled in the wrong place Always buckle your belt into thebu...

Страница 39: ...ant women as for anyone the key to make safety belts effective is wearing themproperly Center rear seat lap belt Pull the buckle along the safety belt to adjust the length of the safety belt To use insert the front buckle into the locking ring which is placed to the right of your body and is marked CENTER Take the center buckle and bring the safety belt across your body The safety belt should not ...

Страница 40: ...equately attached to the vehicle with the child safety restraint anchors A child safety restraint that is not the correct size for the vehicle or the child or a child safety restraint that is improp erly attached to your vehicle can lead to serious personal injury to the child and other passengers in the vehicle in theeventofacollision Caution Achild restraint can become very hot if it is left in ...

Страница 41: ...the top strap The top strap anchor brackets are located at the joint between the left and right rear seatbacks on the rear compartment floor Floor mat have a notch above itself you can open thefloormatfromthenotchtouse 37 Seats and Restraints 6 Push and pull the child restraint in different directions to make sure it issecure 7 Make sure the child restraint is not toohotbeforeplacingachildthere If...

Страница 42: ... up against or very close to any airbag when it inflates can be seriously injured or killed Do not sit unnecessarily close to any airbag as you would be if siting on the edge of the seat or leaning forward Safety belts help keep you in position before and during a crash Always wear a safety belt even with airbags The driver should sit as far back as possible while still maintaining control of the ...

Страница 43: ...or adults and teenagersisas shown HEX0045 Right posture passengers including the driver should always fasten safety belts so that the risk of injury during collisionscanbeminimized Airbags normally do not inflate on a rear or side impact In these kinds Always fasten safety belts All of collisions passengers who do not wear safety belts will not be protected by protective devices thus resultinginca...

Страница 44: ...the airbag is inflated resultinginserious injury Children and pets must not sit on passenger s laps Anything that may hurt the passenger when the airbag is being inflated should not be placedonhisorherlap Do not install any non geniune accessories on the steering wheel or instrument panel since they may hinder the airbag from being inflated interfere with operation of the system or hit the passeng...

Страница 45: ...ated Contact your CHEVROLET retailer when your carneedsscrapping Caution If your car is severely damaged and the airbag is not inflated or your car is not severely damaged but the airbag is activated this does not necessarily mean there is a fault with theairbagsystem Collision sensors detect the rate of change of speed in an axial direction ratherthantheextentofdamage Hitting a lamp post or a tre...

Страница 46: ...d to inflate in moderate to severe frontal or near frontal crashes to help reduce the potential for severe injuries mainly to the driver s or outboard front passen ger s head and chest However they are only designed to inflate if the impact exceeds a predetermined deployment threshold Deployment thresholds are used to predict how severe a crash is likely to be in time for the airbags to inflateand...

Страница 47: ...ows down What MakesanAirbagInflate In a deployment event the sensing system sends an electrical signal triggering a release of gas from the inflator Gas from the inflator fills the airbag causing the bag to break out of the cover and deploy The inflator the airbag and related hardware are all part of the airbag module Frontal airbag modules are located inside the steering wheelandinstrumentpanel 4...

Страница 48: ...rbag inflation does not prevent the driver from seeing out of the windshield or being able to steer the vehicle nor does it prevent peoplefromleavingthevehicle Caution If an airbag covering is damaged opened or broken the airbag may not work properly Do not open or break the airbag coverings If there are any opened or broken airbag covers have the airbag covering and or airbag module replaced For ...

Страница 49: ...n 47 Glove Box Glove box can be opened by pulling the handle Closethegloveboxwithafirmpush 45 Storage Instrument panel storage compartment is located on right side of the instrument panel Pull the handle to open the storage compartment To close the compartment firmly push thedoor HEX0046 1 0 1 2 3 HEX0047 1 Warning Keep the door of glove box closed while driving to reduce the risk of injury in the...

Страница 50: ...ss of controlofthevehicle To reduce the risk of personal injury in the event of sudden stop or collision do not place uncovered or unsecured bottles glasses cans etc in the cup holder while the vehicle is inmotion String Pockets There is a string pocket at either side underneaththerearseat The front cup holders are located in the storage recesses on the inner panels of thefrontdoors The rear cup h...

Страница 51: ... should be fixed to avoidsliding Luggage should not protrude above theupperedgeoftheseatback Do not place any objects on the instrument panel The sensor on the instrument panel must not be covered Luggage must not impede the operation of the pedals parking brake or gear shift The driver s movements must not be restricted Do not put any loose objects in the vehicle Do notdrivewiththetailgateopen Dr...

Страница 52: ...48 Storage ...

Страница 53: ...uster 57 Warning Light for Low Fuel Level 58 ABS Warning Light 58 49 Instruments and Controls Warning Light for Airbag 59 Warning Light for Brake System 60 Warning Light for Battery Charging System 61 Warning Light for Engine Oil Pressure 62 Malfunction Indicator Light 62 Door Ajar Light 63 Engine Coolant Temperature Warning Light 64 FrontFogLightIndicator 64 Driver Seat Belt Warning Light 64 Turn...

Страница 54: ...ation LO Wiping continuously at low speed HI Wiping continuously at high speed Steering Wheel Adjustment For vehicleswithatiltwheel 1 Hold the steering wheel and pull the leverdown 2 Move the steering wheel up or down 3 Pull the lever up to lock the steering wheelinplace Do not adjust steering wheel unless vehicleisstationary Caution If strong impact delivers to steering column axle direction when...

Страница 55: ...Less than clear vision for the driver can lead to an accident resulting in personal injury and damage to your vehicleorotherproperty Do not operate the windshield wipers when the windshield is dry or obstructed as with snow or ice Using the wipers on an obstructed wind shield can damage the wiper blades wipermotor andglass Check that wiper blades are not frozen to windshield before operating in co...

Страница 56: ...te window is dry or frozenwithiceandsnow When the wiper is used with obstacles on the window glass the wiper blades wiper motor and window maybedamaged In freezing weather conditions first check whether the blade is frozen onto the window before using the wiper The wiper motor may be damaged when the wiper is used with itsbladefrozen Caution Tailgate Window Wiper Washer System To use the tailgate ...

Страница 57: ...ay When the cigarette lighter is ready to use itwillautomaticallypop out Depending on vehicle model an accessory power outlet may be equippedhereonsomevehicles Only when the ignition switch is in ACC ACCESSORY or ON position theaccessorypoweroutletcanbeused Cigarette Lighter Accessory Power Outlet HEX0052 1 1 3 5 2 4 R The 12V accessory power outlet can be used to plug in electrical equipment such...

Страница 58: ...eed limit zone please keep to the speedlimit HEX0027 1 km h 54 Instruments and Controls Caution Overheating the cigarette lighter can damage the heating element and the lighteritself Do not hold the lighter in while it is heating This can cause the lighter to overheat Trying to operate malfunctioning cigarette lighter can be dangerous If the heated cigarette lighter does not pop out pull it out an...

Страница 59: ...he last reset To reset the trip odometer press and hold the mode selection button under the speedometer until it is reset to zero Press the mode selection button briefly to switch between odometer and trip odometer HEX0055 ODO ODO Caution It is prohibited by law to operate the odometerillegally Tachometer The digital tachometer displays the engine speed in revolutions per minute rpm Drive in a low...

Страница 60: ...ning in the tank the top up quantity may be less thanthespecifiedtankcapacity Movement of the fuel within the fuel tank causes the fuel gauge display to change when you brake accelerate or turn X1000r min F E 56 Instruments and Controls Before refueling switch off engine and any external heaters with combustion chambers Switch off anymobilephone Vaporised fuel can be ignited by electromagnetic wav...

Страница 61: ...ODO HEX0058 km h X1000r min F E Instrument Cluster 57 Instruments and Controls ...

Страница 62: ...uld go off If it does not have thevehicleserviced Caution Do not let your vehicle run out of fuel This can damage the catalytic converter When this warning light illuminates please fill the fuel tank as soon as possible SeeFuelon page92 ABS Warning Light HEX0060 If the vehicle is equipped with ABS when the ignition switch is turned ON the ABS warning light will illuminate for a moment This shows t...

Страница 63: ...is turned ON the airbag warning light will illuminate briefly This shows that the light bulb and airbag systems are functioning properly HEX0061 Caution If the airbag warning light flashes or stays on when driving it indicates a fault in the airbag system The airbag system will be disabled and cannot be triggered when an accident occurs Consult your CHEVROLET retailerfornecessaryrepair If an accid...

Страница 64: ...to collisions resulting in personal injury and damage to your vehicle or other property If the parking brake is fully released and the brake system warning light still illuminates it indicates that the brake fluid level in its fluid reservoir is too low To rectify this please perform the followingsteps 1 Carefully drive the vehicle away fromthecarriagewayandstop 2 Checkthebrakefluidlevel 3 Add the...

Страница 65: ...and the ignition switch is turned ON even if the warning light is working correctly consult your CHEVROLET retailer to have the vehicle s brake system checked These situations indicate that your vehicle s brake system may have a fault If the vehicle s brakes are not kept in good working condition this may lead to collisions resulting in personal injury and damage to your vehicleorotherproperty HEX...

Страница 66: ...ow can also damage the engine The repairs would not be covered by the vehicle warranty Check the oil level as soon as possible Add oil if required but if the oil level is within the operating range and the oil pressure is still low have the vehicle serviced Always follow the maintenance schedule for changingengineoil If the oil level is too low add specified engineoiltoasuitablelevel If the level ...

Страница 67: ...cle will switch to an emergency operation program so that you can continue to drivethevehicle However at this time you should drive to your CHEVROLET retailer as soon as possible If the MIL illuminates for a while then extinguishes itself it is normal It does notmeanthatthesystemhas afault This light comes on when a door is open or not securely latched Before driving checkthatalldoors areproperlyc...

Страница 68: ... stays on while driving the vehicle may have a problem with cooling system Stop the vehicle and turn off the engine to avoid damage totheengine HEX0067 HEX0068 Front Fog Light Indicator When the front fog lights are on the indicatorlightilluminates SeeFrontFog Lightsonpage69 Driver Seat Belt Warning Light HEX0070 When the ignition switch is ON the safety belt warning light will illuminate briefly ...

Страница 69: ...eed exceeds 20 km h this light will stay on and at the same time the warning buzzer will continue to sound for a period oftime Caution These indicators are essential for safedriving If the bulb in the turn signal light or hazard warning flasher is blown it mustbereplacedimmediately If these indicators are not kept in good working condition this may lead to accidents resulting in personal injury an...

Страница 70: ... an alarm tone to promptthedriver After the vehicle s engine has been shut off if the key is not removed from the ignition switch before openinganydoor After the vehicle s engine has been shut off if the headlamps are not switched off before opening any door The vehicle speed exceeds 120 km h Depending on the model some vehicles may not have some or all of the abovealarmtonepromptfunctions 66 Inst...

Страница 71: ...headlamps and all the abovelightsilluminate Exterior Lighting 67 Headlight Switch 67 High Beam 68 Headlamp Flash 68 Misted Lamp Covers 68 Hazard Warning Flashers 69 Turn and Lane Change Signal 69 Front Fog Lights 69 Reverse Lights 69 Headlamp Range Adjustment 70 Interior Lights 70 Reading Light 70 Rear Compartment Light 70 When the ignition switch is turned to LOCK or ACC ACCESSORY position the he...

Страница 72: ...ou approach on coming vehicles or whenothervehiclesareahead High beam headlamps can tempor arily blind other drivers which could resultinacollision HEX0012 1 To make the headlamps high beam flash pull the combination switch lever towards you and release When you release it the lever will return to the normalposition If you pull the combination switch lever towards you and hold the headlamp highbea...

Страница 73: ... to the normal position 69 Lighting Front Fog Lights While the headlights are on parking light or low beam position turn the ring in the middle of the combination switch lever to ON to turn on the front fog lights Turn the ring to OFF position to turnoffthefrontfoglights HEX0010 1 ODO ODO HEX0013 1 Hazard Warning Flashers Press the switch to turn on or turn off thehazardwarningflashers HEX0014 Rev...

Страница 74: ...goes off when tailgateis closed INTERIOR LIGHTS HEX0073 ON OFF ON OFF 0 1 2 3 HEX0169 Headlamp Range Adjustment The headlamp range adjustment knob is locatedattherightofinstrumentpanel To adapt headlamp range to the vehicle load to prevent dazzling turn knob to requiredposition 0 Frontseatsoccupied 1 Allseatsoccupied 2 All seats occupied and load compartmentladen 3 Driver s seat occupied and load ...

Страница 75: ...ribution Mode Selector 74 Recirculation Mode Button 76 Air Conditioning System 77 Air Conditioning Button 78 Cool Air 78 Warm Air 79 Ventilation 79 Rear Window Defroster Button 80 Defrosting and Demisting 81 Maintenance 82 Air Intake 82 A C Mesh Filter 82 Air Conditioning Regular Operation 82 71 Climate Control System ...

Страница 76: ...72 Climate Control System AIR VENTS 1 1 2 4 4 5 5 3 1 Sideairvent 2 Windshielddefrostervent 3 Centerairvents 4 Floorvent 5 Frontsidewindow defrostervents 6 A C Controlpanel 6 ...

Страница 77: ...o the side windows especially to the area near the exterior rear view mirrors 73 Climate Control System 1 Temperaturecontrolselector 2 Fancontrolselector 3 Airdistributionmodeselector CONTROL PANEL AC 4 5 3 1 6 2 HEX0097 4 Air conditioning A C button 5 Recirculationbutton 6 Rearwindow defrosterbutton Sideairvent You can direct airflow to the front passenger area or to the side windows throughthetw...

Страница 78: ...e amount of airflow by turning the fan speed control knob Turn the knob clockwise to increase fan speed or counterclockwise to decrease fanspeed You can set the fan speed control knob between1to4 as desired Air Distribution Mode Selector Turn the knob to the desired mode according to the desired airflow direction The air distribution selector can be set tooneof thefivepositionsasfollows Temperatur...

Страница 79: ...ing through the center and side vents Most of the air flows through the floor vents with a small amount of air through the windshield and front window defroster vents as well as side vents Front mode This mode directs airflow through the centerventsandsidevents Dual mode Floormode HEX0101 1 HEX0102 1 HEX0103 1 ...

Страница 80: ...culationwillstart Press the button again to switch to fresh air mode The indicator light on the buttonwillturnoff Floor defrosting mode This mode directs airflow through the windshield defroster vent front window vents floor vents and side vents Defrosting mode Recirculation Mode Button AC Note In this mode air conditioning system wouldautomaticallyswitchonthecom pressor and switch off the recircu...

Страница 81: ...s is normal because your cooling system removes moisture from the air Note Because the compressor of the air conditioning system shares the engine power you may notice a slight drop in engine power and performance when the compressor is operating Warning Driving with recirculation mode for prolonged period of time can make you sleepy Periodically turn to the outsideairmodeforfreshair The exchange ...

Страница 82: ...ir conditioning A C button again The indicator light on the button turns off to indicate that the air conditioningstops working The air conditioning system will turn on automatically when the vehicle is started if it was working when the enginewas shutdown lasttime Cool air Maximizecooling For quick cooling in hot weather or after the vehicle has been exposed to direct sunlight for an extended per...

Страница 83: ...selector to the maximum position in theredareatoobtainwarmair 5 Turn the fan control selector to the maximumspeed Normalheating 1 Turn off the air conditioning A C Theindicatorlightturnsoff 2 Turn off the recirculation The indicatorlightturnsoff 3 Turn the air distribution selector to floormode ordualmode 4 Turn the temperature control selector to the red area to obtain warmair 5 Turn the fan cont...

Страница 84: ...trunning Vehicleisnotstarted There is a build up of snow or ice ontherearwindow Operating the rear window defroster under these conditions could drain thebattery This can damage your vehicle requiring the replacement of some parts To turn on the defroster switch ON the ignition and then press the rear window defroster button The indicator light on thebuttonwillturnon The defroster will turn off ap...

Страница 85: ...g system will automatically control the compressor operation and air recirculation mode Indicated by the A C indicator light on and recirculationindicatorlightoff 4 In order to keep the windshield clean and direct warm air to the floor turn the air distribution selector to the floor defrosting position Then the air conditioning system will automatically control the compressor operation and air rec...

Страница 86: ...ime of year Operation with cooling is not possible when outside temperature is low Service For optimal cooling performance it is recommended to annually check the climatecontrolsystem Functionalityandpressure test Heatingfunctionality Leakagecheck Checkofdrivebelts Cleaning of condenser and evapo ratordrainage Performancecheck Caution Use onlycorrectrefrigerant Warning Climate control systems are ...

Страница 87: ...ust 95 Catalytic Converter 96 Driving and Operating 83 Punctureduring driving When driving turn on the hazard flashers if a tire is punctured Hold the steering wheel firmly lift your foot off the accelerator pedal and slow the vehicle gradually Press the brake pedal gently and drive the car into a safe area tochangethetire Faultsduring driving When a fault occurs while driving turn on the hazard f...

Страница 88: ...safe placeandtakethefollowingmeasures Run the engine at idle and then move the gear shift lever into neutral Applytheparkingbrake Turnofftheairconditioning Open the hood to ventilate the enginecompartment Warning If steam or coolant escapes from the engine do not open the hood otherwise you may be scalded by the steamorcoolant If the coolant level does not drop while the engine is idling switch of...

Страница 89: ...e vehicle contains many combustible mate rials such as various oils fibers and plastics All passengers should immediately exit the vehicle and reach to a safe area Do not change the electrical or fuel systems without authorization or a firemightbecaused Use inthesnow Slow down when turning a corner drivinguphillorcrossing abridge Do not park the car on a hard verge or it may obstruct the snow clea...

Страница 90: ...e ignition switch has the following positions LOCK ACC ON andSTART LOCK To lock the steering wheel remove the key and turn the steering wheel clockwiseuntilitislocked In order to operate the key while unlocking the steering wheel turn the steering wheel from left to right gently and then turn the key to the ACC position ACC ACCESSORY Turning the ignition key to the position ACC ACCESSORY will turn...

Страница 91: ...lid key for a vehicle equipped with immobilizer system is an ignition key with integrated transponder which is electronically coded The transponder isplacedinvisiblyintheignitionkey Only valid ignition keys can be used to starttheengine Invalidkeys mayonlyopenthedoors The engine is automatically immo bilized after the key is turned to LOCK and has been removed from the ignition switch Driving and ...

Страница 92: ...ot start please waitfor10seconds andtryagain This can prevent damages to the startermotorandbatterydischarge Parking base When using the parking brake do not press the release button Apply the parking brake firmly when the vehicle is parked on an upward or a downward slope and meanwhiledepress thefoot braketo reducetheforceapplied Turn off the engine and ignition switch Turn the steering wheel clo...

Страница 93: ...ar wheels A dual circuit brake system is used If one brake circuit is ineffective the other circuit can still be used to stop the vehicle but the braking distance will increase and depressing the brake pedal willalsorequireagreaterforce Caution If one of the brake circuit fails depressing the brake pedal will be difficult and the braking distance will also increase Contact your CHEVROLET retailer ...

Страница 94: ...n the ignition switch is turned ON If the ABS warning light stays on or lights during driving it indicatesaproblemwiththeABS Consult your CHEVROLETretailer for necessary repair See ABS Warning Lightonpage58 TheABS system will monitor the speed of each wheel during the braking process If one wheel has a tendency to lock up the system will control the front and rear wheel brakes separately The brake...

Страница 95: ...tor operating and feel the brake pedalpulsate butthisisnormal BrakinginEmergencies ABS allows the driver to steer and brake at the same time In many emergencies steering can help more thaneventheverybestbraking Driving and Operating 91 Caution ABS will not change the time needed for braking neither it will necessar ily shorten the braking distance Even if ABS is equipped an adequate braking distan...

Страница 96: ...n The use of incorrect grade of fuel or filling in the fuel tank with incorrect fuel will cause serious damage to the engineandcatalyticconverter Make sure you use the correct fuel thatiscompatiblewithyourvehicle For safety purposes the fuel tank pumps and piping must be suitably grounded Static electricity can ignite petrol vapours You may be burned and the vehicle will be damaged 92 Driving and ...

Страница 97: ...rightsideofthedriverseat If the fuel filler door does not open in cold weather tap the door lightly Then trytoopenitagain Note Fuel is a flammable and explosive material No smoking No open flames or sparks If you can smell fuel in your vehicle have the cause of this remedied immediately by a CHEVROLET retailer Danger Before adding fuel switch off the engine and any external combustion heatingdevic...

Страница 98: ...issing sound wait until it stops before unscrewing the cap The fuel filler doorisintheleftrearquarterpanel 4 Open the cap The cap is tethered to thevehicle If you can smell fuel in your vehicle have the cause of this remedied immediately by a CHEVROLET retailer Before refueling switch off engine and any external heaters with combustion chambers Switch off anymobilephone Vaporised fuel can be ignit...

Страница 99: ...market modifications that are notcompletelysealed If unusual fumes are detected or if it is suspected that exhaust is coming intothevehicle Ÿ Drive it only with the windows completelydown Ÿ Have the vehicle repaired imme diately Never park the vehicle with the engine running in an enclosed area such as a garage or a building that has no fresh airventilation Driving and Operating 95 Engine exhaust ...

Страница 100: ...event of misfiring uneven engine running a reduction in engine performance or other unusual prob lems have the cause of the fault rectified by a CHEVROLET retailer as soon as possible In an emergency driving can be continued for a short period keeping vehiclespeedandenginespeedlow 96 Driving and Operating Caution Don t touch the catalytic converter during engine operating and it can be possible to...

Страница 101: ... 113 Fuse Blocks 114 Passenger Compartment Fuse Block 115 Engine Compartment Fuse Block 116 Bulb Replacement 117 Headlights 117 Parking Lights 118 Front Turn Signal Lights 118 Front Fog Lights 119 Side Turn Signal Lights 119 Reverse Lights Tail Lights Stoplights Rear Turn Signal Lights 119 Central High Mounted Stoplight 120 License Plate Light 121 Dome Light 121 Rear Cargo Area Light 121 Bulb Spec...

Страница 102: ...orrosionprotection Adjust tire pressure to the value specifiedforfullload Park the vehicle in a dry well ventilated place For manual transmission engage first or reverse gear Prevent the vehicle fromrolling Do notapplytheparkingbrake Caution Never modify your vehicle It may affect the performance durability and safety of the vehicle and the warranty may not cover any problems caused by the modific...

Страница 103: ... See Interior Turning tooloose freeplay Parkingbrake Ensure the parking brake lever has thecorrecttravel Instrument panel Check whether all the instruments controls and warning lights on the instrumentpanelwork properly Rearviewmirrors Ensure all three rear view mirrors arecleanandingood condition Check all the rear view mirrors can beadjusted Controls Check the travel of the brake pedal andclutch...

Страница 104: ...rol Engine LC5 HEX0113 1 Airfilter 2 Engineoilfillercap 3 Brakefluidreservoir 4 Coolantreservoir 5 Fuse andrelayblock 6 Battery 7 Windshieldwasher fluidreservoir 8 Power steeringfluidreservoir 9 Engineoildipstick 100 Vehicle Maintenance 3 ...

Страница 105: ...sure the oil is not contami nated 7 Check the oil level by using the oil dipstick The level should be betweentheMIN andMAX limits 8 Add engine oil of the same grade as recommended if the level is below the lower limit Bring the level up to butnotabovetheupperlimit The engine oil filler cap is located on the cylinder head cover See the Engine Compartment Overview on page100 HEX0115 MIN MAX Caution ...

Страница 106: ...ine oil you use has the API SM GF4 rating Choosing the Right Oil Viscosity HEX0117 SAE 5W 30 is the recommended engineoilforyourvehicle When choosing an oil consider the range of temperature your vehicle will be operated in before the next oil change Then select the recommended oilviscosityfromthechart 102 Vehicle Maintenance ...

Страница 107: ...bricate when contaminated Make sure you change your engine oil according to the maintenanceschedule Make sure you replace the engine oil filter each time you change the engine oil Under severe conditions you must change the oil and filter more fre quently than is recommended in the standardmaintenanceschedule Caution Use of unauthorized or low quality engine oil or chemical engine treatments addit...

Страница 108: ...General Motors India Pvt Ltd recommended coolant available withyour CHEVROLETretailer The engine may overheat or even catchfire Do not dispose of used engine oil and filterwithyourhouseholdwaste See your local authorized waste managementfacility Used engine oil and filter contain harmful elements that may be unhealthy to you and threat to the environment Caution Warning Engine oil and its containe...

Страница 109: ...e MAX mark A low fluid level in the brake fluid reservoir can be either an indication of a leak in the brake system or a normal indication caused by usual brake pad lining wear Consult your CHEVROLET retailer to determine if the system needs repair and add fluid after work is done on your hydraulic brakesystemifitisrequired If the brake fluid level is low the brake system warning light will come o...

Страница 110: ...erimmediately Caution Brake fluid can catch fire if spilt on theengine Wipeoffthetopofthereservoir If the engine catches fire it could cause personal injuries and damage toyourvehicleandotherproperty 4 Refitthecap Caution Do not dispose of used brake fluid withyourhouseholdwaste Use your local authorized waste managementfacility Used brake fluid and their containers are hazardous They can damage y...

Страница 111: ... fluid should be added according to the instructionsinthisManual This job requires special skills and equipment In order to prevent personal injury or vehicle damage we suggest you to have this work done at your CHEVROLETretailer Note Use of the incorrect fluid may damage the vehicle Always use the fluid listed inFluidChartonpage148 Warning An overflow of the fluid may cause the fluid to burn or d...

Страница 112: ...ded to use special ready to use washer fluid If concentrated washer fluid is to be used please add water to dilute the fluid according to instructions of the manufacturer Do not use plain water The minerals or foreign substances in plain water can clog the pipes of the windshield washer If the air temperature is likely to fall below freezing use windshield washer fluid which has sufficient anti fr...

Страница 113: ...her containing siliconeresintothewindshieldglass Otherwise stripes will appear on the glass and the driver s vision will be affected Do not use solvents gasoline kerosene or paint thinners to wash the wipers These substances are corrosive and could damage the wipers and painted surfaces Caution Do not run the wiper blades on dry dusty glass always spray water from windshield nozzle before switchin...

Страница 114: ...rly the drive belt should be in good condition andshould beadjustedproperly Replace the drive belt if it is worn cracked orfrayed Caution The engine could be started unexpectedly if the key is left in the ignition Do not leave the key in the ignition whilecheckingthedrivebelt Moving engine parts can cause serious injuries while the engine is running BATTERY Your vehicle is equipped with a battery ...

Страница 115: ...ry cables to the wrong terminals can result in injury and damage to the vehicle and other property Note Always reconnect the positive terminal first always disconnect the negative terminalfirst Battery Maintenance To extend the life of your vehicle battery do thefollowing Keepthebatterymountedsecurely Keep the top of the battery clean anddry Keep the terminals and connections clean tight and coate...

Страница 116: ...ly the parking brake and count the notch clicks If the number of clicks or the force you feel you are applying differs from the above specification consult your CHEVROLET retailer to adjusttheparkingbrake 112 Vehicle Maintenance Warning Keep smoking materials away from the battery to avoid flames or sparks when the battery is checked because theexplosivegascouldbeoccurred If the battery explodes i...

Страница 117: ...etal can cause a short circuit damage the electrical system or start a fire Seriousinjurycouldoccur 4 Identify the reason for the fuse blowingandsolvetheproblem 5 Replace the fuse with a new one of the correct rating See the layout of fuseblockslaterinthissection Caution Using a fuse substitute or a fuse of the wrong type or rating can damage the electrical system or even start a fire Be sure to u...

Страница 118: ... passenger compartment fuse HEX0123 1 0 1 2 3 Passengercompartmentfuse block Enginecompartmentfuse block HEX0124 is located next to the coolant reservoir The engine compartment fuse block 114 Vehicle Maintenance Caution Spilling liquid on any electrical component on the vehicle may damage it Always keep the covers on anyelectricalcomponent ...

Страница 119: ...Passenger Compartment Fuse Block HEX0125 F14 SPARE CIGAR POWER CENTRAL DOOR LOCK F14 10A DOME LAMP RR Fog Vehicle Maintenance 115 ...

Страница 120: ...FOG EF9 15A ABS EF10 25A HEAD LP EF12 15A FRT 02 SNSR EF13 15A RR 02 SNSR EF14 30A MAIN RELAY EF15 10A ECU EF16 15A INJECTOR EF17 15A ECU2 EF20 15A TCM EF21 30A ELE PUMP EF25 10A H_LP LO LH EF26 10A H_LP HI LH EF27 10A H_LP LO RH EF28 10A H LP HI RH J Case fuse JEF1 30A PWR WINDOW JEF2 40A BLOWER MTR JEF3 40A COOLING FAN JEF4 40A ABS JEF5 30A ACC ING1 JEF6 30A ING2 START JEF7 30A BATT TO IP 116 Ve...

Страница 121: ...acement 1 Openthehood 2 Disconnect the wiring harness connectorfrombehindthebulb 3 Turn and remove the upper end of the windshield washer reservoir Only for the bulb on the left hand side 4 Removetheheadlightcap 5 Release the spring that retains the bulb 6 Removethebulb HEX0127 7 Install a replacement bulb of the samerating See Bulb Specifications on page 122 8 Reinstallthebulbretainingspring 9 Re...

Страница 122: ... panel it is recommended to have the bulb replaced at your CHEVROLETretailer Front Turn Signal Lights Bulb replacement HEX0129 1 Open thehood 2 Remove the wheel arch panel and thenremovethefrontbumper 3 Removetheheadlightassembly 4 Turn the front turn signal light bulb socketcounterclockwise 5 Pull the front turn signal light bulb socketoutofthelighthousing 6 Pull the bulb straight out of the sock...

Страница 123: ... bulb of the samerating 5 Insert the socket into the lamp and turnitclockwise 6 Refitthewheelarchpanel Reverse Lights Tail Lights Stoplights and Rear Turn Signal Lights Bulb replacement HEX0131 1 Open the tailgate remove the tailgatetrimpanelnexttothelights 2 Remove one tail light nut in the tailgate trim panel and two tail light screws next to the tailgate and removethetaillightassembly 3 Turn th...

Страница 124: ...etaining screws pull out the wiring harness plug and remove the high mounted stoplight assembly 2 Pry the lens remove two screws andthenremovethebulbsocket 3 Pull the bulb base out of the bulb socket 4 Pull the bulb straight out of the socket 5 Install a new bulb See Bulb Specificationsonpage122 Bulb replacement Central High Mounted Stoplight HEX0132 6 Reinstallthesocket 7 Reinstall the bulb socke...

Страница 125: ...t assembly from the housing 2 Replace the bulb See Bulb Specificationson page122 3 Reinstallthelightassembly ON OFF Bulb replacement License Plate Light 1 Remove the license plate light assemblydirectlywithyourhands 2 Turn the bulb socket counterclock wisetoremoveitfromthehousing 3 Pullthebulboutofthesocket 4 Replace the bulb See Bulb Specificationson page122 5 Turn the bulb socket clockwise to re...

Страница 126: ... x 2 5W x 2 21 5W x 2 21W x 2 21W x 2 5W x 2 5W x 4 10W x 1 10W x 1 Note H4 60 55W W5W WY21W H8 35W WY5W P21 5W P21W PY21W W5W W5W 12V10W 12V10W Bulb HEX0136 2 1 3 4 5 Bulb specifications in some models can be different from the above table See the wattageprintedonthebulbbeforereplacingburntbulbs Warning The same rating of the bulb to be used during replacement and any usage of higher wattage bulb...

Страница 127: ...essure should comply with the specifications in this Manual to ensure optimal ride comfort safety and performance The tire pressure label is onthedriver s doorframe Use a calibrated tire pressure gauge to check the tire pressure when the tires are cold Tighten the valve caps after checking Caution Tire pressure should be checked when thetiresarecold The readings will not be correct when the tires ...

Страница 128: ...leadtopersonalinjuries If your tires or wheels have been damaged or abnormal wear is detected consult your CHEVROLET retailer Your vehicle is equipped with radial tires General Motors suggests you to use a tire of the same size pattern tread wear temperature and speed rating for replacement Caution Using a tire of a size different from the original tires can cause interfer ence between the tire an...

Страница 129: ...res To make your tires last longer and to avoid uneven tread wear 1 Have the tires rotated according to the maintenance schedule in the Manual 2 Maintainapropertirepressure 3 Inspectthetightnessofwheelnuts Caution Always use the recommended wheels and recommended wheel nuts Otherwise you could lose control of the vehicle and cause a collision resulting in personal injury or damage to your vehicle ...

Страница 130: ...s can affect driving performance Please note the precautions on the spare tire labeling where applicable Replace the defectivetireas soon as possible Changing awheel Observe the following instructions when changingawheel Never position yourself below a vehicle when it is supported by a jack Never let the engine continue to run or start the engine while changing a wheel Only use the jack when chang...

Страница 131: ...oosen them com pletely HEX0142 8 Insert the jack into the position indicated by the arrows where thereisahalfcirclenotch G6D5002A 9 The jack should be placed at a jacking point nearest to the tire you want to change The jack lift head indicated by the arrow should be placed around the vertical lugs and insertedintothenotchofthelugs Vehicle Maintenance 127 ...

Страница 132: ...at tire in the rear compartment together with the tools and jack that are properly packaged 18 Have the tire fixed as soon as you can Reinstall it on the vehicle after balancing Toolpacking steps 1 Place the wheel wrench and jack handleintothespecifiedposition 2 Put the jack into the tool bag facing upward 3 Bundleupthetoolbagtightly 4 Store the tool bag in the spare wheel compartment Place it in ...

Страница 133: ...tinpersonalinjury You can start vehicle that has a discharged battery by transferring electrical power to it from a battery in anothervehicle JUMP STARTING THE ENGINE After the tool bag is packed place the warning triangle properly according to the picture Warning triangle is providedatthetimeofvehicledelivery HEX0147 HEX0161 Vehicle Maintenance 129 ...

Страница 134: ...tems of both vehicles could be damaged and serious injuriescouldoccur Preparationbeforejump starting 1 Apply theparkingbrakefirmly 2 Shiftthetransmissionintoneutral 3 Turn offallelectricalaccessories Caution Turn off the audio system before jump starting Otherwise it could be damaged Caution When connecting the cable make sure it is not near any engine parts thatwillmove Otherwise you could be inj...

Страница 135: ...the jumper cables where the spare wheel is stored 4 Turn off the electrical devices on the vehicle as possible e g lights blowers audio system and drive the discharged vehicle for 20 minutes This can recharge the battery 5 If discharging reoccurs consult yourCHEVROLETretailer There is a mark on the battery housing ortheterminal Caution Do not connect the negative terminal when finally connecting t...

Страница 136: ...vehicle Failure to observe the above warnings couldresultininjuries Towing yourvehiclewith awheellift HEX0149 1 Turn on the hazard warning flashers 2 Turn the ignition key to the ACC ACCESSORYposition 3 ShiftthetransmissionintoNeutral 4 Releasetheparkingbrake TOWING THE VEHICLE HEX0148 If vehicle towing is needed contact your CHEVROLET retailer or a professionaltowingservice 132 Vehicle Maintenanc...

Страница 137: ...t hook under the vehicle When the front hook is used in towing you can only use a tow rope not a rigid towing bar HEX0151 Caution If your vehicle must be towed from the rear use a towing dolly under the frontwheels Do not have your vehicle towed from the rear with the front wheels touchingtheground Otherwise the transmission could be badlydamaged HEX0150 5 Tow your vehicle with the front wheelsoff...

Страница 138: ...nto the hole by pushing it towards the driver side and then press the passenger side to firmly closeit Caution When towing the vehicle with a tow rope thevehiclecanbedamaged Toreducedamage Use the towing hook only if no other towingequipmentisavailable Onlytow thevehiclefromthefront Keep the tow rope clear of the bumper Pull on the tow rope to make sure it is securely fixed to the towing hooks at ...

Страница 139: ...tact CHEVROLET retailer toseekassistance Caution If your vehicle gets stuck in sand mud or snow you will need to rock yourvehicleout Before rocking the vehicle check that there are no physical objects or peoplearoundthevehicle The vehicle could move forward or back suddenly The people around it could be injured and objects could be damaged Towing Hook for Shipping HEX0162 The towing hook for shipp...

Страница 140: ...damage to the transmissionandotherparts Do not press the accelerator pedal while shifting or before the transmis sion is shifted into forward or reverse gear Do not let the engine run at too high speedandavoidspinningthewheels Do not use the following cleaners when cleaning the interior and exterior of the vehicle unless otherwise specified in the stain removal instructions for fabric cleaning Lau...

Страница 141: ...idethevehicle Use a clean wet cloth to clean the vinyl plasticandleathertrimsregularly Use proper cleaners to clean the dusts blemishesorstainsonthetrims Open the doors for proper ventilation when using cleaners or other chemicals forinteriorofthevehicle Caution Do not let color fading fabrics come into contact with the vehicle interior trims unless both materials are completelydry In order to pre...

Страница 142: ...er a collision The safety belts may not have to be replaced if your CHEVROLET retailer finds that the safety belts are not damaged and work properly Glass Surface Caution Abrasive cleaners can scratch the glass and damage the rear window defrostergrid Do not use abrasive cleaners on the rearwindow glass Otherwise the driver s vision will be affected Keeping the window glass clean can help to reduc...

Страница 143: ...s are designed for operation under normal andnaturalconditions Caution The antenna can be damaged by automaticvehiclewashers Turn off the sound system and retract theantenna Remove the antenna rod or roof antenna Polishingand waxing Regular polishing can remove the residual materials on the vehicle surface High quality automotive wax should be used after polishing for best protection Protecting th...

Страница 144: ...reliability Although some parts in the engine compartment and underneath the vehicle may become rusty on surface the reliability or functionality of these partswillnotbeaffected Metalsheetdamage If the vehicle body needs to be repaired or replaced make sure that the workshop uses proper anticorrosive materials to restore the corrosion resistanceproperties Sedimentofforeignsubstances The following ...

Страница 145: ...by the local laws or have them disposed of by the sellers who have supplied these materials and have a legal obligation to dispose ofthemproperly Do not mix these materials with the household waste or discharge them intothedrains These hazardous materials can permanently damage the environ mentifnotdisposed ofproperly General Information SERVICE AND MAINTENANCE ServiceInformation In order to ensur...

Страница 146: ...uel Line and Connections Air Cleaner Element 2 Spark Plugs Chart Symbols I Inspect these items and their related parts If necessary correct clean replenish adjust rotate or replace R Replace or change 1 If a vehicle is operated under severe conditions short distance driving extensive idling or driving in dusty conditions change engine oil and the filter every 7 500 kms or 6 months whichever comes ...

Страница 147: ...op and go traffic or driving in dusty conditions Kilometers or time in months whichever comes first 6 months 7500 1 Year 15000 1 5 Years 22500 2 Years 30000 2 5 Years 37500 3 Years 45000 3 5 Years 52500 4 Years 60000 4 5 Years 67500 5 Years 75000 5 5 Years 82500 6 Years 90000 6 5 Years 97500 7 Years 105000 I I I I I I I I I I I I I I I I I I I I I I I I I R I I I I I I I I I I I I I I I I I I I I ...

Страница 148: ... rotate and balance wheels A C Mesh Filter As and when required or as suggested by CHEVROLET retailer As and when required or as suggested by CHEVROLET retailer Kilometers or time in months whichever comes first 6 months 7500 1 Year 15000 1 5 Years 22500 2 Years 30000 2 5 Years 37500 3 Years 45000 3 5 Years 52500 4 Years 60000 4 5 Years 67500 5 Years 75000 5 5 Years 82500 6 Years 90000 6 5 Years 9...

Страница 149: ...al Data Vehicle Identification Number VIN This number is the legal identifier for yourvehicle The vehicle identification number is engravedon thetopofthebulkhead VEHICLE IDENTIFICATION VIN Plate Location The vehicle identification number VIN plate is attached to the top of the frontendupperpanel HEX0153 1 ...

Страница 150: ...sitive ignition 69 5 x 79 0 4 1199 9 8 1 63 2 6000 113 5000 91 12 45 146 Technical Data Brakes Service brake Auto slack adjuster ABS Front brakes Rear brakes Hydraulic vacuum assisted diagonal circuit with auto slack adjuster Rear brakes Optional Disc Drum Gear Box Drive system No of gears Gear ratios 1st 2nd 3rd 4th 5th Reverse Front axle ratio Front wheel drive 5 forward 1 reverse 3 727 2 050 1 ...

Страница 151: ... 1462 1457 130 Overall length mm Overall width mm Overall height mm Wheel base mm Front wheel track mm Rear wheel track mm Ground clearance mm Vehicle Dimensions Vehicle Weight Kerb weight kg Gross vehicle weight kg 1065 1450 14 x 5 5J alloy 14 x 5 5J steel 175 70 R14 84T Radial tubeless McPherson strut Twist axle Font suspension type Rear suspension type Wheel Tyres Wheel rim size Tyre size type ...

Страница 152: ...eering Fluid Classification SAE5W 30APISMGF4 75W 90 Ethylene Glycol based long life coolant DOT 4 Dexron VI Capacity 3 75 L 1 8 L 6 4 L 0 48 L 1 0 L 148 Technical Data TIRE AND SEATING INFORMATION TIRE FRONT REAR SIZE 175 70 R14 84T COLD TIRE PRESSURE 235 kPa 34 psi 235 kPa 34 psi OCCUPANTS TOTAL 5 FRONT 2 REAR 3 175 70 R14 84T SPARE 175 70 R14 84T 235 kPa 34 psi ...

Страница 153: ...ection and Vehicle Delivery 157 Owner s Statement of Acceptance 159 Chevrolet Service 161 Maintenance Record Sheet 167 Battery 169 Separate Corrosion Protection Service 170 Body Inspection Record 171 Emission Warranty 173 Annexure I 177 Annexure II 178 149 Service and Warranty ...

Страница 154: ...partswithaviewtocorrectinganydefectcoveredby thiswarranty 2 WHATIS COVERED Time and distance limits for New Vehicle Warranty coverage Warranty Type Warranty Limits Other Warranties A General B Rust Through Three 3 years or 1 00 000 kms whichever is earlier from the date of delivery by a CHEVROLET retailer or the date of first registration of the motor vehicle whicheveroccursfirst Three 3 years fro...

Страница 155: ...fication without prior notice Service outside the municipal limits specified abovewillbeprovidedafterchargingtheactualtoandfrotravelingandincidentalexpenses as prevailingfromtimetotime Necessary care and caution is taken in manufacturing of the vehicle however General Motors India Pvt Ltd shall not be liable for any loss or damage caused to any article property death or disability caused to any hu...

Страница 156: ...one mentioned in the Owner s Manual Exceeding specified capacities such as loadingweight passenger speed use as acommercialvehicleandrpmlimitations f Damagecausedby drivingthevehicleundersevereconditionssuch asun pliableorwater loggedroads inracesorrallies g Damage caused by natural disasters including but not restricted to earthquakes storms floods fire and accidents The owners are recommendedtok...

Страница 157: ...asimilarnature o Damage caused by running vehicle on adulterated fuel lubricants or fuel lubricants other than those specified by General Motors IndiaPvt Ltd WHATIS NOTCOVERED Adjustments cleaning inspection or requiredperiodicmaintenance Partsdesignatedas requiringperiodicreplacement WarrantyrepairnotperformedbyaCHEVROLETretailer Charges or fees for telephone tow transportation charges of the veh...

Страница 158: ... Ltd shallbefinalandbinding 154 Service and Warranty Spark plug Drive belts Air cleaner element Fuel filter Oil filter Clutch disc clutch parts Brush holders Brake shoe and pads Brake discs Brake drums Wiper blades Light bulbs Motor brushes Hoses Fuses etc Consumptive Parts Oil Grease and other fluids Engine oil Transmission oil Power steering fluid Brake fluid Coolant Grease Washer fluid Battery ...

Страница 159: ...trationregardlessofthedistancetraveled b Tyres This warranty is covered by the tyre manufacturer The coverage period is one year Please check with your CHEVROLET retailerfordetails c Audio Radio Acc This warranty is covered by the audio radio Acc manufacturer The coverage period is one year Please check withyourCHEVROLETretailerfordetails 6 MAKING THE WARRANTY EFFECTIVE The warranty goes into effe...

Страница 160: ...et Sail U VAin different cities in a phased manner The CHEVROLET retailer responsible for delivering your Sail U VA is qualified to provide all Sail U VA related services within the city where he is located As other CHEVROLET retailers become operational to handle the Sail U VA they will also be able to provide similar Sail U VArelated services IN ORDER FOR THE WARRANTY ON YOUR VEHICLE TOAPPLY IT ...

Страница 161: ...t free condition Accompanying this appropriately filled out service booklet Owner s Manual are the toolkitandyourvehicledocuments You have been informed of the service intervals and necessary service checks including under extreme operating conditions andinparticularwithregardtooilchangingofpetrolengines City date CHEVROLETRetailer s ASO s StampandSignature 157 Service and Warranty ...

Страница 162: ...158 Service and Warranty ...

Страница 163: ...d in an orderly and proper operating condition including Keys Service booklet Owner s Manual and tool kit I have read and understood the terms and conditions pertaining to the New VehicleWarrantyand agreetoabideby thesame I have been informed of the service intervals and necessary servicechecks includingunderextremeoperatingconditions Dateofdelivery City date Nameandsignatureofcustomer 159 Service...

Страница 164: ...160 Service and Warranty ...

Страница 165: ... that the vehicle has been inspected and delivered to my satisfaction Customer s Signature DearCustomer We are confident that you and your family would be enjoying thesafeandcomfortabledriveof theChevroletSailU VA We would like to undertake a thorough check up of the vehicle at 1000 kms or 30 days whichever occurs earlier This will also allow us to re emphasize the salient features of theSailU VAt...

Страница 166: ... ElectricalChecks Malfunctionindicatorlamp Charginglamp Oilpressurelamp Parkingbrakelamp indicator High beam Turn signal Hazard indicator allothertelltalelamp Cigarettelighter reardefogger Checklightingsystem Horn Radio OutsideMirrors High Lowbeam Hazardsignal Turnsignal Flashtopass signal Front Rearfog lamps Taillamps Stop lamp Reversing lamp Trunk lamp DynamicEvaluation Steering function noise a...

Страница 167: ...edtomysatisfaction Customer s Signature Labourfree Partsarechargeable Retainwithjobcard CHEVROLETInspection 1st ServiceCheck6months 7500 kms whicheveroccursearlier VIN ______________________________________________ Regn No __________________________________________ Deliverydate _______________________________________ Dateofservice _____________________________________ kms _________________________...

Страница 168: ...rtifythatthework has beencarriedoutas perthe schedule ServicingRetailer s ASO stamp date DeliveringRetailer s stamp date Iherebycertifythatthework has beencarriedoutasperthe schedule ServicingRetailer s ASO stamp date 164 Service and Warranty ...

Страница 169: ...dedtomysatisfaction Customer s Signature Labour Partsarechargeable Retainwithjobcard CHEVROLETInspection 3rd Service Check 1 5 years 22500 kms whichever occurs earlier VIN ______________________________________________ Regn No __________________________________________ Deliverydate _______________________________________ Dateofservice _____________________________________ kms _____________________...

Страница 170: ...rtifythatthework has beencarriedoutas perthe schedule ServicingRetailer s ASO stamp date DeliveringRetailer s stamp date Iherebycertifythatthework has beencarriedoutasperthe schedule ServicingRetailer s ASO stamp date 166 Service and Warranty ...

Страница 171: ...EET Repair category Free Service Paid Service Running Repair Accident Repair R O No Repair Category Details of Repair Done Name of Servicing Retailer Service Adv Sign Retailer Stamp Repair Date kms 167 Service and Warranty ...

Страница 172: ...nty MAINTENANCE RECORD SHEET Repair category Free Service Paid Service Running Repair Accident Repair R O No Repair Category Details of Repair Done Name of Servicing Retailer Service Adv Sign Retailer Stamp Repair Date kms ...

Страница 173: ...e vent hole In case of any drop in electrolyte level add pure distilledwater NEVERADDACID Batteryis warrantedforaperiodof oneyearonly Liability under this warranty is limited to defects arising out of faulty material or workmanship developing under proper use and NOT whenthebatteryis merelydischarged Defects arising out of faulty vehicle electrical systems negligent maintenance incorrect charging ...

