background image

Ć

Filter Components Cleaning

2.

Machine Body Cleaning

Sensor

3.

Wash and maintenance

On/off

Mode

Odor sensor

Clean/Change

Timer

Running mode

Fan Speed

Lock

Dust sensor

Mute

Low  High

Turbo

Auto

Sleep

Anion

Odor

Dedust filter

Dust sensor

Odor sensor

W a s h   a n d   m a i n t e n a n c e

1.

Use a vacuum cleaner to remove the dust on the detection port surface of smell sensor and dust sensor.

,QRUGHUWRPDLQWDLQWKHEHVWVWDWHPDFKLQHVVKRXOGEHFOHDQHGUHJXODUO\

'XULQJWKHFOHDQSURFHVVPDFKLQHVVKRXOGEHXQSOXJQRWLQZHWKDQGVZKLFKPD\

FDXVHHOHFWULFVKRFNDQGLQMXULHV

Dirt on the main frames and desks where the main frames are placed should be 
clean as often as possible.
After a long time, dirt would be difficult to remove.
• Use soft fabric
  Use a dry soft fabric to remove stubborn dirt.
• No volatile substance
  Petrol, thinner and abstergent would cause damage to machines.
• No detergent
  Chemical composition in the detergent would cause damage to machines.
• No water spraying
  Shell and other things should not be flushed or washed.

When the “cleaning” light on the screen of a machine shines, filter components 
should be cleaned.
• Use a vacuum cleaner first, then use water to wash the components.
• If the components are very dirty, use neutral household detergent, or after using 
  the vacuum cleaner, use a cleaning rag or a soft-hair brush, then use water to wash 
  until no residuum is left.
• After cleaning, fix the filter components again. Press the mode button for 5 
  seconds in the holding state, time remark would be zero cleaning, and the 
  “cleaning” light would turn off.

AIR PURIFIER

Summary of Contents for SP-300A

Page 1: ...USER S MANUAL SP 300A AIR PURIFIER ...

Page 2: ... to meet customers requirements the company is entitled to make appropriate changes on the product specifications And the users will not be informed Please understand The applicable area is the impact area when the machine is running at high speed Model P K G P PP NJ SP 300A 9 Turbo 396 W h 245 D h 576 H 4QFDJGJDBUJPOT Fan Speed Air Flow Power Noise Dimension High L o w Mute Maximum Cleaning area ...

Page 3: ...please use the return and collection systems or contact the retailer where the product was purchased They can take this product for environmental safe recycling Product Introduction Attentions Contents Master Operation Parts function Remote Control Operation Disassembly method Maintenance instructions 1 3 2 7 9 5 4 8 10 12 11 Thoubleshooting 14 Welcome to buy SINCLAIR air purifier please keep this...

Page 4: ... out formaldehyde It has unique functions of adsorption and catalytic decomposition It can catalyse and decompose hazardous substances especially absorb them HEPA high efficient filter It can 99 efficiently filtrate floating particles of 0 3 micron above bacteria dead mites dust particles etc and fast refresh the indoor air The conductive carbon can efficiently adsorb harmful gases The conductive ...

Page 5: ...e remove the dust on the plug periodically Fouling can cause humid and then leakage which will cause fire electric shock or other accidents If it is not used for a long time the plug must be pulled out Otherwise insulation degradation will cause electric shock leakage fire or other accidents Please do not insert fingers or other objects at inlet scoop and air outlet Otherwise it may cause electric...

Page 6: ...n Do not put the machine in places where the curtains can touch the inlet scoop and air outlet Otherwise it may cause fire electric shock or injury Please contact Special Service Center ofSinclair electrical product to repair Air purifier can not remove carbon monoxide Do not reconstruct by yourself Do not demolish and repair if you are not the technicians Take the battery out before it loses effe...

Page 7: ... carbon Host display screen Air inlet Remote control On off Mode Odor sensor Clean Change Timer Running mode Fan Speed Lock Dust sensor Mute Low High Turbo Auto Sleep Anion Odor Dedust filter Indicator light Remote control receiver window Dust sensor Odor sensor On Off button Mode button 1 Parts name Host computer parts Host computer parts Host computer display 2 AIR PURIFIER ...

Page 8: ...ted carbon filter screen It can adsorb most smell and remove the ammonia acetic acid and other harmful gases in the air Parts function Functional description of various parts and components Back 2 The main ingredients of cotton filter is as cold catalyst also known as the cold catalyst filter It can effectively collect some dust catalyze and decompose part of the odor HIMOP HEPA filter component h...

Page 9: ...resh the air 14ǃPower Cord It supplies power for the machine and it has access to single phase 220 240V 50Hz AC 15ǃOdor sensor It can sense the different smell of cigarettes and pets and it also very sensitive to pesticides cosmetics aerosols alcohol and other odor or sudden changes in temperature and humidity 16ǃFan speed indicator Different indicator shines corresponding to different fan speed 1...

Page 10: ...nd you can remove the panel Use hands to hold the handle pull forward and remove the dust frame components Take the HIMOP grid out Pull the handles pull it out and take the HIMOP grid out upward when the sound click is heard Remove the activated carbon filter Install the machine in a reverse order Do not scratch the surface when remove the front panel Take care of the protruding part on the back i...

Page 11: ...me dirt would be difficult to remove Use soft fabric Use a dry soft fabric to remove stubborn dirt No volatile substance Petrol thinner and abstergent would cause damage to machines No detergent Chemical composition in the detergent would cause damage to machines No water spraying Shell and other things should not be flushed or washed When the cleaning light on the screen of a machine shines filte...

Page 12: ... HEPAfilter component 4 After HIMOP HEPA filter component is replaced all the indicators shines at the same time and the change light on the screen goes out after the tick sound 5 The life of activated carbon filter is about 2 3 years When there is odor please remove the activated carbon filter and place it in the sunlight for 3 5 hours and then put it back If the odor still exists please replace ...

Page 13: ...dentally swallow the battery you should quickly get in touch with the doctor Before the battery is discarded please use the tape etc wrap it at both ends of positive and negative poles to prevent mixing with other metals or batteries and causing fever rupture fire and so on When the battery is not used any longer please put it into battery recycling place at the nearest electrical shop watch or ca...

Page 14: ... there too much dust on the filter components filter cotton and HIMOP HEPA filter components Is there too much odor and smoke produced Remove obstacles Clean the filters and replace filter cotton Clean activated carbon filters The TV signal is in interference Are there any TV radio within 2 meters away from the machine or is there any indoor antennas near the machine Are there any power cords or t...

Page 15: ...ing off the plastic packaging of the cotton filter and HIMOP HEPA filter components put them into the HIMOP grid Open the battery cover on the back of the remote control place the battery in the circular tank pay attention to positive and negative poles plug back the remote control and then it can be used Please put the remote control pointing to the receiver window in operation The remote control...

Page 16: ... will be in this mode The plasma opens and the fan will run at the highest speed When it is in running state click the button the machine will be in this mode The negative ion opens and the fan will run at low speed You can change the fan speed through the speed button When it is in running state click the button The machine automatically adjust mute fan speed or low speed according to air quality...

Page 17: ...accidental power failure when the power is on again When the remote control is not around you can use buttons at the central top of the machine to operate the machine The buttons at both ends respectively control on off and mode switching of the machine Press the Mode button every time you press it the machine switches according to the following sequence The indicator will shine as the mode set No...

Page 18: ...nd you can remove the panel Use hands to hold the handle pull forward and remove the dust frame components Take the HIMOP grid out Pull the handles pull it out and take the HIMOP grid out upward when the sound click is heard Remove the activated carbon filter Install the machine in a reverse order Do not scratch the surface when remove the front panel Take care of the protruding part on the back i...

Page 19: ...me dirt would be difficult to remove Use soft fabric Use a dry soft fabric to remove stubborn dirt No volatile substance Petrol thinner and abstergent would cause damage to machines No detergent Chemical composition in the detergent would cause damage to machines No water spraying Shell and other things should not be flushed or washed When the cleaning light on the screen of a machine shines filte...

Page 20: ... HEPAfilter component 4 After HIMOP HEPA filter component is replaced all the indicators shines at the same time and the change light on the screen goes out after the tick sound 5 The life of activated carbon filter is about 2 3 years When there is odor please remove the activated carbon filter and place it in the sunlight for 3 5 hours and then put it back If the odor still exists please replace ...

Page 21: ...dentally swallow the battery you should quickly get in touch with the doctor Before the battery is discarded please use the tape etc wrap it at both ends of positive and negative poles to prevent mixing with other metals or batteries and causing fever rupture fire and so on When the battery is not used any longer please put it into battery recycling place at the nearest electrical shop watch or ca...

Page 22: ... there too much dust on the filter components filter cotton and HIMOP HEPA filter components Is there too much odor and smoke produced Remove obstacles Clean the filters and replace filter cotton Clean activated carbon filters The TV signal is in interference Are there any TV radio within 2 meters away from the machine or is there any indoor antennas near the machine Are there any power cords or t...

Reviews: