manualshive.com logo in svg

Agilent Technologies 54853A, Руководство по обслуживанию, Страница: 128 / 194

Поделиться
Скачать
Agilent Technologies 54853A Скачать руководство пользователя страница 128

Chapter 5: Troubleshooting

To check the keyboard; Troubleshooting Procedure

5–26

To check the keyboard; Troubleshooting Procedure

8VHWKLVSURFHGXUHRQO\LI\RXHQFRXQWHUNH\IDLOXUHVLQWKHNH\ERDUGWHVWSURFHGXUH,IDQ\

NQREVIDLOUHSODFHWKHNH\ERDUGDVVHPEO\

1

Disconnect the power cord and remove the cover.

2

Remove the front panel assembly.

6HHFKDSWHUIRULQVWUXFWLRQV

3

Remove the keyboard assembly and the cursor keyboard assembly from the front panel 
assembly. Partially re-assemble the front panel assembly, including the flat-panel 
display and lens, but omitting the keyboard and cursor keyboard. Re-attach the partial 
assembly to the chassis.

%HVXUHWRUHFRQQHFWWKHGLVSOD\YLGHRFDEOHDQGWKHEDFNOLJKWLQYHUWHUFDEOHV6HHFKDSWHU

IRULQVWUXFWLRQVRQUHPRYLQJDQGGLVDVVHPEOLQJWKHIURQWSDQHO

4

Separate the elastomeric keypads from the cursor keyboard and keyboard assemblies.

C A U T I O N

CONTAMINATION CAN CAUSE INTERMITTENT OPERATION!
Be careful not to contaminate the key side of the PC board or the keypads. Dust and fingerprints 
on these parts may cause intermittent key operation.

5

Set the cursor keyboard and keyboard assembly on an antistatic electrical insulated 
surface.

6

Connect the cursor keyboard cable to the keyboard assembly. Connect the keyboard 
cable to the scope interface board in the chassis.

<RXPD\QHHGWRVHWWKHFKDVVLVRQLWVVLGHWRDOORZSURSHUURXWLQJRIWKHFDEOHVZLWKRXW

VWUDLQLQJWKHP

7

Reconnect the power cable and apply power.

8

Enable the graphical interface, then start the keyboard test as described in the previous 
procedure.

9

Carefully short the PC board trace, with a paper clip or screwdriver, at each 
nonoperating key (as determined by keyboard test), and look for an appropriate 
response on the display.

• If the display responds as though a key were pressed, replace the elastomeric keypad.

• If the display does not respond as though a key were pressed, replace the keyboard.

10

Re-assemble the instrument.

Содержание 54853A

Страница 1: ...n Warranties and Regulatory information see the pages at the back of this book Copyright Agilent Technologies 2003 All Rights Reserved Agilent Model 54853A 54854A and 54855A Infiniium Oscilloscopes Advanced Test Equipment Rentals www atecorp com 800 404 ATEC 2832 Established 1981 ...

Страница 2: ...n sweep speeds from 5 ps div to 20 s div 54855A 54854A or 10 ps div to 20 s div 54853A Delayed sweep speeds from 1 ps div to main time base setting Intensified waveforms on main sweep window make it easy to see what will appear in delayed sweep window Acquisition and general controls start and stop the scope and do basic setup Run and stop controls for continuous or single shot acquisitions Clear ...

Страница 3: ...terface Marker and Quick Measurements Vertical Controls Vertical Inputs Auxiliary Trigger Input Trigger Setup AutoProbe Interface GPIB Interface Mouse and Keyboard Interface VGA Interface CD RW drive Rear foot LAN and USB Ports Sound In Sound Out Microphone Trig Out AC Power Input 10 MHz Ref Out Parallel Printer Port RS232 COM Port Secondary monitor ...

Страница 4: ...iv Rear panel with option 017 Removable hard drive ...

Страница 5: ...r use Chapter 3 gives performance tests Chapter 4 covers calibration procedures how to do them and how often they need to be done Chapter 5 gives the procedures and techniques for replacing assemblies and other parts Chapter 6 includes a list of exchange assemblies and other replaceable parts part ordering information and shipping information Chapter 7 briefly covers the internal operation of the ...

Страница 6: ...vi ...

Страница 7: ... on the oscilloscope 2 16 To turn off the oscilloscope 2 16 To verify basic oscilloscope operation 2 17 Installing application programs on Infiniium 2 18 Changing Windows System Settings 2 18 To clean the oscilloscope 2 19 3 Testing Performance Performance Test Interval 3 2 Performance Test Record 3 2 Test Order 3 2 Test Equipment 3 2 Before Performing Performance Verification Testing 3 3 Vertical...

Страница 8: ... Power Supply Trouble Isolation 5 22 Power Board Trouble Isolation 5 24 AutoProbe Board Trouble Isolation 5 25 To check the keyboard Troubleshooting Procedure 5 26 To check the LEDs 5 27 To troubleshoot the acquisition system 5 28 Software Revisions 5 29 To check probe power outputs 5 30 To check the SVGA display board video signals 5 31 To check the backlight inverter voltages 5 32 6 Replacing As...

Страница 9: ...ve and replace the floppy disk drive 6 26 To remove and replace the internal hard disk drive 6 27 To remove and replace the CD ROM drive 6 29 To remove and replace the motherboard 6 31 To remove and replace the power supply 6 33 To remove and replace the fans 6 37 7 Replaceable Parts Ordering Replaceable Parts 7 2 Power Cables and Plug Configurations 7 3 Exploded Views 7 5 Replaceable Parts List 7...

Страница 10: ...Contents 4 ...

Страница 11: ...truments covered by this service guide 1 2 Accessories supplied 1 3 Options available 1 3 Accessories available 1 3 Specifications and Characteristics 1 5 Recommended test equipment 1 12 General Information ...

Страница 12: ...nges made to the oscilloscope after the release data listed on the title page An oscilloscope manufactured after the printing of this manual may have a newer serial number This newer serial prefix indicates that the oscilloscope may be different from those described in this manual The manual for this oscilloscope will be revised as needed If you have an oscilloscope with a newer serial number plea...

Страница 13: ...cope Table 1 1 Infiniium Oscilloscope Options You can order multiple options with the oscilloscope Also all model numbers shown in table 1 1 may also be ordered separately using the model number Some accessories that will enhance your work with the oscilloscope are listed in table 1 2 Accessories available The following accessories are available for use with the oscilloscope Table 1 2 Accessories ...

Страница 14: ...erminator E2622A 100 110 120 Ω differential terminator E2654A EZ Probe Positioner E2655A Additional probe deskew and performance verification kit E2669A Differential connectivity kit E2668A Single ended connectivity kit E2675A Differential browser and accessories E2676A Single ended browser and accessories E2677A Differential solder in probe head E2678A Single ended differential socketed probe E26...

Страница 15: ...l scale at full resolution channel scale Maximum input voltage 5 Vrms CAT I Offset range 12 div or 4 Volts whichever is smallest Offset accuracy 1 2 of channel offset 1 of full scale Dynamic range 4 div from center screen DC voltage measurement accuracy 1 Dual cursor Single cursor DC gain accuracy resolution DC gain accuracy offset accuracy resolution 2 Horizontal Main sweep time scale range 54855...

Страница 16: ...d data points to enhance measurement accuracy and waveform display quality Trigger Sensitivity1 Internal Low1 Internal High1 Auxiliary 54855A 0 5 div p p 0 to 2 GHz 1 0 div p p 2 to 4 GHz 2 5 div 5 GHz 54854A 0 5 div p p 0 to 2 GHz 1 0 div p p 2 to 4 GHz 54853A 0 5 div p p 0 to 2 GHz 1 0 div p p 2 to 2 5 GHz 54855A 0 2 div p p 0 to 6 GHz 54854A 0 2 div p p 0 to 4 GHz 54853A 0 2 div p p 0 to 2 5 GH...

Страница 17: ...d setup and or hold time must then be specified Triggeron pulse rising orfalling edges thatdo not cross two voltage levels in or the amount of time specified Measurements and math Waveform measurements Voltage Time Frequency Domain Peak to peak minimum maximum average RMS amplitude base top overshoot preshoot upper middle lower area Period frequency positive width negative width duty cycle delta t...

Страница 18: ... icons that can be dragged and dropped onto the displayed waveforms Marker modes Manual markers track waveform data track measurements Display Display Display Resolution Annotation Grids Waveform style 8 4 inch diagonal color TFT LCD 640 pixels horizontally x 480 pixels vertically Up to 12 labels with up to 100 characters each can be inserted into the waveform area Can display 1 2 or 4 waveform gr...

Страница 19: ...data file transfers and network printing IEEE 488 2 fully programmable COM1 printer and pointing device support Centronics printer port 2 ports Supports PS 2 pointing and input devices 2 ports Allows connection of USB peripherals and pointing devices while the oscilloscope is on 15 pin VGA full color output of scope waveform display 15 pin XGA full color output for using third party applications D...

Страница 20: ...th 440 mm 17 34 in Safety Meets IEC 61010 1 A2 CSA certified to C22 2 No 1010 1 self certified to UL 3111 Denotes warranted specifications all others are typical Specifications are valid after a 30 minute warm up period and 5 C from annual calibration temperature 1 Full scale is defined as 8 vertical divisions Vertical divisions are defined by the major scale settings above non major scale setting...

Страница 21: ...Chapter 1 General Information Dimensions 1 11 Dimensions The following pictures shows the dimensions of the frame ...

Страница 22: ...Bm to 16 dBm Agilent E4413A P Microwave Cable Assembly 50 Ω characteristic impedance 3 5 mm m or SMA m connectors Max Frequency 18 GHz Agilent 8120 4948 or Agilent 11500E or Gore EKD01D010480 P Cable Assembly 2 required 50 Ω characteristic impedance BNC m connectors Agilent 8120 1840 P Adapter BNC Tee m f f Agilent 1250 0781 P Adapter BNC f to dual banana Agilent 1251 2277 P Adapter 3 5 mm f to Pr...

Страница 23: ...itical Specifications Recommended Model Use Power Splitter 2 Resistor Power Splitter Max Frequency 18 GHz Agilent 11667A P Power Sensor Maximum Frequency 6 GHz Power range 24 dBm to 16 dBm Agilent E4412A P Adapters 3 5 mm f to Precision BNC 3 5 mm f to 3 5 mm m Type N m to 3 5 mm m Agilent 54855 67604 Agilent 1250 1748 Agilent 1250 1750 P ...

Страница 24: ...1 14 ...

Страница 25: ...onnect a printer 2 11 To connect an external monitor 2 13 To connect a GPIB cable 2 13 To tilt the oscilloscope upward for easier viewing 2 15 To turn on the oscilloscope 2 16 To turn off the oscilloscope 2 16 To verify basic oscilloscope operation 2 17 Installing application programs on Infiniium 2 18 Changing Windows System Settings 2 18 To clean the oscilloscope 2 19 Setting Up the Oscilloscope...

Страница 26: ...2 2 Setting Up the Oscilloscope This chapter shows you how to set up your Infiniium oscilloscope connect power and accessories and verify general operation ...

Страница 27: ...e sufficient clearance for airflow around the top bottom back and sides 2 Position the oscilloscope so that it is not difficult to unplug the power cord Figure 2 1 Positioning the Infiniium Oscilloscope with Sufficient Clearance Minimum 0 mm Minimum 85 mm both sides Minimum 39 mm Airflow requirements 250 cfm Minimum 22 mm ...

Страница 28: ...igure 2 2 Infiniium Oscilloscope Power Cord Connection The oscilloscope power supply automatically adjusts for line input voltages in the range 120 to 240 VAC Therefore you do not need to adjust an input line voltage setting The line cord provided is matched by Agilent Technologies to the country of origin of the order A full list of power cables and plug configurations is shown in chapter 6 Repla...

Страница 29: ...ouse Cable While you can operate many oscilloscope functions using only the front panel keys and knobs you will need the mouse to access advanced oscilloscope functions through the graphical interface or to find out more about the oscilloscope through the built in information system The optional touchpad pointing device connects in exactly the same way as the mouse The supplied mousepad provides t...

Страница 30: ...ack panel of the oscilloscope Figure 2 4 Connecting the Keyboard The keyboard simplifies some oscilloscope tasks such as entering file names when you store waveforms and setups to the disk 2 If you need more desk space place the keyboard on top of the oscilloscope Do not stack other objects on the keyboard this will cause self test failures on power on ...

Страница 31: ... 1 Connect your LAN cable to the RJ 45 connector on the LAN card Make sure the connection is secure Figure 2 5 Connecting to the LAN Card 2 After you have connected to the LAN card you must set up the network See your system administrator for assistance in setting up the network RJ 45 Connection ...

Страница 32: ...obes 1 Attach the probe connector to the desired oscilloscope channel or trigger input Push it straight on until it latches into place Figure 2 6 Attaching the Probe Connector 2 Connect the probe to the circuit of interest using the browser or other probing accessories Figure 2 7 Probing the Circuit ...

Страница 33: ...onnectorbodyawayfrom thefrontpaneloftheoscilloscopewithouttwisting it Figure 2 8 Disconnecting the Oscilloscope Probe CAUTION Do not attempt to twist the snap on probes on or off the oscilloscope s BNC connector Twisting the probe connector body will damage it CAUTION Do not exceed the maximum input voltage rating The maximum input voltage for the 50 Ω inputs is 5 Vrms CAT I ...

Страница 34: ...rs are supplied with the 54854A and 54855A Precision adapters are not required for the 54853A 1 Attach the two 3 5 mm to BNC compatible adaptors to the ends of an SMA cable 2 Push the 3 5 mm to BNC compatible adaptors onto the oscilloscope BNC connectors 3 Tighten the thumbscrews until they are snug Figure 2 9 Connecting SMA to BNC Adaptors SMA cable Thumb screw Precision 3 5 mm to BNC compatible ...

Страница 35: ...t the oscilloscope has a 9 pin serial connector Go to step 5 1 Attach the 25 pin small D connector to the printer output connector on the rear of the oscilloscope Tighten the thumbscrews to secure the cable Figure 2 10 Attaching the Small D Connector 2 Attach the larger 36 pin D connector to the printer Latch the wire bails into the tabs on each side of the connector Figure 2 11 Attaching the Larg...

Страница 36: ...oscilloscope Tighten the thumbscrews to secure the cable Figure 2 12 Attaching the 9 pin D Connector 6 Attach the 25 pin D connector to the serial input port of the printer Tighten the thumbscrews to secure the cable Figure 2 13 Attaching the 25 pin D Connector 7 Set the printer configuration to use the serial interface See the documentation for your printer Port on Printer ...

Страница 37: ...ure below 2 Tighten the retaining screws To extend the Windows XP desktop You can extend the Windows XP desktop by connecting a secondary monitor 1 Connect the monitor cable to the secondary monitor connector at the rear panel of the oscilloscope as shown in the figure below 2 Tighten the retaining screws then go into the Windows control panel to setup and configure the monitor Figure 2 14 Connect...

Страница 38: ...Chapter 2 Setting Up the Oscilloscope To connect a GPIB cable 2 14 Figure 2 15 Attaching the GPIB Connector ...

Страница 39: ... upward for easier viewing 2 15 To tilt the oscilloscope upward for easier viewing 1 Lift up the front of the oscilloscope grasp the wire bail near the center and pull it down and forward until it latches into place Figure 2 16 Latching the Oscilloscope Front Feet ...

Страница 40: ...the oscilloscope is turned on To turn off the oscilloscope 1 Momentarily depress the power switch at the lower left hand corner of the oscilloscope front panel The oscilloscope will go through a normal Windows shutdown process Screen Saver The oscilloscope display has a screen saver that turns off the backlight when there has been no front panel or graphical interface activity for a pre determined...

Страница 41: ...e is configured to its default settings 4 Press the Autoscale key on the front panel The display will pause momentarily while the oscilloscope adjusts the sweep speed and vertical scale You should then see a square wave with peak to peak amplitude of approximately 5 divisions and a period of almost 3 divisions If you do not see the waveform ensure your power source is adequate the oscilloscope is ...

Страница 42: ...em Properties Hardware Tab settings Do not change the System Properties Advanced Tab settings Do not change the Regional and Language Options Advanced Tab settings Do not remove Fonts Display Settings Do not turn off the screen saver The screen saver turns off the display s backlights extending their life Do not change the screen resolution from 640 by 480 pixels or the color quality from High 24 ...

Страница 43: ... 2 19 To clean the oscilloscope Clean the oscilloscope with a soft cloth dampened with a mild soap and water solution CAUTION Do not use too much liquid in cleaning the oscilloscope Water can enter the Infiniium front panel damaging sensitive electronic components ...

Страница 44: ...2 20 ...

Страница 45: ...mance Test 3 5 DC Measurement Accuracy Single Cursor Test 3 11 Analog Bandwidth Maximum Frequency Check 3 16 Horizontal Performance Verification 3 23 Time Base Accuracy Test 3 24 Delta time Measurement Accuracy Test 3 28 Trigger Performance Verification 3 31 Internal Channel Trigger Sensitivity Test 3 32 Trigger Jitter Test 3 43 Agilent 54853A 54A 55A Performance Test Record 3 47 Testing Performan...

Страница 46: ...results Test Order The tests in this section maybe performed in any order desired However it is recommended to conduct the tests in the order presented in this manual as this represents an incremental approach to performance verification This may be useful if you are attempting to troubleshoot a suspected problem Test Equipment Lists of equipment needed to conduct each test are provided for each t...

Страница 47: ... self tests fail ensure that the failure is diagnosed and repaired before calibrating and testing performance 2 Performance calibration After the warm up period calibrate the oscilloscope a Pull down the Utilities menu and select Calibration b Uncheck to Cal Memory Protect box to allow calibration c Click on Start to start the calibration procedure Follow the on screen instructions as calibration ...

Страница 48: ...e Verification This section contains the following vertical performance verification Offset Performance Test Zero Error Test Offset Gain Test DC Measurement Accuracy Single Cursor Test Analog Bandwidth Maximum Frequency Check ...

Страница 49: ...1 of full scale Offset Gain Zero Error Offset Range 12 div or 4 V whichever is smallest Full scale is defined as 8 vertical divisions Vertical divisions are defined by the major scale settings above non major scale settings The major scale settings are 10 mV 20 mV 50 mV 100 mV 200 mV 500 mV and 1 V Description Critical Specifications Recommended Model Part Numbers Digital Multimeter DC voltage mea...

Страница 50: ... as follows a Change the vertical sensitivity of channel 1 to 10mV div b Click the V avg measurement icon on the left side of the screen c When the Enter Measurement Info window is displayed ensure that the V avg function is set up as follows and then click OK Source Channel 1 Measurement Area Entire Display V avg icon ...

Страница 51: ...played enable averaging and set the of averages to 256 b Change the vertical sensitivity of channel 2 to 10 mV div c Click the V avg measurement icon on the left side of the screen d When the Enter Measurement Info window is displayed ensure that the Vavg function is set up as follows and then click OK Source Channel 2 Measurement area Entire Display 9 Press the Clear Display key on the scope wait...

Страница 52: ...Measurement area Entire Display Notes Where it is used it is important to connect the BNC Tee adapter directly to the scope channel input to minimize ground potential differences between the scope and the test instruments and to ensure that the DMM measures the input voltage to the scope channel as accurately as possible Differences in ground potential can be a significant source of measurement er...

Страница 53: ...n the dialog box c Enter 120 mV in the Enter Offset dialog box 16 Set the Aux Out voltage VAux Out to 120 mV as follows a Pull down the Utilities menu and select Calibration b Change the Aux Output function to DC top left corner c Set the Level to 120 mV d Click on Close 17 Press the Clear Display key on the scope wait for the Avgs value top left corner of screen to return to 256 and then record t...

Страница 54: ... and record this value in the Offset Gain Test section of the Performance Test Record 22 Repeat steps 15 to 21 for the remaining channel 1 vertical sensitivities in the Offset Gain Test section of the Performance Test Record For each measurement set both the Aux Out voltage VAux Out and the Channel offset voltage to the positive VAux Out value and then to the negative VAux Out value in the VAux Ou...

Страница 55: ...curacy resolution Full scale is defined as 8 vertical divisions Vertical divisions are defined by the major scale settings above non major scale settings The major scale settings are 10 mV 20 mV 50 mV 100 mV 200 mV 500 mV and 1 V Vertical resolution for 8 bits 0 4 of full scale for 12 bits 0 024 of full scale Description Critical Specifications Recommended Model Part Numbers Digital Multimeter DC ...

Страница 56: ...n the scope and the test instruments and to ensure that the DMM measures the input voltage to the scope channel as accurately as possible Differences in ground potential can be a significant source of measurement error particularly at high scope sensitivities It also helps to reduce ground potential differences if the scope and the external test instruments are connected to the same AC supply circ...

Страница 57: ... DC top left corner c Set the Level to 30 mV d Click on Close 5 Configure the scope to measure Average voltage as follows a Change the vertical sensitivity of channel 1 to 10 mV div b Click the V avg measurement icon on the left side of the screen c When the Enter Measurement Info window is displayed ensure that the V avg function is set up as follows and then click OK Source Channel 1 Measurement...

Страница 58: ...y key on the scope wait for the Avgs value top left corner of screen to return to 256 and then record the DMM voltage reading and the scope V avg reading in the DC Measurement Accuracy Single Cursor Test section of the Performance Test Record 10 Repeat steps 7 8 and 9 for the remaining channel 1 vertical sensitivities in the table For each measurement set the Aux Out voltage to the VAux Out Settin...

Страница 59: ...n the scope wait for the Avgs value to return to 256 and then record the DMM voltage reading and the scope V avg reading in the DC Measurement Accuracy Single Cursor Test section of the Performance Test Record 14 Repeat steps 12 and 13 for the remaining channel 2 vertical sensitivities in the table For each measurement set the Aux Out voltage to the VAux Out Setting column in the DC Measurement Ac...

Страница 60: ... 6 GHz Power range 24 dBm to 16 dBm Agilent E4413A Microwave Cable Assembly 50Ω Characteristic Impedance 3 5 mm m or SMA m connectors Max Frequency 18 GHz Agilent 8120 4948 or Agilent 11500E or Gore EKD01D010480 Adapters 3 5 mm f to Precision BNC Agilent 54855 67604 Description Critical Specifications Recommended Model Part Numbers Power Splitter 2 Resistor Power Splitter Max Frequency 18 GHz Agil...

Страница 61: ...d and all other channels are turned off b Set the vertical sensitivity of channel 1 to 10mV div c Set the horizontal scale to 16 ns div to display 8 cycles of a 50 MHz waveform Notes Connect output 1 of the 11667B splitter to the scope Channel n input directly using the 54855 67604 adapter without any additional cabling or adapters Connect the power sensor directly to output 2 of the power splitte...

Страница 62: ... as follows Memory Depth Automatic Sampling rate Maximum 20 GSa s Sin x x Interpolation filter enabled Averaging enabled with of Averages 16 e Pull down the Measure menu select Voltage and then select V rms f When the RMS voltage measurement setup window is displayed configure this measurement as follows Source Channel 1 Measurement Area Entire Display RMS Type AC ...

Страница 63: ...oes not produce a vertically clipped signal on the scope Table 3 1 Nominal Generator Amplitude Settings 8 Measure the input power to the scope channel and convert this measurement to Volts RMS using the expression For example if the power meter reading is 4 0 µW then Vin 4 0 10 6 50Ω 1 2 14 1 mVrms Record the RMS voltage in the Analog Bandwidth Maximum Frequency Check section of the Performance Te...

Страница 64: ...rea at the bottom of the screen 10 Calculate the reference gain as follows Record this value in the Calculated Gain 50 MHz column in the Analog Bandwidth Maximum Frequency Check section of the Performance Test Record Notes For all scope readings in this procedure use the mean value in the Measurements display area at the bottom of the screen If a question mark is displayed in front of any of the v...

Страница 65: ...Clear Display key on the scope wait for the Avgs value top left corner of screen to return to 16 and then record the scope V rms reading in the Analog Bandwidth MaximumFrequencyChecksectionofthePerformanceTestRecord Vout Max Freq 15 Calculate the gain at the maximum frequency using the expression For example if Vout Max Frequency 13 825 mV Vin Max Frequency 13 461 mV and Gain 50MHz 1 0023 then Rec...

Страница 66: ... Right click on the V rms measurement at the bottom of the screen When the RMS voltage measurement setup window is displayed change the source from Channel 1 to Channel 2 22 Repeat steps 7 to 20 to complete measuring gains for channel 2 23 Move the splitter to channel 3 and change the scope configuration as follows a Ensure Channel 3 is displayed and all other channels are turned off b Set the ver...

Страница 67: ...3 23 Horizontal Performance Verification This section contains the follow horizontal performance verification Time Base Accuracy Test Delta time Measurement Accuracy Test ...

Страница 68: ...ccuracy 1 ppm peak Description Critical Specifications Recommended Model Part Numbers 10 MHz Signal Source Sine Wave with Amplitude 6 Vp p into 50Ω Frequency Accuracy better than 0 4 ppm Output resistance 50Ω Agilent E8247C with Opt 520 or Agilent 82712B with Opt 1E5 or Agilent 8665B with Opt 004 Microwave Cable Assembly 50Ω Characteristic Impedance 3 5 mm m or SMA m connectors Max Frequency 18 GH...

Страница 69: ...he time base is calibrated the displayed waveform will be un aliased at this time base setting and will appear like the one on the screen image shown below The question marks in the frequency measurement area at the bottom of the screen indicate that the frequency is not measurable at this time scale d If the time base is NOT calibrated an aliased waveform with a frequency in the range of about 30...

Страница 70: ...r Display key until at least 1 complete cycle is displayed and NO question marks are displayed in the frequency measurement area at the bottom of the screen c In most cases it will be necessary to repeat this procedure until the time base setting is about 100 ms div to 500 ms div A typical aliased waveform will look like the one shown below Wait until the of meas field shows 15 or more measurement...

Страница 71: ...l used in this test If this is the case a waveform like the one shown below will be displayed If this case it will be impossible to capture a full cycle of the aliased waveform If this occurs with the timebase set to 200 ms div or higher and if the frequency accuracy of the source is 0 4 ppm or better then the scope under test passes this test ...

Страница 72: ...rate 20 GSa s sinx x interpolation enabled measurement threshold fixed voltage at 50 level Measurement is between two edges on a single channel RMS value refers to the standard deviation of 256 consecutive measurements performed using an individual instrument Description Critical Specifications Recommended Model Part Numbers Microwave CW Generator Maximum Frequency 6 GHz Power range 20 dBm to 16 d...

Страница 73: ...ximum 20 GSa s Sin x x filter enabled Averaging enabled with of Averages 256 3 Set up the signal source to operate as follows Frequency 4 GHz 54855A and 54854A or 2 5 GHz 54853A Amplitude 7 divisions peak to peak 2 5 dBm 4 Set up the scope to measure period as follows a Click the Period measurement icon on the left side of the screen or b Pull down the Measure menu select Time and then select Peri...

Страница 74: ...ess the Stop key 7 Record the min max and std dev values in the Delta time Results with Averaging Enabled section of the Performance Test Record 8 Pull down the Setup menu select Acquisition and then disable Averaging 9 Press the Clear Display key then allow the of meas field to increment to at least 256 and then press the Stop key 10 Record the min max and std dev values in the Delta time Results...

Страница 75: ...rformance verification Internal Channel Trigger Accuracy Test Low Sensitivity Measurements 1 GHz Low Sensitivity Measurements 2 5 GHz 54853A or 4 GHz 54854A and 54855A High Sensitivity Measurements Maximum Frequency 2 5 GHz 54853A or 4 GHz 54854A or 6 GHz 54855A Trigger Jitter Test ...

Страница 76: ...p p 0 to 2 GHz 1 0 div p p 2 to 4 GHz 54853A 0 5 div p p 0 to 2 GHz 1 0 div p p 2 to 2 5 GHz High sensitivity mode 54855A 0 2 div p p 0 to 6 GHz 54855A 0 2 div p p 0 to 4 GHz 54855A 0 2 div p p 0 to 2 5 GHz Description Critical Specifications Recommended Model Part Numbers Microwave CW Generator Maximum Frequency 6 GHz Power range 20 dBm to 16 dBm into 50Ω Output resistance 50Ω Agilent E8247C with...

Страница 77: ...Source Channel 1 Sweep Auto Click on Conditioning and select Low Sensitivity e Pull down the Setup menu select Acquisition and then set up the acquisition parameters as follows Memory Depth Automatic Sampling rate Maximum 20 GSa s Sin x x Interpolation filter enabled Averaging enabled with of Averages 16 3 Set up the source generator as follows Frequency 2 GHz Amplitude 5 0 dBm ...

Страница 78: ... indicator by the Horizontal timebase knob turns on solidly not blinking to indicate stable triggering 7 Reduce the source generator signal amplitude in 0 2 dBm decrements until the Trig d indicator by the Horizontal timebase knob starts to blink on and off When the Trig d indicator starts to blink carefully re adjust the trigger level to try to re establish stable triggering Trig d indicator not ...

Страница 79: ...using the expression e Record this peak to peak division value in the space provided in the Internal Trigger Sensitivity Test section Low Sensitivity 2 GHz section of the Performance Test Record for channel 1 9 Turn off the V p p measurement 10 Move the cable from channel 1 to channel 2 11 Change the scope setup as follows a Turn channel 1 display off b Turn channel 2 display on c Set channel 2 ve...

Страница 80: ... key until Auto is illuminated 17 Reset the generator output to 5 dBm 18 Repeat steps 4 to 8 inclusive for channel 3 19 Move the cable from channel 3 to channel 4 20 Change the scope setup as follows a Turn channel 3 display off b Turn channel 4 display on c Set channel 4 vertical sensitivity to 1 0 V div d Press the trigger Source key until 4 is illuminated e Press the trigger Sweep key until Aut...

Страница 81: ...l the Trig d indicator by the Horizontal timebase knob turns on solidly not blinking to indicate stable triggering 7 Reduce the source generator signal amplitude in 0 2 dBm decrements until the Trig d indicator by the Horizontal timebase knob starts to blink on and off When the Trig d indicator starts to blink carefully re adjust the trigger level to try to re establish stable triggering Trig d in...

Страница 82: ...l 2 to channel 3 16 Change the scope setup as follows a Turn channel 2 display off b Turn channel 3 display on c Set channel 3 vertical sensitivity to 1 0 V div d Press the trigger Source key until 3 is illuminated e Press the trigger Sweep key until Auto is illuminated 17 Reset the source generator output amplitude to 1 5 dBm 18 Repeat steps 4 to 8 inclusive for channel 3 19 Move the cable from c...

Страница 83: ...orizontal timebase knob turns on solidly not blinking to indicate stable triggering 7 Reduce the source generator signal amplitude in 0 2 dBm decrements until the Trig d indicator by the Horizontal timebase knob starts to blink on and off When the Trig d indicator starts to blink carefully re adjust the trigger level to try to re establish stable triggering Trig d indicator not blinking If stable ...

Страница 84: ...l 2 to channel 3 16 Change the scope setup as follows a Turn channel 2 display off b Turn channel 3 display on c Set channel 3 vertical sensitivity to 1 0 V div d Press the trigger Source key until 3 is illuminated e Press the trigger Sweep key until Auto is illuminated 17 Reset the source generator output amplitude to 1 5 dBm 18 Repeat steps 4 to 8 inclusive for channel 3 19 Move the cable from c...

Страница 85: ... Level control until the Trig d indicator by the Horizontal timebase knob turns on solidly not blinking to indicate stable triggering 7 Reduce the source generator signal amplitude in 0 2 dBm decrements until the Trig d indicator by the Horizontal timebase knob starts to blink on and off When the Trig d indicator starts to blink carefully re adjust the trigger level to try to re establish stable t...

Страница 86: ... 2 to channel 3 16 Change the scope setup as follows a Turn channel 2 display off b Turn channel 3 display on c Set channel 3 vertical sensitivity to 1 0 V div d Press the trigger Source key until 3 is illuminated e Press the trigger Sweep key until Auto is illuminated 17 Reset the source generator output amplitude to 10 0 dBm 18 Repeat steps 4 to 8 inclusive for channel 3 19 Move the cable from c...

Страница 87: ...nterpolation enabled measurement threshold fixed voltage at 50 level Internal trigger Trigger level contained within full scale display range of trigger channel Description Critical Specifications Recommended Model Part Numbers Microwave CW Generator Maximum Frequency 6 GHz Power range 20 dBm to 16 dBm into 50Ω Frequency Accuracy better than 0 4 ppm Output resistance 50Ω Agilent E8247C with Opt 52...

Страница 88: ...s Default Setup b Set channel 1 vertical sensitivity to 200 mV div c Set the horizontal scale to 10 ps div d Trigger Mode Edge triggered Rising edge e Trigger Source Channel 1 4 Configure the scope to measure jitter as follows a Pull down the Setup menu and select Display b Enable Color Grade ...

Страница 89: ...e Channel 1 Top Limit By 0 0 V Bottom Limit Ay 0 0 V Left Limit Ax 10 ps Right Limit Bx 10 ps Histogram is enabled 5 Press the Clear Display key allow the hits counter to increment to at least 512 and then record the std dev value in the Trigger Jitter Test section of the Performance Test Record for channel 1 Click here and enter limits from step d Record the std dev reading hits counter ...

Страница 90: ...Change the trigger source to channel 2 7 Pull down the Analyze menu and select Histogram When the histogram menu is displayed change the scale source from channel 1 to channel 2 8 Press the Clear Display key allow the hits counter to increment to at least 512 and then record the std dev value in the Trigger Jitter Test section of the Performance Test Record for channel 2 9 Repeat steps 6 to 8 for ...

Страница 91: ...40 mV 0 98 to 1 02 50 mV div 600 mV 0 98 to 1 02 100 mV div 1 2 V 0 98 to 1 02 200 mV div 2 4 V 0 98 to 1 02 500 mV div 2 4 V 0 98 to 1 02 1 V div 2 4 V 0 98 to 1 02 Channel 2 10 mV div 120 mV 0 98 to 1 02 20 mV div 240 mV 0 98 to 1 02 50 mV div 600 mV 0 98 to 1 02 100 mV div 1 2 V 0 98 to 1 02 200 mV div 2 4 V 0 98 to 1 02 500 mV div 2 4 V 0 98 to 1 02 1 V div 2 4 V 0 98 to 1 02 Channel 3 10 mV d...

Страница 92: ...600 mV 32 0 mV 500 mV div 1 5 V 80 0 mV 1 V div 2 4 V 160 mV Channel 2 10 mV div 30 mV 1 6 mV 20 mV div 60 mV 3 2 mV 50 mV div 150 mV 8 0 mV 100 mV div 300 mV 16 0 mV 200 mV div 600 mV 32 0 mV 500 mV div 1 5 V 80 0 mV 1 V div 2 4 V 160 mV Channel 3 10 mV div 30 mV 1 6 mV 20 mV div 60 mV 3 2 mV 50 mV div 150 mV 8 0 mV 100 mV div 300 mV 16 0 mV 200 mV div 600 mV 32 0 mV 500 mV div 1 5 V 80 0 mV 1 V ...

Страница 93: ...3dB Vin Max Freq Vout Max Freq Calculated Gain Max Freq Test Limit greaterthan 3dB Channel 1 10 mV div 20 mV div 50 mV div 100 mV div 200 mV div 500 mV div 1 V div Channel 2 10 mV div 20 mV div 50 mV div 100 mV div 200 mV div 500 mV div 1 V div Channel 3 10 mV div 20 mV div 50 mV div 100 mV div 200 mV div 500 mV div 1 V div Channel 4 10 mV div 20 mV div 50 mV div 100 mV div 200 mV div 500 mV div 1...

Страница 94: ...urements and Results 2 GHz 1 0 5 division 2 0 5 division 3 0 5 division 4 0 5 division Low Sensitivity Measurements and Results 4 GHz 54855A 54854A or 2 5 GHz 54853A 1 1 0 division 2 1 0 division 3 1 0 division 4 1 0 division Low Sensitivity Measurements and Results 5 GHz 54855A only 1 2 5 division 2 2 5 division 3 2 5 division 4 2 5 division High Sensitivity Measurements and Results Max Frequency...

Страница 95: ...rdware Adjustments 4 2 Mainframe Cal Factor Memory Error 4 2 Operating Hints 4 3 Loading Default Oscilloscope Settings 4 3 Loading New Software 4 3 Calibration Procedures 4 3 To check the flat panel display FPD 4 4 To run the self calibration 4 7 Calibration ...

Страница 96: ... under circumstances set by certain needs which are explained in other areas of this guide The self calibration uses signals generated in the oscilloscope to calibrate channel sensitivity offsets and trigger parameters You should run the self calibration yearly or according to your periodic needs when you adjust or replace the acquisition assembly or acquisition hybrids when you replace the hard d...

Страница 97: ... Oscilloscope Settings To reset the oscilloscope to default conditions press the Default Setup key Loading New Software This oscilloscope stores its operating system code on a hard disk drive New code is loaded into the oscilloscope by using the CD ROM It is rarely necessary to reload the code If your system is not working correctly you may need to update to newer code or re image the disk Find th...

Страница 98: ... mm Length 10 mm Dent φ 0 4mm Dot Defect A dot is defined as 1 2 or 3 stuck subpixels touching horizontally Subpixels are horizontal red green bluetriads sothesemayshowupas one of 8 colors or black Bright dot N 5 Dark dot N 7 Total dot N 12 Two adjacent dots Bright dot Dark dot 2 pairs 2 pairs Three or more adjacent dots Not allowed Distance between defects Bright dot Dark dot 10 mm 10 mm Line Def...

Страница 99: ... 5 Click Start Self Test A new dialog appears with a series of radio buttons that allow selection of different background colors See figure 4 2 Figure 4 2 Screen Test Click to start the test SelectScreentodo the flat panel display test Clickoneofthesebuttons to select the background color to check ...

Страница 100: ...ntly than the current selection These pixels are either inactive or stuck If black when a color or white is selected they are inactive if another color than the current selection but not black then they are stuck If the display does not meet the specification given on the previous page replace it See chapter 5 for removal and replacement procedures 8 Repeat steps 6 and 7 for all colors ...

Страница 101: ...e calibration 2 Pull down the Utilities menu and Select Calibration 3 Click the check box to clear the Cal Memory Protect condition You cannot run self calibration if this box is checked See figure 4 3 Equipment Critical Specifications Recommended Model Part Adapter supplied with 54854A 54855A 2 required for 54855A calibration 3 5 mm f to precision BNC No substitute Agilent 54855 67604 Shorting Ca...

Страница 102: ...connect a 10 MHz reference signal to channel 1 that meets the following specifications Failure to use a reference signal that meets this specification will result in an inaccurate calibration Skip Time scale calibration will not be performed Time scale calibration factors from the previous time scale calibration will be used and the 10 MHz reference signal will not be required The remaining calibr...

Страница 103: ...Primary Trouble Isolation 5 6 No Display Trouble Isolation 5 10 POST Code Listing 5 19 Power Supply Trouble Isolation 5 22 To check the keyboard Troubleshooting Procedure 5 26 To check the LEDs 5 27 Software Revisions 5 29 To check probe power outputs 5 30 To check the SVGA display board video signals 5 31 To check the backlight inverter voltages 5 32 Troubleshooting ...

Страница 104: ...es Tools Required You will need basic electronic troubleshooting tools including a digital multimeter external Atx supply or loopback connector external monitor and a 100 MHz oscilloscope Performance verification tests have more stringent requirements See chapter 1 for the list of recommended test equipment If you need to remove and replace assemblies you will need some of the hand tools listed in...

Страница 105: ...ies the instrument setup procedure Use the default setup when a procedure requires it Press the Default Setup key to set the instrument to the default state To install the fan safety shield 1 Disconnect the instrument power cord and remove the cover I QHFHVVDU UHIHU WR WKH SURFHGXUHV LQ FKDSWHU 5HSODFLQJ VVHPEOLHV 2 Clip the fan safety shield over the outside of the instrument chassis next to the ...

Страница 106: ...RZFKDUW FRQWDLQV WKH HQWLUH WURXEOHVKRRWLQJ SDWK IURP D IDLOHG LQVWUXPHQW WR D ZRUNLQJ RQH DQG ZLOO GLUHFW RX LQ DQ RUGHUO PDQQHU WKURXJK WKH SRVVLEOH IDLOXUH V PSWRPV 5HIHUHQFH OHWWHUV RQ WKH IORZFKDUWV SRLQW WR SURFHGXUDO VWHSV WKDW H SODLQ WKH EULHI LQVWUXFWLRQV LQ WKH FKDUW R QRW WU WR WURXEOHVKRRW E IROORZLQJ RQO WKH UHIHUHQFH WH W EHFDXVH WKH WH W LV QRW LQ WKH FRUUHFW RUGHU IRU WURXEOHVKRRW...

Страница 107: ...se Do knob and key test OK System works do performance tests End Go to No Display Debug Go to Keyboard Troubleshooting Does LED test OK Check Self Calibration Does self calibration test pass Go to Acquisition Troubleshooting No No No Yes A B E F G H 54830F01 Check processor temperature C Is temperature OK Yes Check for fan fail message Does fan fail No Replace fan Yes D Go to Acquisition Troublesh...

Страница 108: ...VHOI IRU RXU WURXEOHVKRRWLQJ SDWK A Perform power up 1 Power on the instrument A short time after the instrument is turned on the scope graticule is displayed on the screen The screen should look similar to the next figure The exact appearance may vary depending on the setup selected before the instrument was turned off Figure 5 2 Power on Display Default Graphical Interface Disabled 2 Press the D...

Страница 109: ...efansarerunning If afanisnot running afan failuremessagewill appear If more than one fan has failed the oscilloscope will shut down E Run oscilloscope self tests 1 Enable the graphical interface Refer to section 2 Preparing for use for instructions 2 Select Self Test from the Utilities menu 3 Select Scope Self Tests from the Self Test drop down list box 4 Click the Start Test button and follow the...

Страница 110: ...ctions until you have turned all knobs KHQ RX WXUQ D NQRE LQ RQH GLUHFWLRQ WKH FRUUHVSRQGLQJ NQRE V PERO RQ WKH GLVSOD VKRXOG FKDQJH IURP UHG WR HOORZ KHQ RX WKHQ WXUQ WKH NQRE LQ WKH RWKHU GLUHFWLRQ WKH NQRE V PERO VKRXOG FKDQJH IURP HOORZ WR JUHHQ 6 When you are finished click Close I DQ RI WKH NQREV RU NH V GR QRW ZRUN JR WR 7R FKHFN WKH NH ERDUG 7URXEOHVKRRWLQJ 3URFHGXUH When you push a key or...

Страница 111: ...onding LEDs on the front panel are the only ones illuminated 5 When you are finished click Close If any of the LEDS do not work go to To check the LEDs later in this chapter 6 If both tests pass go to step E G Self Calibration 1 Complete a self Calibration by following the procedures in chapter 3 Testing Performance 2 Ifthe calibrationtestfails replacethe acquisitionassembly Ifthe calibrationtestp...

Страница 112: ...rd Turn on unit Does unit turn on Replace acquisition board Plug probe interface board cable back into power board Turn unit on Remove the probe interface board cable from the power board Does unit turn on No trouble found Loose connectors were probably reseated No Display Debug Check the power supply using the Power Supply Verification flowchart in this chapter Go to Front Panel Display Debug Go ...

Страница 113: ...d and LCD No Does front panel display work Try a golden SVGA card to verify failure Does display work with golden card Replace LCD Replace SVGA card Try a golden SVGA card to verify failure Does display work with golden card Replace motherboard No Replace SVGA card Yes Check inverter board control cable Yes Check voltage on Cap C2 of SVGA card Should be 12V Is cable and voltage OK Replace LCD Yes ...

Страница 114: ... WARNING INJURY CAN RESULT Once the cover is removed the fan blades are exposed both inside and outside the chassis Disconnect the power cable before working around the fan Use extreme caution in working with the instrument when the cover is removed Install the fan safety shield Agilent Technologies P N 54810 00601 on the side of the chassis over the fan Failure to observe these precautions may re...

Страница 115: ...ation 7KH PRWKHU ERDUG YHULILFDWLRQ UHTXLUHV WKH XVH RI HLWKHU D DWW RU JUHDWHU 7 3 SRZHU VXSSO RU D WHVW IL WXUH WKDW FDQ EH EXLOW DV IROORZV 8VLQJ DQ 03 FRQQHFWRU 7 FR OHFWURQLFV SDUW QXPEHU RU JLOHQW SDUW QXPEHU VROGHU ZLUHV EHWZHHQ WKH SLQV DV VKRZQ LQ WKH LJXUH Figure 5 5 ...

Страница 116: ...rness into motherboard Plug motherboard connector of ATX supply into motherboard power connector Yes Plug ac power into power supply being used Push power button on front of instrument No Hit delete at splash screen Enter bios setup Yes Is power board 54855 66502 in instrument Is Power on After Power Fail set to off Go to Primary Trouble Isolation Setup bios per setting instructions Motherboard OK...

Страница 117: ...ug Remove all PCI cards and disconnect hard drive CD drive and floppy drive from the motherboard Use tweezers and motherboard switch cable to try and get the motherboard to boot Start adding components back in one at a time Remove all cables from cards and add them back on one at a time also Go to Primary Trouble Isolation Motherboard verification Do fans turn on does motherboard beep 10 sec No Ye...

Страница 118: ... ODEHOHG q9 1 r RQ WKH LQVWUXPHQW UHDU SDQHO QILQLLXP RVFLOORVFRSHV RI WKLV FRQILJXUDWLRQ DUH HTXLSSHG ZLW WKH 027 6HULHV 93 PRWKHUERDUG DQG WKH QWHO SURFHVVRU 7KH PRWKHUERDUGpV YROWDJH VHOHFW LV DXWRPDWLF IRU WKH FRUUHFW SURFHVVRU YROWDJH 7KLV PRWKHUERDUG FRQILJXUDWLRQ OLVWV WKH IROORZLQJ PHVVDJH RU VLPLODU DW WXUQ RQ Award Modular BIOS v 6 0PG Copyright VP22 Main Processor Intel Pentium III 1 GH...

Страница 119: ...Infiniium oscilloscope 2 Connect the external keyboard to the rear panel 3 Press the delete key when you see the following prompt on the bottom of the screen Press TAB to Show POST screen DEL to enter SETUP F12 to select boot device 1RWH I RX DUH QRW VHHLQJ WKH SURPSW RU WKH RVFLOORVFRSH GRHV QRW DSSHDU WR EH IXQFWLRQLQJ FKHFN WKH PRWKHUERDUG MXPSHU VHWWLQJ DQG WKH ULEERQ FDEOH FRQQHFWRUV 2WKHUZLV...

Страница 120: ...s the Enter key 2 If you have a power board part number 54855 66502 then perform the following steps Otherwise go to step 7 3 Go to Power Management Setup and press the Enter key 4 Select the PWORN After PWR Fail setting and press the Enter key 5 Select the Off option and press the Enter key 6 Return to the CMOS Setup Utility by pressing the Esc key 7 Press F10 to save and exit the setup Type Y to...

Страница 121: ... it is R W able or not If test fails the speaker will keep beeping 10 Auto detect flash type to load appropriate flash R W codes into the runtime area in F000 for EscD DMI support 12 Use walking 1 s algorithm to check out the interface in CMOS circuitry Set real time clock power status and then check for override 14 Program chipset default values into chipset Chipset default values are MODBINable ...

Страница 122: ...on Auto 6F Initialize floppy controller Set up floppy related fields in 40 hardware 73 Enter AWARDFLASH EXE if found if floppy drive 75 Detect and install all IDE devices Example hard drive LS120 CDROM 77 Detect serial ports and parallel ports 7A Detect and install co processor 7F Switch back to text mode if full screen is supported 82 Call chipset power management hook Recover the text found used...

Страница 123: ...Chapter 5 Troubleshooting Front Panel Debug 5 21 Front Panel Debug Front Panel Debug Follow the keyboard troubleshooting guide for just the power button Go to Primary Trouble Isolation ...

Страница 124: ...ower board from the power supply the power supply should turn on Does power supply fan turn Check ac power cables to power supply No Are cables OK No Replace power supply Yes Reseat or replace bad cable Go to Primary Trouble Isolation Check power supply voltages see procedure Yes Are voltages ON No If voltages are ON but out of spec adjust voltages see procedure Yes Can voltages be adjusted to wit...

Страница 125: ...y adjustment procedure WARNING SHOCK HAZARD The maintenance described in this section is performed with power supplied to the oscilloscope and with the protective covers removed Only trained service personnel who are aware of the hazards involved should perform the maintenance Read the safety summary at the back of this book before proceeding Failure to observe safety precautions may result in ele...

Страница 126: ...F 5 0 V 0 4 2 0 V 0 4 3 3 V 0 4 1 62 V 1 4 98 V to 5 02 V 1 992 V to 2 008 V 3 2868 V to 3 3132 V 1 6038 V to 1 6362 V J8 AVDD12 AVDD1F 1 60 V 3 1 62 V 1 1 552 V to 1 648 V 1 6038 V to 1 6362 V J9 2 5 V 12 VF 12 VF 2 5 V 0 4 12 V 10 12 V 0 4 2 49 V to 2 51 10 8 V to 13 2 V 11 952 V to 12 048 V Power Board Verification Ensure unit is configured as follows Power supply connected to power board Acqui...

Страница 127: ...place bad cable No Ensure cable W17 is connected into the power board and the probe interface board correctly Disconnect other cable from probe interface board W8 Yes Turn unit on Does unit turn ON Replace probe interface board No Make sure connections between probe interface board and AutoProbe board are correct Yes Turn unit on Does unit turn ON Replace AutoProbe board No Go to Primary Trouble I...

Страница 128: ...d assemblies CAUTION CONTAMINATION CAN CAUSE INTERMITTENT OPERATION Be careful not to contaminate the key side of the PC board or the keypads Dust and fingerprints on these parts may cause intermittent key operation 5 Set the cursor keyboard and keyboard assembly on an antistatic electrical insulated surface 6 Connect the cursor keyboard cable to the keyboard assembly Connect the keyboard cable to...

Страница 129: ...3 EULGJH ERDUG DFTXLVLWLRQ FDEOH RU DFTXLVLWLRQ ERDUG 7U WURXEOHVKRRWLQJ WKH DFTXLVLWLRQ V VWHP ILUVW WR YHULI FRUUHFW EHKDYLRU EHIRUH UHSODFLQJ DQ DVVHPEOLHV I WKH YROWDJHV DUH FRUUHFW EXW WKH V GR QRW OLJKW FRUUHFWO UHSODFH WKH NH ERDUG DVVHPEO I RX ILQG D SUREOHP ZLWK WKH UPHG FKHFN SLQ RI ZLWK WKH FDEOH GLVFRQQHFWHG IURP WKH NH ERDUG 7KH YROWDJH VKRXOG EH DV IROORZV 5 0 V 0 5 V when Armed is s...

Страница 130: ...pass Yes Does acquisition interface test group pass Does misc scope test group pass Yes Yes Replace acquisition board Replace the interface board A10 If that does not work replace the display board Does temp sense pass Does fan status pass Check fans Replace fans that are not turning if none are turning replace power board Does NVram tests pass Replace interface card Go to Primary Trouble Isolatio...

Страница 131: ...LQJ WKH FXUUHQW YHUVLRQ QXPEHU IRU WKH VFRSH VRIWZDUH DQG RQ OLQH LQIRUPDWLRQ V VWHP VRIWZDUH 7KLV LQIRUPDWLRQ PD EH XVHIXO ZKHQ FRQWDFWLQJ JLOHQW 7HFKQRORJLHV IRU IXUWKHU VHUYLFH LQIRUPDWLRQ 6HH ILJXUH Figure 5 7 About Infiniium Information Enable the Graphical Interface The graphical interface must be enabled to select this command ...

Страница 132: ...UG Use the table and figure to the right to check the power output at the connectors The 12 V and 12 V supplies come from ripple regulator on the power board and the 3 V and 3 V supplies are developed in three terminal regulators on the probe power control assembly Measure the voltages with respect to the ground terminal on the front panel located near the Aux Out BNC Donotattempttomeasurevoltages...

Страница 133: ...S VLGH RI WKH FRQQHFWRU 7KH YLGHR VLJQDOV DUH SUHVHQW GXULQJ WKH V VWHP ERRW SURFHVV EHIRUH WKH EDFNOLJKWV FRPH RQ I WKH VLJQDOV DUH QRW SUHVHQW VXVSHFW WKH GLVSOD FDUG I WKH VLJQDOV DUH SUHVHQW DQG WKH EDFNOLJKWV DUH RQ VXVSHFW WKH IODW SDQHO GLVSOD DV WKH SUREOHP Table 5 2 Video Signals Figure 5 8 Video Signals Pin Number Signal 1 2 3 3 V 3 5 6 NC 4 7 9 11 15 19 23 27 31 35 38 40 Ground 12 14 16...

Страница 134: ... connector on the side of the board There are two output connectors one at each end of the board top and bottom which power the two backlights inserted into the flat panel display 7KH RXWSXW YROWDJH LV DSSUR LPDWHO 9UPV N PHDVXUHG GLIIHUHQWLDOO EHWZHHQ WKH WZR ZLUHV ZKHQ WKH EDFNOLJKW LV LOOXPLQDWHG 7KH YROWDJH LV DSSUR LPDWHO N9 EHIRUH WKH EDFNOLJKW WXEH LV LOOXPLQDWHG 7KH RXWSXWV DUH FRQWUROOHG ...

Страница 135: ...eyboard and flat panel display assemblies 6 16 To remove and replace the acquisition board assembly 6 19 To remove and replace the power regulator distribution board 6 22 To remove and replace the GPIB interface board 6 23 To remove and replace the PCI bridge board 6 24 To remove and replace the scope interface board and SVGA display board 6 25 To remove and replace the floppy disk drive 6 26 To r...

Страница 136: ...in Torque driver 0 34 Nm 3 in lbs 5 mm or 3 16 in hex drive Torque driver 0 34 Nm 3 in lbs Torx T6 drive CAUTION REMOVE POWER BEFORE REMOVING OR REPLACING ASSEMBLIES Do not remove or replace any circuit board assemblies in this oscilloscope while power is applied The assemblies contain components which may be damaged if the assembly is removed or replaced while power is connected to the oscillosco...

Страница 137: ...dications 2 Remove all accessories from the oscilloscope Accessories include all cables Do not include accessories unless they are associated with the failure symptoms 3 Protect the oscilloscope by wrapping it in plastic or heavy paper 4 Pack the oscilloscope in foam or other shock absorbing material and place it in a strong shipping container You can use the original shipping materials or order m...

Страница 138: ...orx T20 screws that secure the rear feet two in each foot 6 Remove the four Torx T20 screws that secure the top cover to the rear of the chassis 7 Place the unit so the bottom is facing up 8 Remove the eight Torx T10 screws that secure the top and bottom covers to the chassis 9 Place the unit so the top is facing up 10 Carefully slide the top cover off of the frame by pulling the front panel and t...

Страница 139: ... to catch the feet on the chassis 14 To replace the covers reverse the above procedure Be sure to keep ribbon cables out of the way when replacing the covers particularly the flex cable and connector for the AutoProbe assembly at the bottom front of the oscilloscope CAUTION PROPERLY TIGHTEN HANDLE AND SCREWS Tighten the side handle screws to 2 4 Nm 21 in lbs and rear feet screws to 2 Nm 18 in lbs ...

Страница 140: ...force the retainer it should remain attached to the body of the socket 2 Gently pull the flex cable out of the connector Figure 5 3 Disconnecting a Mylar Ribbon Cable To reconnect the cable 1 Ensure that the cable retainer is up then insert the ribbon cable into the socket making sure to observe polarity of the cable with respect to the connector 2 Push the ends of the retainer down onto the conne...

Страница 141: ...rs by doing the following a Place the unit so the bottom is facing up b Locate the access hole on the inside of the front panel assembly which is below and almost between channel 2 and channel 3 BNC connectors c From the back of the front panel put a small screw driver or other slender pointed object through the access hole to push the AutoProbe assembly faceplate away from the front panel assembl...

Страница 142: ...y 6 8 d Disconnect the mylar flex cable W8 from the AutoProbe board See To disconnect and connect Mylar flex cables in this chapter Figure 5 7 Pushing Out the AutoProbe Faceplate 3 To replace the AutoProbe assembly reverse the above procedure Disconnect mylar flexcableW8here ...

Страница 143: ... assembly to the AutoProbe assembly The connector must be unlocked before you can remove the flex cable See To disconnect and connect Mylar flex cables in this chapter 3 Disconnect the mylar flex cable W17 from the probe power and control assembly Figure 5 8 Remove the Probe Power and Control Assembly 4 Remove the two Torx T10 screws securing the probe power and control assembly to the chassis 5 L...

Страница 144: ...cedure When inserting the assembly be sure the two tabs on the circuit board engage the two slots in the sheet metal Also be sure to carefully lock in the connector for the mylar flex cable when reattaching the cable See To disconnect and reconnect mylar flex cables in this chapter Figure 5 9 Probe Power and Control Assembly Tab Tab Probe Power and Control Board ...

Страница 145: ...al procedures Figure 5 10 Backlight Inverter Board WARNING SHOCK HAZARD The backlight inverter assembly which is mounted at the front corner of the oscilloscope near the flat panel display operates at a high voltageof 1 3 kV acrms DO NOT handle this assembly while it is in operation 1 Disconnect the power cable and remove the top and bottom covers Backlight Inverter Board ...

Страница 146: ... board 4 Remove the two Torx T10 screws that secure the backlight inverter board to the chassis Figure 5 11 Removing the Backlight Inverter Board 5 Lift the backlight inverter board out through the top of the chassis 6 To replace the backlight inverter board reverse the assembly procedure Avoid Interference You may need to use a Torx key or stubby Torx driver to avoid interference with other parts...

Страница 147: ...Figure 5 12 Removing the BNC Nuts 4 Remove the power supply spring cover from the left side of the chassis 5 Using a 5 16 open end wrench disconnect the Aux Out semi rigid cable from the rear of the front panel 6 Disconnect the probe comp wire from the acquisition board If necessary use pliers to remove the probe comp wire 7 Remove the Torx T10 screw that secures the front frame to the chassis Fig...

Страница 148: ...cting W21 Backlight Primary Cable W11 Display Driver Cable and W12 Keyboard Cable 9 Remove the four Torx T15 screws that secure the chassis sides to the front panel assembly Figure 5 15 Front Panel Side Screws Top edge front panel Backlight primary cable W21 Keyboard cable W12 Flat panel display driver cable W11 Power supply supportbracket Pull front panel away from chassis T15 screws T15 screws T...

Страница 149: ...careful to feed the ribbon cables W16and W20 out throughtheslot in the front of the chassisand not todamage the backlight invertor board 12 To replace the front panel assembly reverse the above procedure Ensure that you observe polarity designations when reconnecting the ribbon cables Replacing the BNC hex nuts When assembling the hex nuts to secure the BNC connectors to the front panel put the co...

Страница 150: ... panel cover plate to the front casting Figure 5 16 Front Panel Cover Plate Screws 4 Carefully feed the front panel keyboard cable W12 and the flat panel display driver cable W11 through the cable access hole while separating the front panel cover plate from the front casting Keep Long Screws Separate for Re assembly Thefourscrewsthatfastenthekeyboardtothefrontpanelplatearelongerthanthosearoundthe...

Страница 151: ...e backlight inverter board see previous figure b Remove the three Torx T10 screws securing the display to the cover plate 7 To remove the cursor keyboard and flat lens a Remove the display spring Note orientation of spring for reassembly b Remove the four Torx T10 screws that secure the corners of the lens bracket c Carefully remove the lens You can lift the cursor keyboard directly out of the fro...

Страница 152: ... Make sure lens gasket is positioned correctly Inspect the inside surfaces of the Lens Glass and the Display Monitor closely for dust smudges and finger prints Viewing these with line of sight 45 degrees to the surface is the best method for seeing subtle faults Clean the inside surfaces with glass cleaner and lint free lens paper before re assembly Clean the front of the FPD monitor by applying t...

Страница 153: ...ving the BNC Nuts 4 Remove the power supply spring cover 5 Using 1 4 and 5 16 open end wrenches disconnect the semi rigid Aux Out cable between the bottom of the acquisition board and the main part of the cable Hold the 1 4 wrench stationary while turning the 5 16 wrench 6 Disconnect the following cables from the acquisition board Line sync cable W5 Acquisition cable W3 10 MHz Ref SMB cable Trig O...

Страница 154: ...0 Figure 5 20 Removing Cables and Screws Torx T10 4 Power Distribution Board 10 MHz Ref SMB Cable Acquisition Cable W3 Acquisition Board Torx T10 16 in heat sinks Power Supply Spring Cover Line Sync Cable W5 Aux Out Cable Probe Comp Wire Torx T10 4 Trig Out SMB Cable Aux Trig In SMB Cable ...

Страница 155: ...is Figure 5 21 Separate Acquisition Board from Power Distribution Board 11 To re install the acquisition board assembly reverse the above procedure Replacing the heat sink screws When replacing the heat sink screws start all screws but do not torque them For each heat sink torque 2 diagonally opposed screws first and then torque the other 2 screws to 5 in lb Replacing the BNC hex nuts When assembl...

Страница 156: ...wer supply cables part of W4 from the top side of the chassis Fan harness cable W19 on the top side of the chassis Fan harness cable W19 on the bottom side of the chassis Mylar flex probe power cable W17 4 Remove the four Torx T10 screws from the power regulator distribution board 5 Lift the board out of the chassis 6 To re install reverse this procedure Figure 5 22 Removing the Power Regulator Di...

Страница 157: ...er cable and remove the top cover 2 Remove the Torx T15 screw that secures the GPIB board to the rear of the chassis 3 Pull the board up to disengage it from the motherboard then lift up and out of the chassis CAUTION BE CAREFUL NOT TO SNAG THE DISPLAY CABLE W11 4 To replace the board reverse the removal procedure Figure 5 23 Removing the GPIB Interface Board T15 screw GPIB Board Display Cable W11...

Страница 158: ...nect these cables from the A21 PCI bridge board Motherboard switch cable W7 Acquisition cable W3 Keyboard cable W12 3 Remove the Torx T15 screw that secures the cord to the chassis 4 Pull the board up to disengage it from the motherboard 5 To replace the interface board reverse the above procedure Figure 5 24 Removing the PCI Bridge Board T15 Screw PCIBridge Board Keyboard Cable W12 Acquisition Ca...

Страница 159: ...face and SVGA display boards to the chassis These screws are at the rear of the chassis Figure 5 25 Removing the Scope Interface and SVGA Display Boards 4 Grasp the scope interface board at the top corners and pull the board straight up until it is free of the card cage 5 Grasp the SVGA display board at the top corners and pull the board straight up until it is free of the card cage 6 To replace t...

Страница 160: ...r 2 Disconnect mylar flex cable W23 at the rear of the floppy disk drive 3 Using a T8 driver remove the two side screws holding the floppy disk drive in place 4 Slide the floppy disk drive through the front frame and remove Figure 5 26 Removing the Floppy Disk Drive Screws 5 To replace the floppy disk drive reverse the above procedure with a new disk drive Torx T8 Floppy DIsk Drive Floppy Drive My...

Страница 161: ...rear of the CD ROM drive Figure 5 27 Removing the Cables CAUTION DO NOT LET THE DISK DRIVE FALL Support the drive while removing the screws so that the drive does not fall 3 Remove the two top T20 Torx screws holding the shock mount in place If the oscilloscope has option 017 removeable hard disk drive installed then there is no internal hard disk drive You may need to use a Torx key to loosen the...

Страница 162: ...e the four T10 Torx screws holding the disk drive onto the shock mount 6 To replace the hard disk reverse the above procedure with a new hard drive CAUTION DO NOT OVER TIGHTEN THE SCREWS Do not overtighten the T10 screws that secure the Internal Hard Disk Drive to the bracket Torque to 3 in lbs Reinstalling the internal hard drive 1 Make sure the assembly is inserted into the center slots of the l...

Страница 163: ...e 3 Remove the Torx T10 screw securing the block to the CD ROM support rail 4 Remove the Torx T20 screw securing the CD ROM support bracket to the rear chassis 5 Slide the CD ROM assembly inwards towards the front frame then lift up and remove Figure 5 29 Removing the CD ROM Drive 6 Remove the two Torx T6 screws securing the CD ROM drive to the support rail and one screw securing the CD ROM drive ...

Страница 164: ...6 Replacing Assemblies To remove and replace the CD ROM drive 6 30 8 Remove the CD ROM Adapter Board from the rear of the CD ROM drive 9 To replace the CD ROM drive reverse the above procedure with a new drive ...

Страница 165: ...d remove the top and bottom covers 2 Remove the CD ROM drive 3 Disconnect the following cables See Figure 5 30 Mylar flex cable W23 from floppy disk drive Motherboard power supply cable W4 Motherboard switch cable W7 Display ribbon cable W11 Keyboard cable W12 Acquisition cable W3 Backlight primary cable W21 Figure 5 30 Removing the Cables Acquisition Cable W3 Motherboard Power Supply Cable W4 Dis...

Страница 166: ...5 31 6 Remove all PCI cards from the motherboard 7 Remove the 8 T10 screws holding the motherboard to the chassis 8 Remove the 6 port lock screws holding the port connectors to the chassis Figure 5 31 Removing the Motherboard Screws IDE Cable and PCI Cards 9 To replace the motherboard assembly reverse the above procedure 10 BIOS settings 11 Run the self test to verify the oscilloscope is operating...

Страница 167: ... charge on some capacitors This charge could remain for many days after removing power from the supply 1 Disconnect the power cable and remove the top cover 2 Remove the floppy disk drive 3 Remove the motherboard subassembly 4 Remove the power supply spring cover 5 Disconnect the cables from the front of the supply Figure 5 32 Disconnecting Power Supply Cables Red wire Green wire Yellow wire Brown...

Страница 168: ... T10 screws that secure the support bracket to the front chassis 8 If you do not have option 017 removeable hard disk drive follow the instructions for removing the hard disk drive found earlier in this chapter If youhaveoption017installed remove thefourT15screwsinthe sideofthepowersupply See Figure 5 33 9 Separate the main power input cable from the power supply cable to the power supply ...

Страница 169: ...gure 5 33 Removing Hard Disk Support Bracket and Power Supply Power supply cable Mainpower input cable Press retaining latches to release Power supply Support bracket T10 screws Mounting bracket Hard disk drive T15 screws T15 screw T15 screws 4 Without option 017 With option 017 ...

Страница 170: ...Chapter 6 Replacing Assemblies To remove and replace the power supply 6 36 10 Lift the supply up and out of the chassis 11 To replace the supply reverse the installation procedure ...

Страница 171: ... board One cable is on the top of the chassis and one cable is on the bottom of the chassis 3 Remove the fan bracket securing the fan to the chassis Figure 5 34 Removing Fan Fasteners CAUTION AVOID OVERHEATING THE oscilloscope When replacing the fan be sure the direction of the fan air flow is coming from the inside to the outside of the oscilloscope Check the flow arrows on the fan and check for ...

Страница 172: ...6 38 ...

Страница 173: ...placeable Parts 7 2 Listed Parts 7 2 Unlisted Parts 7 2 Direct Mail Order System 7 2 Exchange Assemblies 7 2 Power Cables and Plug Configurations 7 3 Exploded Views 7 5 Replaceable Parts List 7 10 Replaceable Parts ...

Страница 174: ...gilent Technologies Sales Office when the orders require billing and invoicing Prepaid transportation There is a small handling charge for each order No invoices In order for Agilent Technologies to provide these advantages please send a check or money order with each order Mail order forms and specific ordering information are available through your local Agilent Technologies Sales Office Address...

Страница 175: ...lor Country Opt 900 250V 8120 1703 90 90 228 Mint Gray United Kingdom Cyprus Nigeria Zimbabwe Singapore Opt 901 250V 8120 0696 90 87 221 Mint Gray Australia New Zealand Opt 902 250V 8120 1692 90 79 200 Mint Gray East and West Europe Saudi Arabia So Africa India unpolarized in many nations Opt 903 125V 8120 1521 90 90 228 Jade Gray United States Canada Mexico Philippines Taiwan Opt 919 250V 8120 67...

Страница 176: ...t 927 8120 8871 90 Thailand Part number shown for plug is industry identifier for plug only Number shown for cable is Agilent Technologies part number for complete cable including plug These cords are included in the CSA certification approval of the equipment E Earth Ground L Line N Neutral Plug Type Cable Part No Plug Description Length in cm Color Country ...

Страница 177: ...Chapter 7 Replaceable Parts Exploded Views 7 5 Exploded Views Front Frame and Front Panel ...

Страница 178: ...Chapter 7 Replaceable Parts Exploded Views 7 6 Fan and Acquisition Assembly ...

Страница 179: ...Chapter 7 Replaceable Parts Exploded Views 7 7 Power Supply and PC Motherboard without option 017 ...

Страница 180: ...Chapter 7 Replaceable Parts Exploded Views 7 8 Power Supply and PC Motherboard with option 017 ...

Страница 181: ...Chapter 7 Replaceable Parts Exploded Views 7 9 Sleeve and Accessory Pouch ...

Страница 182: ... are generally those that take the physical wear and tear of use Internal parts in several categories Each category is in alphanumeric order by reference designation Replacing these parts generally requires opening the cabinet The information given for each part consists of the following Reference designation Agilent Technologies part number Total quantity QTY in instrument or on assembly The tota...

Страница 183: ... 47411 1 KNOB 18 MM PINK MP21 54801 47407 1 KNOB 12 MM PINK MP22 54801 47401 2 KNOB 12 MM GRAY MP24 54855 94303 1 AUTO PROBE LABEL MP26 54855 94302 1 FRONT PANEL 4CH LABEL MP28 54853 94301 1 LOGO LABEL 54853A Infiniium 2 5 GHz 20GSa s MP28 54854 94301 1 LOGO LABEL 54854A Infiniium 4 GHz 20GSa s MP28 54855 94301 1 LOGO LABEL 54855A Infiniium 6 GHz 20GSa s MP31 54810 68701 1 ACCESSORY POUCH MP32 504...

Страница 184: ...810 61616 1 CDROM AUDIO CABLE All Configurations A9 54810 66506 1 PROBE INTERFACE BOARD A10 54810 66529 1 WAVEFORM DISPLAY BOARD A11 54810 66525 1 DISPLAY BOARD A12 82350BI 1 PCI GPIB BOARD A15 54810 66511 1 AUTO PROBE I F A17 54810 66507 1 KEYBOARD CURSOR A18 54855 66506 1 KEYBOARD 4CH A21 54855 66510 1 PCI BRIDGE BOARD Fans B1 3160 4134 6 12 V FAN Internal Chassis Parts H1 0515 2219 3 MACHINE SC...

Страница 185: ...ACKET STIFFENER MP25 54801 09101 1 SPRING STEEL MP27 54855 41901 1 KEYPAD 4CH MP29 54810 41902 1 CURSOR KEYPAD MP30 54801 01206 1 CAL BNC BRACKET MP33 54810 04104 1 SLEEVE TOP MP39 1520 0238 4 GROMET NOT ON OPTION 017 MP41 54810 03703 1 CD SUPPORT RAIL STOP MP42 1400 3242 1 CABLE CLAMP MP43 54832 09102 1 DISPLAY SPRING MP44 54832 09103 1 POWER SUPPLY SPRING COVER MP45 54810 42203 4 GROMMET 9x38 MP...

Страница 186: ...LE W20 54801 61626 1 KEYBOARD INTERCONNECT W21 54810 61605 1 BACKLIGHT POWER CABLE W22 54801 61624 1 DISPLAY JUMPER CABLE W23 54855 61610 1 FLOPPY DRIVE CABLE W24 54855 61618 2 AUX TRIG OUT CABLE W25 01680 61625 1 IDE HARD DISK DRIVE CABLE W26 54855 61622 1 REMOVABLE HARD DISK POWER CABLE Replaceable Parts Ref Des Agilent Part Number QTY Description ...

Страница 187: ...8 Block Level Theory 8 3 Acquisition Theory 8 5 Theory of Operation ...

Страница 188: ...oard Power Supply PCI BUS Acquisition PCI Bridge Main Keyboard Cursor Keyboard Carefree Probe Board Autoprobe I F 6 Fans Scope Interface Display Board Flat Panel Display Backlight Driver 4 chan analog in external trig in trig out probe comp aux out on off switch Power Board GPIB on off switch ...

Страница 189: ...hbuttons for major oscilloscope functions An 8 4 inch diagonal color flat panel display for waveform measurement and graphical interface display A 3 1 2 inch flexible disk drive BNC connectors for channel input signals auxiliary trigger input and auxiliary output AutoProbe interface for probe power and probe control A connection for probe compensation The rear panel provides several connections Th...

Страница 190: ...ata Management ASIC Trigger Chip Logic Trigger Clocks Interpolator FPGA PCI Bridge ADC Temps PCI BUS External Trigger 256Kb NVRAM CH4 Trig in Preamp 20 Gs s ADC Data Management ASIC CH3 Preamp 20 Gs s ADC Data Management ASIC CH2 Preamp 20 Gs s ADC Data Management ASIC CH1 Ribbon Connector 32MB SDRAM 32MB SDRAM 32MB SDRAM Aux out ...

Страница 191: ...evice on the PCI bus connected with an 80 pin ribbon cable through the PCI bridge board Power is delivered to the acquisition board from the Power Board The power board is common to all three oscilloscope models and is responsible for regulating the bulk supply to the various voltages needed by the acquisition board The power board mates to the acquisition board with six 51 pin board to board conn...

Страница 192: ...8 6 ...

Страница 193: ...at the ground protection is impaired you must make the instrument inoperative and secure it against any unintended operation Service instructions are for trained service personnel To avoid dangerous electric shock do not perform any service unless qualified to do so Do not attempt internal service or adjustment unless another per son capable of rendering first aid and resuscitation is present Do n...

Страница 194: ... material contained in this document is provided as is and is subject to being changed without notice in future editions Further to the maximum extent permitted by applica ble law Agilent disclaims all warranties either express or implied with regard to this manual and any information contained herein including but not lim ited to the implied warran ties of merchantability and fitness for a partic...

Отзывы:

Нет отзывов