Страница 174: ...pected for damage as part of the regular annual inspection or 15 000 kms service The customer is informed of any damage detected and measures to rectify this damage Any damage discovered is also indicated in the followingcorrosionprotectiondiagram Confirmation of the inspection is indicated by a stamp and dated signature accompanied by indication of the vehicle mileage on thefollowingverificationd...

Страница 175: ... subjected to an inspection by CHEVROLET retailer once ayear Any resultingwork issubjecttoacharge Check up 1 year after initial registration Check up date Odometer reading Damage found 1 Outer body Yes No 2 Under body Yes No 3 Engine compartment Yes No Retailer stamp signature Damage repaired Yes No Remarks General Motors India Pvt Ltd 171 Service and Warranty ...

Страница 176: ...ranty the vehicle must be subjected to an inspection by CHEVROLET retailer once ayear Any resultingwork issubjecttoacharge Check up 2 year after initial registration Check up date Odometer reading Damage found 1 Outer body Yes No 2 Under body Yes No 3 Engine compartment Yes No Retailer stamp signature Damage repaired Yes No Remarks General Motors India Pvt Ltd ...

Страница 177: ...mponents as mentioned in Annexure II 2 The period of the vehicle s warranty shall commence from the date of thevehiclesale 2 1 Warranty period 1 00 000 kms or 3 years whichever occurs earlier fromdateofthevehiclesale 3 The warranty claim will be accepted only after examination carried out by CHEVROLET retailers leading to a firm conclusion that none of the original settings specifications have bee...

Страница 178: ...dia Pvt Ltd will not be responsible for any fines penalties that may be charged by Statutory or Regulatory authorities on account of failure of the vehicle to comply with the in use emission standards on the vehicle not meeting any such given legal regulatory requirement during inspectionbysuch authorities 11 Emission Warranty will be appli cable irrespective of the change of ownership of the vehi...

Страница 179: ...r the service schedule described in the mainte nance chart given in the Owner s Manual 3 Avehicle which has been subjected to abnormal use abuses neglect and improper maintenance or has metwithanaccident 4 Use of such replacement parts which are not specified and approved by General Motors India Pvt Ltd 5 If the vehicle or parts thereof have been altered tampered with or modified or replaced in an...

Страница 180: ...vers only compliance with the emission standard as specified in sub rule 2 of Rule 115 of CMVR It does not cover any other performance of these parts or routine test and consequent maintenance or adjust ments to establish compliance to the in use emission standard as applicable to the state in which the vehicleisregisteredandis inuse 176 Service and Warranty ...

Страница 181: ...ormal production tolerance in design material or workmanship in a deviceorsystemwhichaffectsanyparameter performance orcomponentbelongingtoemissioncontrolsystem 7 Product Warranty The manufacturer warranty as provided by General Motors India Pvt Ltd which covers failure of various partsandsystems as pertheOwner s Manual3 years 1 00 000kms whicheverisearlier 8 Emission Warranty Warranty for emissio...

Страница 182: ...peratureSensor 10 Injectors 11 Knock Sensor 12 ExhaustGas Re circulationValve 13 FuelPump Catalytic Converter is covered only for emission related failures as provided under the warranty statement Replacements if any shall notbeapplicablefor breakageandnoiseproblems Note All the above mentioned parts are covered only if the car fails to meet the prescribed Emission norms Any other performance prob...

Страница 183: ...re authorized to carry out Periodic Maintenance Free Paid Minor Running Repair Only Authorized Service Center North Zone 180 West Zone 186 South Zone 191 East Zone 197 International 200 179 Service Network The list of authorized Retailers ASC are mentioned herein as of July 2012 For any change in authorized Retailers ASC please visit www chevrolet co in ...

Страница 184: ... Fax 011 45595979 Showroom 3 Majesty Mall Plot No 2 Road No 43 Guru Harkishan Marg Pitampura Delhi 110 034 Tel 011 42787878 Fax 011 42787877 Workshop 3 G 14 Udyog Nagar Rohtak Road Peeragarhi Delhi 110 041 Tel 011 42010101 Fax 011 42010132 Workshop 4 B 239 Okhla Industrial Area Phase 1 New Delhi 110 020 Tel 011 49808080 Fax 011 49808031 Workshop 5 62 Rama Road New Delhi 110015 Tel 011 43210707 432...

Страница 185: ...ality Papers Showroom Workshop Plot No 145 146 Industrial Area Sector 2 Kurukshetra 136 118 Telefax 01744 231050 HISSAR L Vibhushan Automobiles Pvt Ltd Showroom Workshop Opp Vidyut Nagar Delhi Road Hissar 125 001 Tel 0166 222224 5 645898 JHAJJAR L Shailesh Automobiles Showroom Workshop Tehsil Road Jhajjar Haryana 124 001 Tel 9253660066 9254171300 KAITHAL L Lekh Raj Motors Private Limited Showroom ...

Страница 186: ...L RSA Motors Showroom Workshop Plot No 5 Industrial Area Phase I Chandigarh 160 001 Tel 0172 5033333 37 5039999 69 Fax 0172 5033338 5039939 L Padam Motors Pvt Ltd Showroom 182 2 Industrial Area Phase 1 Chandigarh 160002 Tel 0172 5212900 Workshop 185 Industrial Area Phase 1 Chandigarh 160002 Tel 0172 5212999 HOSHIARPUR L Bedi Automobiles Showroom Workshop Piplawala Jalandhar Road Hoshiarpur 146 022...

Страница 187: ...ad NH 15 Sri Ganganagar Telefax 0154 2496200 UDAIPUR L Atharva Motors Pvt Ltd Showroom Workshop A 83 Mewar Industrial Area Madri NH 8 Ahmedabad Bye Pass Udaipur 313 002 Tel 0294 3002730 3002769 Fax 0294 2490108 ALLAHABAD L Eldee Motors Showroom Eldee Enclave 2 S P Marg Civil Lines Allahabad 211 001 Tel 0532 2560743 44 Workshop Kanodia Mill Compound 1 Luker Ganj Allahabad 211 001 Tel 0532 2616368 A...

Страница 188: ...224 001 Mob 09839099210 GORAKHPUR L United Motors Showroom 7 Park Road Golgarh Gorakhpur 273 001 Tel 0551 2201667 Fax 0551 2338299 Workshop Charphatak Road Mohaddipur Gorakhpur 273 001 Tel 0551 2270231 GHAZIABAD L Shiva Motors Showroom Workshop 28 3 5 Site IV Industrial Area Sahibabad Ghaziabad Tel 0120 3008600 605 631 632 635 636 Fax 0120 3008643 45 48 49 50 Workshop 2 58 3 Site 04 Sahibabad Ghaz...

Страница 189: ...reilly Road Moti Nagar Crossing Haldwani Mob 9258071041 Workshop 7 5km Stone Gora Padav Bareilly Road Haldwani 263 641 Tel 05946 232050 RUDRAPUR L Analysis Motors Showroom Near Axis Bank Nanital Road Rudrapur 263 153 Tel 9258071011 JAMMU L K C Motors Showroom Workshop NH 1 Byepass Road Jammu 180 004 Tel 0191 2465769 59 2460829 Fax 0191 2476660 RS PURA L K C Motors Showroom Workshop Bagha Mode RS P...

Страница 190: ...ot Road Chitra Bhavnagar 364 003 Tel 0218 2444590 2444445 BHUJ L Cargo Motors Showroom Workshop Plot No 10 Survey No 29 1 Bhuj Mirzapur Road Bhuj 370001 Tel 02832 654191 654192 GANDHIDHAM L Cargo Motors Showroom Workshop NH 8A Kandla Port Road Gandhidham 370 201 Tel 02833 654370 653317 9825611692 GODHRA L Shree Gopinathji Agencies Showroom Workshop Moonlight Cinema Compount Vavdi Godhra 389 001 Te...

Страница 191: ...Sahajanand Industrial Estate Munjmahuda Akota Vadodara 390 020 Tel 0265 2681010 2681020 2359898 2334109 Fax 0265 2681050 2681060 BHOPAL L Super Cars Ltd Showroom Workshop Plot No 21 Sector G Govindpura Industrial Area J K Road Bhopal 462 021 Tel 0755 4028400 4228201 Fax 0755 4228203 L Varenayam Motors Showroom Workshop 189 Angoori Bagh Jinsi Road Bhopal 462008 Tel 0755 2575288 299 300 Fax 0755 257...

Страница 192: ...i Mumbai 400 709 Tel 022 27780801 40708888 Fax 022 40708899 27780805 Showroom 2 264 265 Vaswani Chambers Opp Old Passport Office Pravhadevi Mumbai 400 025 Tel 022 434594444 24221711 12 Fax 022 24222713 Workshop 2 C o Bharat Tiles Marbles Ltd Jaibhimnagar Dharukhana Road Reay Road East Near Sujala Hotel Mumbai 400 010 Tel 022 64560303 23774514 15 16 Fax 022 23774505 Workshop 3 Plot No D 238 A TTC I...

Страница 193: ...room Workshop 41 Mutha Colony Sadar Bazar Satara 416 002 Mob 09623225299 SOLAPUR L Gandhi Wheels Showroom 163 1 Railway Lines Solapur 413 001 Telefax 0217 2629400 Workshop Vale Pune Road Solapur 413 001 Tel 0217 2500800 SANGLI L Unique Automobiles Showroom 442 3 Kulkarni Complex 100 feet road South Sivaji Nagar Sangli 416 416 Tel 0233 2326544 Fax 0233 2326594 Workshop Kulkarni Complex 100 Feet Roa...

Страница 194: ...Opp Oswal Park Thane West 400601 Tel 022 66040000 Fax 022 66040102 BILASPUR L Vardhaman Motors Showroom Workshop Uslapur Mungeli Road Bilaspur Tel 07752 217934 217935 BHILAI L Vardhaman Motors Showroom Chauhan Plaza Sutela Bhilai Distt Durg Tel 0788 3245924 STATE CHATTISGARH KORBA L Vardhman Automobiles Pvt Ltd Showroom Transport Nagar Near ICICI Bank Korba Workshop Vijay Talkies Road Transport Na...

Страница 195: ... 670 Azamabad RTC X Road Hyderabad 500 020 Tel 040 27668678 27668761 Fax 040 27668632 Workshop 3 Plot No 21 Mini Industrial Estate Hafeezpet Road Kondapur Hyderabad 500049 Tel 040 31906677 Workshop 4 Plot No 37 Survey No 45 Vignan Junior College Road Kundapur Hyderabad 500081 Tel 040 31906699 L Orange Auto Pvt Ltd Showroom 1 6 3 249 3 Abhinandan Towers Road No 1 Banjara Hills Hyderabad 500 034 Tel...

Страница 196: ...80 28603884 28605550 L Kropex India Ltd Showroom Workshop 49 1 Singasandara Hosur Main Road Bangalore 560 068 Tel 080 43574357 Fax 080 43574353 Showroom 2 7 1 Binnamangala 100 Feet Road 1st Stage Indira Nagar Bangalore Karnataka 560 038 Tel 080 42019013 Fax 080 42019216 L Trident Automobiles Pvt Ltd Showroom 1 No 122 1 C Shankar Reddy Layout Kalyan Nagar Outer Ring Road Bangalore 560 043 Tel 080 4...

Страница 197: ...eeyem Motors Pvt Ltd Showroom Workshop 11 336 NH 47 Bye Pass Nettor P O Ernakulam Cochin 682 304 Tel 0484 2703245 49 3097100 3097101 Fax 0484 2703244 Showroom 2 33 2440B Geetanjali Junction NH Byepass Chakkaraparambu Cochin 682 032 Tel 0484 2343146 CHALAKKUDY L Geeyem Motors Pvt Ltd Showroom IX 461A B Panampilly College NH 47 Potta Chalakkudy 680722 Tel 0480 2705125 2705123 KANJRAPALLI L Geeyem Mo...

Страница 198: ...owroom 14 3 A1 Guruvayoor Road Puzhakkal Ayyanthole P O Thrissur 680 003 Tel 0487 2388945 46 2388851 52 Fax 0487 2388851 Workshop Near Boating Station Puzhakkal Post Office Thrissur 680553 Tel 0487 2225100 2225101 TRIVENDRUM L Deedi Motors Pvt Ltd Showroom Workshop Erumalathopu N H Bye Pass Road Venpalvattom Anayara P O Trivendrum 695 029 Tel 0471 2556006 3257777 2558599 2558499 Fax 0471 2551020 W...

Страница 199: ...nit Nagari Madurai 625 221 Tel 0452 2463612 13 14 NAGERCOIL L AR A S Motors P Ltd Showroom Workshop 2 86 Tirunelveli Main road Ozhuginasery Nagercoil 629 001 Tel 04652 644664 Showroom 04652 272443 Workshop NAMAKAL L Thriive Cars Showroom 5 58 Salem Main Road Namakal Tel 04286 275603 Workshop 276 85 Tiruchengode Main Road Opp Old Lakshmi Kalyana Mandapam Namakkak 637 001 PUDUKOTTAI L Jayaraj Karz S...

Страница 200: ...owroom Workshop Pudukottai Bye Pass Road Thanjavur Tel 04362 226452 VELLORE L Sundaram Motors Showroom Workshop RS No 210 1 211 1B Bangalore Road Konavattam Vellore 632 013 Tel 0416 2291667 57 Fax 0416 3390869 196 Service Network ...

Страница 201: ...9234323211 BOKARO L Power Motors Showroom Workshop N 1 City Centre Sector 4 Bokaro Steel City Bokaro 827004 Tel 0654 2 233555 232977 Fax 06542 232988 DHANBAD L Black Diamond Techo Pvt Ltd Showroom Plot No 2324 Near Vishal Mega Mart Saraidhela Dhanbad 828 127 Tel 0326 2224886 2224892 Workshop Tilakraidhih NH 33 P O K G Ashram Near Govindpur Dhanbad 828 109 Tel 0326 24010630 HAZARIBAGH L Laxmi Auto ...

Страница 202: ...pali Sambalpur 768 002 Tel 0663 2402736 2405286 Fax 0663 2585894 ROURKELA L Balaram Motors Showroom Workshop Opposite Pahadi Kanta Vedvyash Rourkela 769 041 ASANSOL L Shaila Autotech Showroom Workshop NH 2 Chanda More Asansol 713 339 Telefax 0341 2343704 705 HOWRAH L Priti Motor Udyog P Ltd Showroom Workshop 112 Salkia School Road Howrah 711 106 Tel 033 26751916 18 Fax 033 26751917 Showroom 2 NH 6...

Страница 203: ... L Urban Station Showroom Workshop NSC Petrol Pump NH 39 6th Mile Kohima Road Dimapur Nagaland 797 112 Tel 03862 240994 240992 STATE MANIPUR STATE NAGALAND STATE TRIPURA STATE MEGHALAYA AGARTALA L Sri Krishna Automobiles Showroom Workshop Plot No 4612 4615 Shanihani Airport Road Agartala Tripura West 799 001 Tel 0381 2342566 SHILLONG L DH Royal Cars Showroom Workshop Parkview Fire Brigade Shillong...

Страница 204: ...pal Tel 00 97 1 4 4414625 4 4433205 Fax 00 97 1 4 4433294 SRI LANKA L Mag City Motor Company Pvt Ltd Showroom Workshop No 320A Darley Road Colombo 10 Sri Lanka Tel 0094777410407 BHUTAN L Global Trade Showroom Lkahilham Changgankha Thimphu Bhutan Workshop Post Box No 1037 Olarongcchu Thimphu Bhutann 200 Service Network ...

Страница 205: ......

Страница 206: ...t notice General Motors India Pvt Ltd Regd Office Chandrapura Industrial Estate Halol 389 351 Dist Panchmahals Gujarat India Phone 91 2676 221000 Customer Assistance Center Plot No 15 Echelon Institutional Area Sector 32 Gurgaon 122 001 Haryana India Tel 91 124 3080000 Works A 16 MIDC Talegaon Industrial Area Phase II Near Floriculture Park Talegaon Navlakh Umbhre Village Road Tehsil Maval Pune 41...

Отзывы: