Siemens SIMATIC HMI OP 73micro Operating Instructions Manual Download Page 22

Page: 22 / 188

Safety instructions and general notes

2.3 Notes about usage

OP 73micro, TP 177micro (WinCC flexible)

Operating Instructions, 09/2007, 6AV6691-1DF01-0AB0

●

A label with the following warning must be attached to the inside of the switch

cabinet/cubing at a place that is clearly visible upon opening:

7KLVZDUQLQJGRHVQRWKDYHWREHWDNHQLQWRFRQVLGHUDWLRQ

LI\RXDUHDZDUHWKDWWKHUHLVQRH[SORVLRQKD]DUG

7KHFRQWUROFDELQHWHQFORVXUHLVRQO\DOORZHG

WREHRSHQIRUDVKRUWWLPHHJJUDSKLFGLDJQRVWLFV

,QWKHPHDQWLPH\RXDUHQRWDOORZHGWRSUHVVDVZLWFKSXOORULQVHUW

PRGXOHVDQGGLVFRQQHFWDQ\HOHFWULFOLQHVFRQQHFWRUV

:DUQLQJ

List of approved HMI devices

The list of approved HMI devices is available on the Internet under:
"

http://www4.ad.siemens.de/view/cs

under article ID 13702947.

Further information

The "HMI device in potentially explosive atmospheres of Zone 2 and Zone 22" flyer is part of

the package and must be complied with.

Maintenance

Defective HMI devices must be returned to the manufacturer for repair. Repair may only be

carried out by the manufacturer at his site.
Location of the manufacturer:
Siemens AG

Automation & Drives

Werner-von-Siemens-Straße 50

92224 Amberg

Germany

Approval

Note
HMI devices with approval to II 3 G EEx nA II T4 may only be used on SIMATIC systems of

device category 3.

Summary of Contents for SIMATIC HMI OP 73micro

Page 1: ...oduction Overview 1 Safety instructions and general notes 2 Planning use 3 Mounting and connection 4 Operator control components and LEDs 5 Configuring the operating system 6 Preparing and backing up a project 7 Operating a project 8 Operating alarms 9 Maintenance and servicing 10 Specifications 11 Appendix A Abbreviations B SIMATIC HMI HMI device OP 73micro TP 177micro WinCC flexible Operating In...

Page 2: ...ntation Commissioning and operation of a device system may only be performed by qualified personnel Within the context of the safety notes in this documentation qualified persons are defined as persons who are authorized to commission ground and label devices systems and circuits in accordance with established safety practices and standards Prescribed Usage Note the following WARNING This device m...

Page 3: ...e section Safety instructions and general notes carefully The help integrated in WinCC flexible the WinCC flexible Information System contains detailed information The Information System contains instructions examples and reference information in electronic form Basic knowledge required General knowledge of automation technology and process communication is needed to understand the operating instr...

Page 4: ...e project on a PC WinCC flexible Migration Describes how to convert an existing ProTool project to WinCC flexible Describes how to convert an existing WinCC project to WinCC flexible Describes how to convert an existing ProTool project including a change of the HMI device e g from OP7 to OP 77B or OP7 to OP 77B Describes how to convert an existing ProTool project including a change from a graphics...

Page 5: ...rtal html_00 techdoku htm SIMATIC Guide for Technical Documentation in English http www ad siemens de simatic portal html_76 techdoku htm Conventions Configuration and runtime software differ with regard to their names as follows WinCC flexible 2004 for example refers to the configuration software The term WinCC flexible is used in a general context The full name for example WinCC flexible 2004 is...

Page 6: ...t http www siemens com automation partner Training center Siemens AG offers a variety of training courses in order to familiarize you with automation systems Please contact your regional training center or the central training center in D 90327 Nuremberg Germany Phone 49 911 895 3200 Internet http www sitrain com Service support on the Internet Service Support offers online services for additional...

Page 7: ...nditions 25 3 Planning use 27 3 1 Mounting information 27 3 2 Mounting the OP 73micro 30 3 2 1 Mounting positions and fixation 30 3 2 2 Preparing for mounting 31 3 3 Mounting the TP 177micro 33 3 3 1 Mounting positions and fixation 33 3 3 2 Preparing for mounting 35 3 4 Information on insulation tests protection class and degree of protection 37 3 5 Nominal voltages 38 4 Mounting and connection 39...

Page 8: ...perator control components and indicators on the OP 73micro 69 5 2 Front side operator control components and LEDs on the TP 177micro 70 6 Configuring the operating system 71 6 1 Configuring the operating system for the OP 73micro 71 6 1 1 Overview 71 6 1 2 Info Settings menu 72 6 1 2 1 Overview 72 6 1 2 2 Setting screen contrast 74 6 1 2 3 Displaying information about the HMI device 74 6 1 2 4 Vi...

Page 9: ...anumerical Values 107 8 1 3 3 Entering and editing symbolic values 110 8 1 3 4 Entering and modifying date and time 111 8 1 3 5 Viewing infotext 112 8 1 4 Project security 113 8 1 5 Close the project 114 8 2 Operating a project on TP 177micro 115 8 2 1 Overview 115 8 2 2 Setting the project language 116 8 2 3 Entries and help within a project 117 8 2 3 1 Overview 117 8 2 3 2 Entering and editing n...

Page 10: ...cations 141 11 1 Dimensional drawings 141 11 1 1 Dimensional drawings OP 73micro 141 11 1 2 Dimensional drawings TP 177micro 142 11 2 Specifications 143 11 2 1 Specifications of the OP 73micro 143 11 2 2 Specifications of the TP 177micro 144 11 3 Description of interfaces 146 11 3 1 Power supply 146 11 3 2 RS485 IF 1B on OP 73micro 146 11 3 3 RS 485 IF 1B on TP 177micro 147 A Appendix 149 A 1 ESD ...

Page 11: ...hort configuration and commissioning times and their configuration in WinCC flexible form highlights of these panels In addition the panels support up to 32 configuration languages and five online languages including the Asian and Cyrillic character sets The mounting dimensions of the Operator Panel OP 73micro with its graphical 3 display unit are compatible with OP3 and TD200 Touch Panel TP 177mi...

Page 12: ...TP 177micro WinCC flexible 12 Operating Instructions 09 2007 6AV6691 1DF01 0AB0 1 2 Design of the OP 73micro HMI device Views of the HMI device 1 2 3 4 Figure 1 1 Front and side view Display Membrane keyboard Clamping recess Mounting seal Figure 1 2 Bottom view ...

Page 13: ...Front view and side view Construction related opening not a slot for a memory card Mounting seal Display Touch screen Clamping recess Figure 1 4 Bottom view 1 4 Accessories Accessory kit The accessory kit contains the following A terminal block for the power supply Four mounting clamps for installing a TP 177micro Two mounting clamps for installing an OP 73 Additional documents may be enclosed wit...

Page 14: ...cro Note The specified values are maximum values of the individual objects Simultaneous use of multiple objects with their maximum value can lead to problems in the active project Alarms Table 1 1 Range of functions for alarms Object Specification OP 73micro TP 177micro Number of discrete alarms 250 500 Number of analog alarms 5 20 Length of the alarm text 80 characters 80 characters Number of tag...

Page 15: ...t Linear Scaling Input Output Yes Yes Text lists Number 150 150 Screens Table 1 3 Range of functions for screens Object Specification OP 73micro TP 177micro Number 250 250 Fields per screen 20 20 Tags per screen 20 20 Complex objects per screen e g bars 5 5 Screen Template Yes Yes Infotext Table 1 4 Range of functions for infotext Object Specification OP 73micro TP 177micro Length no of characters...

Page 16: ...ect Number 2500 500 Password protection Number of passwords 1 1 1 7 Communication with PLCs Number of connections Interconnection OP 73micro TP 177micro Number for MPI PROFIBUS DP 1 1 Siemens PLCs The following table shows the Siemens PLCs and protocols or profiles that can be used PLC Protocol profile OP 73micro TP 177micro S7 200 MPI1 yes yes 1 If you require a baud rate of 9 6 Kbps use the DP p...

Page 17: ... and for personnel who have received instruction or are authorized Danger high voltage Opening the cabinet will expose high voltage parts Contact with these parts could be fatal Switch off the power supply to the cabinet before opening it Hazardous areas When operating the HMI device in hazardous areas the following warning applies WARNING Explosion Hazard Do not disconnect while circuit is live u...

Page 18: ...ing EC directives and conforms to the harmonized European standards EN for programmable logic controllers published in the official gazettes of the European Union 89 336 EEC Electromagnetic Compatibility EMC guideline 94 9 EG Equipment and protective systems intended for use in potentially explosive atmospheres ATEX EC declaration of conformity The EC declarations of conformity are kept available ...

Page 19: ... for use in Class I Division 2 Group A B C D or Class I Zone 2 Group IIC or non hazardous locations FM Approval FM APPROVED Factory Mutual Research FM conforming to Approval Standard Class Number 3611 3600 3810 Approved for use in Class I Division 2 Group A B C D T4 Class I Zone 2 Group IIC T4 Ex approval In compliance with EN 50021 Electrical apparatus for potentially explosive atmospheres Type o...

Page 20: ... conforming to EN 55011 for RF interference Suitable measures to achieve Limit Class B for suppression of radio interference include Installation of the HMI device in a grounded control cabinet Use of filters in electrical supply lines Use in potentially explosive atmosphere Zone 2 DANGER Risk of explosion Operate the HMI device only in a Zone 2 potentially explosive atmosphere if it has been iden...

Page 21: ...acturer s declaration for Zone 2 conforming to EN 50021 Special conditions for operation in potentially explosive atmospheres of Zone 2 In situations where the temperature on the cable or at the cable inlet of this enclosure exceeds 70 C is or the temperature on the wire branching point exceeds 80 C under operating conditions the properties of the cables used must ensure that these can withstand t...

Page 22: ...KSXOO RU LQVHUW PRGXOHV DQG GLVFRQQHFW DQ HOHFWULF OLQHV FRQQHFWRUV DUQLQJ List of approved HMI devices The list of approved HMI devices is available on the Internet under http www4 ad siemens de view cs under article ID 13702947 Further information The HMI device in potentially explosive atmospheres of Zone 2 and Zone 22 flyer is part of the package and must be complied with Maintenance Defective...

Page 23: ...to pulse shaped interference A requirement for this is that the HMI device meets the specifications and directives regarding electrical installation Table 2 1 Pulse shaped interference Pulse shaped interference Tested with Corresponds to test intensity Electrostatic discharge conforming to IEC 61000 4 2 Air discharge 8 kV Contact discharge 4 kV 3 Burst pulses high speed transient interference conf...

Page 24: ... 3 conforming to IEC 61000 4 3 10 V m with 80 amplitude modulation of 1 kHz in the range from 80 MHz to 1 GHz and 1 4 GHz to 2 GHz 10 V m with 50 pulse modulation at 900 MHz 10 V m with 50 pulse modulation at 1 89 GHz 3 RF interference current on cables and cable shielding conforming to IEC 61000 4 6 Test voltage 10 V with 80 amplitude modulation of 1 kHz in the range from 9 kHz to 80 MHz 3 Emissi...

Page 25: ...0 C to 60 C Atmospheric pressure from 1080 hPa to 660 hPa corresponds to an elevation of 1000 m to 3500 m Relative humidity from 10 to 90 without condensation Sinusoidal vibration conforming to IEC 60068 2 6 5 Hz to 9 Hz 3 5 mm 9 Hz to 150 Hz 9 8 m s2 Shock conforming to IEC 60068 2 29 250 m s2 6 ms 1000 shocks NOTICE Ensure that no condensation dewing develops on or inside the HMI device after tr...

Page 26: ...Safety instructions and general notes 2 5 Transport and storage conditions OP 73micro TP 177micro WinCC flexible 26 Operating Instructions 09 2007 6AV6691 1DF01 0AB0 ...

Page 27: ...l measures In locations with a high degree of ionizing radiation In locations with extreme operating conditions resulting from situations as follows Corrosive vapors gases oils or chemicals Electrical or magnetic fields of high intensity In plants requiring special monitoring features for example Elevator systems Systems in especially hazardous rooms Mechanical ambient conditions The mechanical am...

Page 28: ... type and scope of the check of mechanical ambient conditions Table 3 2 Check of mechanical ambient conditions The check includes Test standard Remarks Vibrations Vibration test conforming to IEC 60068 part 2 6 sinusoidal Type of vibration Transitional rate of the frequency 1 octave minute 10 f 58 Constant amplitude 0 075 mm 58 f 150 Constant acceleration 1 g Vibration duration 10 frequency cycles...

Page 29: ...s Temperature Vertical mounting Inclined mounting from 0 C to 50 C from 0 C to 40 C See the Mounting positions and type of fixation section Relative humidity 10 to 90 Without condensation corresponds to a relative humidity stress class 2 conforming to IEC 61131 part 2 Atmospheric pressure 1080 hPa to 795 hPa Corresponds to an elevation of 1000 to 2000 m Pollutant concentration SO2 0 5 ppm relative...

Page 30: ... the general term cabinet The HMI device is self ventilated and approved for vertical and inclined mounting in stationary cabinets Figure 3 1 Approved deviations from the vertical mounting position of the OP 73micro without auxiliary ventilation Mounting position Deviation from the vertical Inclined 80 Vertical 0 Inclined 80 CAUTION Impermissible ambient temperatures Do not operate the HMI device ...

Page 31: ...bjected to direct sunlight Position the HMI device to provide an ergonomic position for the operator and select a suitable mounting height Ensure that the air vents are not covered as a result of the mounting Observe the permissible mounting positions for the HMI device Preparing the mounting cut out The degrees of protection are only guaranteed when the following is observed Material thickness at...

Page 32: ...B0 Maintaining clearances The HMI device must be installed with sufficient clearance 50 50 15 15 Figure 3 4 Clearance around the OP 73micro At least 10 mm clearance is required at the rear NOTICE Ensure that the maximum ambient temperature is not exceeded when mounting the device in a cabinet and especially in a closed enclosure ...

Page 33: ... mounting options are referred to by the general term cabinet The HMI device is self ventilated and approved for vertical and inclined mounting in stationary cabinets Figure 3 5 Permitted mounting positions Mounting position Deviation from the vertical Inclined 35 Vertical 0 Inclined 35 CAUTION Impermissible ambient temperatures Do not operate the HMI device without auxiliary ventilation if the ma...

Page 34: ...zontally the cable inlets are located at the bottom Vertical mounting When mounted vertically the cable inlets are on the right Type of fixation Spring clamps are provided for mounting the device Hook the clamps into the recesses of the HMI device The overall HMI device dimensions are not exceeded by this 1 2 Figure 3 6 View of a mounting clamp Hook Recessed head screw ...

Page 35: ...uitable mounting height Ensure that the air vents are not covered as a result of the mounting Observe the permissible mounting positions for the HMI device Preparing the mounting cut out The degrees of protection are only guaranteed when the following is observed Material thickness at the mounting cut out 2 mm to 6 mm The deviation from plane for the panel cut out is 0 5 mm This condition must be ...

Page 36: ...g clearances The following clearance is required around the HMI device in order to its ensure self ventilation Figure 3 8 Clearance around the HMI device At least 10 mm clearance is required at the rear NOTICE Ensure that the maximum ambient temperature is not exceeded when mounting the device in a cabinet and especially in a closed enclosure ...

Page 37: ...Class I conforming to IEC 60536 i e grounding conductor to profile rail required Protection from foreign objects and water Degree of protection conforming to IEC 60529 Explanation Front panel Rear panel IP65 in mounted state IP20 protection against contact with standard test probes There is no protection against ingress by water The degree of protection provided by the front side can only be guara...

Page 38: ...le 38 Operating Instructions 09 2007 6AV6691 1DF01 0AB0 3 5 Nominal voltages The following table shows the permitted nominal voltage and the corresponding tolerance range Table 3 5 Permitted nominal voltages Nominal voltage Tolerance range 24 V DC 20 4 V to 28 8 V 15 20 ...

Page 39: ...ct your Siemens representative Keep the supplied documentation in a safe place The documentation belongs to the HMI device and is required for subsequent commissioning 4 2 Mounting and connecting the OP 73micro 4 2 1 Mounting the HMI device Requirements Two mounting clamps from the accessories are required for installation The mounting seal must be available on the HMI device If the mounting seal ...

Page 40: ...and then fasten the clamps Figure 4 1 Insert the mounting clamp on the OP 73micro 4 Tighten the clamps by screwing down the recessed head screw permitted torque 0 15 N m NOTICE Check the fit of the mounting seal on the front The mounting seal must not protrude from the HMI device Otherwise repeat steps 1 to 4 4 2 2 Connecting the HMI device Requirements The HMI device must be mounted according to ...

Page 41: ...e that you do not bend any of the contact pins Secure the connectors with screws Always use shielded data cable Always use standard cables For further information refer to the SIMATIC HMI Catalog ST 80 The pin assignment of the interfaces is described in the specifications See also Safety instructions Page 17 4 2 2 1 Interfaces The figure below shows the interfaces of the HMI device Figure 4 2 Int...

Page 42: ...ines with shielding connected to the grounding protective conductor on both sides the impedance of the additionally installed equipotential bonding cables may not exceed 10 of the shielding impedance The cross section of a selected equipotential bonding conductor must be capable of handling the maximum equalizing current The best results for equipotential bonding between two cabinets were achieved...

Page 43: ...7 2 6 5 4 Figure 4 3 Installing the equipotential circuit Chassis ground terminal on the HMI device example Equipotential bonding conductor cross section 4 mm2 Cabinet Equipotential bonding conductor cross section min 16 mm2 Ground terminal Cable clamp Voltage bus Parallel routing of the equipotential bonding conductor and data cable See also Electromagnetic compatibility Page 23 ...

Page 44: ...Note when connecting NOTICE Always use the approved cables to connect a SIMATIC S7 PLC Standard cables are available for the connection For further information refer to the SIMATIC HMI Catalog ST 80 See also Communication via a point to point connection Page 57 Communication in the network Page 58 Interfaces Page 41 4 2 2 4 Connecting the configuration computer Wiring diagram The figure below illu...

Page 45: ...nnecting The power terminal block is included in the assembly kit and is designed for conductors with a maximum cross section of 1 5 mm2 Connecting the terminal block NOTICE Damage Pressure on the screwdriver may damage the HMI device socket if the terminal block is plugged in when you tighten the screws Always remove the terminal block to connect the wires 1 DC 24 V Figure 4 7 Connecting the term...

Page 46: ...ithin the specified range to prevent malfunctions on the HMI device Equipotential bonding Therefore wire the 24 V output of the power supply to the equipotential circuit See also Interfaces Page 41 4 2 3 Switching on power and testing the HMI device Procedure Switching on power and testing the HMI device Proceed as follows 1 Plug the terminal block into the HMI device 2 Switch on the power supply ...

Page 47: ...Use the relevant operator control object to close the project Further information on this may be available in your plant documentation Navigating in the Loader Button Action or TAB Press one of these cursor keys to select the next entry in arrow direction ENTER The input is confirmed The submenu or dialog shown below opens ESC HELP Move back Returns to the next higher menu layer Cancel transfer mo...

Page 48: ...nting seal is part of the associated service pack Mounting NOTICE Always mount the HMI device according to the instructions in this manual Proceed as follows 1 Check that the mounting seal is fitted on the HMI device Do not install the mounting seal turned inside out This may cause leaks in the mounting cut out 2 Insert the HMI device into the mounting cut out from the front 3 Insert the mounting ...

Page 49: ...ollowing sequence 1 Equipotential bonding 2 Power supply Perform a power up test to ensure that the correct polarity of the supply voltage 3 PLC configuration computer as necessary NOTICE Connection sequence Always follow the correct sequence for connecting the HMI device Failure to do so may result in damage to the HMI device Connecting the cables When connecting the cables ensure that you do not...

Page 50: ...485 interface IF 1B See also Power supply Page 146 RS 485 IF 1B on TP 177micro Page 147 4 3 2 2 Connecting the equipotential bonding circuit Potential differences Differences in potential between spatially separated system parts can lead to high equalizing currents over the data cables and therefore to the destruction of their interfaces This situation may arise if the cable shielding is terminate...

Page 51: ... selected equipotential bonding conductor must be capable of handling the maximum equalizing current The best results for equipotential bonding between two cabinets were achieved with a minimum conductor cross section of 16 mm2 Use equipotential bonding conductors made of copper or galvanized steel Establish a large surface contact between the equipotential bonding conductors and the grounding pro...

Page 52: ... Wiring diagram 1 3 3 8 7 2 6 5 4 Figure 4 13 Installing the equipotential circuit Chassis ground terminal on the HMI device example Equipotential bonding conductor cross section 4 mm2 Cabinet Equipotential bonding conductor cross section min 16 mm2 Ground terminal Cable clamp Voltage bus Parallel routing of the equipotential bonding conductor and data cable ...

Page 53: ...on Note when connecting NOTICE Always use the approved cables to connect a SIMATIC S7 PLC Standard cables are available for the connection For further information refer to the SIMATIC HMI Catalog ST 80 See also Communication via a point to point connection Page 57 Communication in the network Page 58 Interfaces Page 50 4 3 2 4 Connecting the configuration computer Wiring diagram The figure below i...

Page 54: ...ed for conductors with a maximum cross section of 1 5 mm2 Connecting the terminal block NOTICE Damage Pressure on the screwdriver may damage the HMI device socket if the terminal block is plugged in when you tighten the screws Always remove the terminal block to connect the wires 1 DC 24 V Figure 4 17 Connecting the terminal block Connect the power supply cables to the terminal block as shown in t...

Page 55: ...age must always be within the specified range to prevent malfunctions on the HMI device Equipotential bonding Therefore wire the 24 V output of the power supply to the equipotential circuit See also Interfaces Page 50 4 3 3 Switching on power and testing the HMI device Procedure Proceed as follows 1 Plug the terminal block into the HMI device 2 Switch on the power supply The display lights up afte...

Page 56: ...ing the system a project may already be loaded on the HMI device The system then skips Transfer mode and starts the project Use the relevant operator control object to close the project Further information on this may be available in your plant documentation Function test Perform a function test following commissioning The HMI device is fully functional when one of the following states is indicate...

Page 57: ...n using WinCC flexible 4 4 1 Topologies Introduction The HMI device and PLC can communicate using a PtP connection or within a network The HMI device can communicate only with one S7 200 at a time 4 4 1 1 Communication via a point to point connection In a PtP connection the HMI device is the only device which is connected directly with the S7 200 You need an MPI cable or a PROFIBUS bus cable with ...

Page 58: ...onnector to install a network The HMI device always operates as master station The HMI device can communicate only with one S7 200 within the network S7 200 as active or passive node The S7 200 station may be operated on the network in master mode PPI master mode and in slave mode PPI slave mode The default setting of the S7 200 station is PPI slave mode The OP 73micro and TP 177micro can communic...

Page 59: ... 0AB0 59 Several HMI devices on one S7 200 An S7 200 PLC supports the connection of up to three HMI devices per CPU interface The DP interface of a CPU215 2DP supports the connection of up to five HMI devices Configuration example Figure 4 22 Three HMI devices on one S7 200 See also Connecting the PLC Page 44 Connecting the PLC Page 53 ...

Page 60: ...st end nodes of a PROFIBUS MPI network only one can be an HMI device No other HMI devices should be connected to the network as terminal nodes The RS485 PROFIBUS terminal and the PROFIBUS connector are equipped with a switch for setting the terminating resistor Meaning of the ON and OFF switch settings OFF The terminating resistor is disabled i e the bus segment is not terminated ON The terminatin...

Page 61: ...een of the HMI device From the Communications driver column of the working area select the value SIMATIC S7 200 Then system automatically writes the default values of the protocol parameters to the properties dialog You can now customize the protocol parameters of your configuration Figure 4 23 Creating an S7 200 connection Device specific parameters Set the network parameters for the HMI device u...

Page 62: ...ice Profile Set MPI here Select DP if you need a baud rate of 9 6 Kbps Highest station address Set the highest station address The highest station address must be equal to or higher than the highest actual address The setting must be identical throughout the network Number of masters Set the number of masters operating in the network HMI devices must be operated in master mode The S7 200 may be op...

Page 63: ...ntroller user data areas In the case of the OP 73micro and TP 177micro the user data area serves for transmitting the date and time from the PLC to the HMI device User data areas are set up when you create the project in the project window in WinCC flexible of the HMI device by selecting Communication Connections in the Area pointers work area Physically the user data area is in the PLC 4 4 3 2 Pe...

Page 64: ...edure To configure the address of the area pointer select Communication Connection then select Area pointer Figure 4 24 Creating an area pointer Connection Name of the connection Name Default name of the area pointer set by WinCC flexible Address Enter the tag address of the area pointer In the PLC here Length The default length of the area pointer is set by WinCC flexible Acquisition cycle Here d...

Page 65: ...for the date time area pointer because this will have a negative influence on HMI device performance Recommendation Acquisition cycle of 1 minute if the process allows this The HMI device time has a resolution of seconds regardless of the acquisition cycle The date time data area has the following structure DATE_AND_TIME format in BCD code Most significant byte Least significant byte Data word 7 0...

Page 66: ...are made for acknowledgments Acknowledgment on the HMI device Acknowledgment by the PLC Acknowledgment by the PLC Acknowledgment of error alarms by the PLC requires the Write acknowledgment tag function to be configured When Write acknowledgment tag is set in the PLC the system automatically acknowledges the corresponding error alarm This function is identical to the acknowledgment function on the...

Page 67: ...nowledged an alarm In order to generate a signal transition each time the acknowledgment bit is set the HMI device initially resets the corresponding Read acknowledgment tag bit when an error alarm bit is set There is a certain time based offset between these two operations due to the processing time of the HMI device The figure below shows the pulse diagram 1HZ HUURU DODUP FNQRZOHGJP YLD 0 GHYLFH...

Page 68: ...Mounting and connection 4 4 Communication with S7 200 OP 73micro TP 177micro WinCC flexible 68 Operating Instructions 09 2007 6AV6691 1DF01 0AB0 ...

Page 69: ...groups Soft keys F1 to F4 The soft keys can only be assigned within a project and do not have any function in the Loader menu System keys These include the control keys for example NOTICE Unintentional actions Unwanted actions may be triggered if the operator unintentionally actuates several keys at once Never press more than two keys simultaneously Keyboard damage Operation of the keys with hard ...

Page 70: ...screen All operator control objects required for operator input are displayed on the touch screen once the HMI device has started NOTICE Unintentional actions Never touch more than one point on the display Never touch more than one touch object at a time otherwise you may trigger unintentional actions Damaging the touch screen The use of with hard sharp or pointed items or applying excessive press...

Page 71: ...u commands have the following functions Transfer Select this menu command to set the HMI device transfer mode Start Select this menu command to start the project which is stored on the HMI device Info Settings Select this menu command to open the HMI device configuration menu The Loader also appears when you close the project Navigating in the Loader Button Action or TAB By pressing one of these b...

Page 72: ...confirmed the selected list entry with ENTER See also Switching on power and testing the HMI device Page 46 6 1 2 Info Settings menu 6 1 2 1 Overview Requirements Info Settings was called in the Loader Info Settings menu Info Settings Device Info Contrast Logon Settings Version Info Figure 6 2 Info Settings menu Contrast Menu command for setting the display contrast Device Info Menu command with i...

Page 73: ...ands When a password is assigned the following dialog appears when the user attempts to open the Logon Settings menu Password Figure 6 3 Password dialog You need to enter the password again to access the Logon Settings menu after you closed the previous session NOTICE Password no longer available If the Loader password is no longer available you can only call the Logon Settings menu again after yo...

Page 74: ...trast can be increased and reduced within a wide range Note that this may lead to the screen content becoming unrecognizable under unfavorable lighting conditions reduces the contrast and TAB increases the contrast 6 1 2 3 Displaying information about the HMI device Requirements Info Settings Device Info was selected from the Loader menu Principle Figure 6 5 Device Info dialog This dialog is used ...

Page 75: ...image file and therefore the version of the operating system This information is required when you contact A D Technical Support 6 1 3 Settings menu 6 1 3 1 Overview Requirement Info Settings Logon Settings was selected from the Loader menu You have entered the password for the Settings menu Settings menu Settings Startup Delay Screensaver Figure 6 7 Settings menu Startup Delay Menu command for se...

Page 76: ...defines the period which the HMI device automatically delays the startup of a stored project When the value 0 is set the project starts immediately It is then no longer possible to call the Loader after switching on the HMI device To handle this situation you must have configured an operator control object you can use to close the project Valid range of values 0 s to 60 s 6 1 3 3 Setting the scree...

Page 77: ...and editing passwords Proceed as follows 1 Enter the password Select the first character with TAB or Press INS to enter additional characters Note Password entry The last character of the password entered is shown in plain text The remaining characters are represented by a character 2 Press ENTER You have now completed entry of the password The Confirm Password dialog appears Confirm Password Figu...

Page 78: ...he Settings menu opens The Settings menu is password protected Procedure Deleting a password Proceed as follows 1 Press ENTER do not enter any other characters The Confirmation dialog opens 2 Press ENTER do not enter any other characters The system confirms the deletion Result The Settings menu opens You have revoked the password protection of the Settings menu See also Overview Page 72 ...

Page 79: ...s was selected from the Loader menu Transfer Settings Channel1 Serial Figure 6 12 Transfer Settings menu Procedure 1 Press ENTER The Channel1 Serial dialog opens Channel 1 serial Value Enable Figure 6 13 Channel1 Serial dialog This dialog is used to configure the RS495 port for serial data transfer 1 Select the relevant setting using the TAB and cursor keys Disable Serial data transfer is disabled...

Page 80: ...ntrol Panel to open the HMI device Control Panel The Control Panel is used to configure various settings such as the transfer settings The Loader also appears when you close the project Password protecting the Control Panel You can protect the Control Panel from unauthorized access You can read the settings in the Control Panel without entering a password but you cannot edit all settings This prev...

Page 81: ...rol Panel using the HMI device Loader The following options are available to open the Loader The Loader appears briefly after starting the HMI device During runtime If configured touch the relevant operator control object to stop the project The Loader is displayed Further information on this may be available in your plant documentation Touch the Control Panel button in the Loader to open the HMI ...

Page 82: ...input field or check box and use the displayed screen keyboard if necessary Enter the required password if the Control Panel is protected against unauthorized access Change the HMI device settings in the Control Panel Close the Control Panel Touch the button 4 Start the project using the Loader 6 2 2 2 Changing screen settings Requirements The OP icon on the Control Panel has been touched Procedur...

Page 83: ...e interval in seconds which expires between the appearance of the Loader and start of the project When the value 0 is set the project starts immediately It is then no longer possible to call the Loader after switching on the HMI device To handle this situation you need to configure an operator control object with Close project function The valid value range is 0 s to 60 s 5 Close the dialog and sa...

Page 84: ...tab 1 2 3 4 5 Figure 6 17 OP Properties dialog Device tab example HMI device name Version of the HMI device image Version of the boot loader Boot loader release date The Flash memory is used to store the HMI device image and project data 2 The Device tab is used to display specific HMI device information There are no input options This information is required when you contact A D Technical Support...

Page 85: ...ating errors as a result calibrate the screen again in the startup phase or during runtime Requirements The OP icon on the Control Panel has been touched Procedure Proceed as follows 1 Open the OP Properties dialog then select the Touch tab 1 2 Figure 6 18 OP Properties dialog Touch tab If the HMI device does not react precisely to a touch the touch screen may require calibration Button for calibr...

Page 86: ... password Proceed as follows 1 Enter a password in the Password input field Touch the input field The alphanumerical screen keyboard is displayed 2 Repeat the password entry in the Confirm Password input field 3 Close the dialog with NOTICE The password may not contain space characters or the special characters Result The Control Panel is protected from unauthorized access Without entering a passw...

Page 87: ...r automatic activation of the screen saver on the HMI device The screen saver is automatically activated if the HMI device is not operated within the specified period of time The screen saver stops in the following situations When you touch the touch screen A message is displayed Requirements The Screen Saver dialog has been opened with the Screen Saver icon Figure 6 20 Screen saver dialog Procedu...

Page 88: ... channel you can protect the HMI device from unintentional overwriting of project data and of the HMI device image Requirements You have touched the Transfer icon on the Control Panel The Transfer Settings dialog is displayed 1 Figure 6 21 Transfer Settings dialog This dialog is used to configure the RS495 port for serial data transfer Group for data channel 1 Channel 1 Procedure Enable the Channe...

Page 89: ...rocesses The HMI device project which includes the plant screens is created during the configuration phase Once the project is transferred to the HMI device and the HMI device is connected to a PLC in the automation system processes can be operated and monitored in the process management phase RQQHFWLRQ WR WKH 3 7UDQVIHU WKH SURMHFW 3 7HVW WKH SURMHFW 6LPXODWH WKH SURMHFW 6DYH WKH SURMHFW 0 GHYLFH...

Page 90: ...n updated When recommissioning any project on the HMI device is replaced 7 1 1 Setting the operating mode Operating modes Operating modes of the HMI device Offline Online Transfer Offline mode and Online mode can be set on the configuration computer and on the HMI device To set these modes on the HMI device use a corresponding operator control object of the project Changing the operating mode The ...

Page 91: ...ng cases are possible 1 Reusing projects on OP 73micro Existing OP3 projects can be reused on OP 73micro Migrate the OP3 project to WinCC flexible compact standard advanced into an OP 73 project then replace your HMI device with the OP 73micro 2 Reusing existing projects on TP 177micro TP 170A project available in ProTool Migrate the TP 170A project to WinCC flexible compact standard advanced and ...

Page 92: ...es Yes Updating the operating system Serial No No Serial with reset to factory setting No No Transfer of a project Serial Yes Yes 1 Applies to complete restore 2 Applies to restoring the password list Serial transmission You can use one of the following adapters for the serial transmission to the configuration PC RS 232 PPI cable MM Multimaster USB PPI cable MM Multimaster as of manufacturer versi...

Page 93: ...n the HMI device 2 Proceed as follows on the configuration computer Select the Project Transfer Transfer Settings menu command in WinCC flexible Select the HMI device and define the parameters for the connection Start the download with Transfer The configuration computer verifies its connection to the HMI device If the connection is not available or is faulty the configuration computer outputs an ...

Page 94: ...Check the screen structure 3 Check the input objects 4 Enter the tag values The test increases the certainty that the project will run error free on the HMI device Requirements for the offline test The project has been transferred to the HMI device The HMI device is in Offline mode Procedure In Offline mode you can test the various project functions on the HMI device without them being affected by...

Page 95: ...internal Flash memory can be backed up and restored Project and HMI device image Password list Backup and restoring can be performed in the following ways WinCC flexible ProSave General notes NOTICE Power failure If an operation for restoring data is interrupted due to power failure on the HMI device the operating system of the HMI device may be deleted The operating system then has to be updated ...

Page 96: ...I device operating system is corrupt and you can therefore can no longer run the Loader of the HMI device Use the Reset to factor state check box in ProSave to determine the restoring procedure 7 3 3 Backup and Restore via WinCC flexible Introduction Backup and restore operations transfer the relevant data between flash memory on the HMI device and a configuration computer Requirement The HMI devi...

Page 97: ...ring with reset to factory setting only Switch off power to the HMI device 2 Select the menu command Project Transfer Communication Settings in WinCC flexible on the configuration computer The Communication Settings dialog opens 3 Select the HMI device type 4 Set the connection parameters 5 Close the dialog with OK 6 In WinCC flexible select the menu command Project Transfer Restore The Restore Se...

Page 98: ... ProSave is installed Only for restoring the password list or when backing up the data The data channel is configured on the HMI device Procedure backup Proceed as follows 1 From the Windows Start menu run ProSave on the PC 2 Select the HMI device type from the General tab 3 Set the connection parameters in the General tab 4 Use the Backup tab to select the relevant data 5 Select a destination fol...

Page 99: ...red from the Restore tab The tool outputs a message showing the HMI device for which the backup copy was created and the type of backup data contained in this file 6 To restore the password list Set Transfer mode on the HMI device 7 Start the restore operation in ProSave with Start Restore Follow the instructions in ProSave A status view opens to indicate the progress of the operation Result The t...

Page 100: ...ity conflict may occur when transferring a project to the HMI device This is caused by different versions of the engineering software and the HMI device image The configuration computer cancels the transfer and triggers an alarm to indicate a compatibility conflict You must update the operating system of the HMI device NOTICE Data loss An operating system update deletes all data such as projects a...

Page 101: ...alog with OK 6 In WinCC flexible select the menu command Project Transfer Update operating system 7 In Image path select the folder which contains the HMI device image file img The HMI device image files are available under WinCC flexible Images in the WinCC flexible installation folder and on the corresponding WinCC flexible installation CD 8 Select Open In the output area you are provided inform...

Page 102: ... parameters 5 Select the OS Update tab 6 In Image path select the folder which contains the HMI device image file img The HMI device image file is available on the corresponding WinCC flexible installation CD 7 Select Open In the output area you are provided information on the version of the HMI device image file after it is opened 8 On the PC select Update OS to run the operating system update Fo...

Page 103: ... be assigned either a global or a local function The local function takes priority over the global setting Soft keys with local function assignment A soft key with local function assignment is screen specific and is therefore only effective within the active screen The function assigned to a soft key can vary from screen to screen Operation with key combinations Unwanted actions may be triggered i...

Page 104: ...ey Viewing infotext SHIFT ESC HELP Opens a window containing infotext on the selected object You can press ENTER to toggle between infotext for a screen and an object for example for an IO field Cancel action ESC HELP Undo You can undo your input as long you have not yet confirmed it with ENTER Close the alarm window if configured Cancel the output of infotext to return to the previous view Acknow...

Page 105: ...ages at any time Language specific objects are immediately output to the screen in the relevant language when you switch languages The following options are available for switching the language 1 A configured operator control object switches from one project language to the next in a list 2 A configured operator control directly sets the desired project language Further information on this may be ...

Page 106: ...o indicate any violation of set limits of the input value for example 80 exceeds the set limit value of 78 The value entered is rejected The original value is displayed again Decimal places for numerical values If a numerical input field is configured for a specific number of decimal points decimal places in excess of the limit are ignored Empty decimal places are filled with 0 after the number is...

Page 107: ...ges the sign of a numerical value Press SHIFT to toggle between the two characters SHIFT This toggles between upper and lower case letters TAB or All characters available in the extended character set are called in succession ENTER Validates the input ESC HELP Deletes the entry Restores the original value Options of entering numerical and alphanumerical characters Enters value and thereby fully re...

Page 108: ...wing applies for further entries Press TAB to enter letters Upper and lower case letters are indicated first followed by the special characters and numbers To toggle between an upper and a lower case letter press SHIFT Press to enter numbers The list opens with various special characters and continues with the numbers Press or TAB to view the next value if you already entered a value Procedure del...

Page 109: ...or position Example for numerical input Activate the the input box The following table shows the keys you need to press to enter 12 34 Key Instruction Display ENTER Press 1 x to begin input DEL Press 5 x to move the marking five positions to the left Keep pressing until appears INS Press 1 x to move the marking one position to the right TAB Keep pressing until 1 appears INS Press 1 x to move the m...

Page 110: ... SHIFT INS Press both keys 1 x simultaneously to create a space character 2 3 INS Press 1 x to move the marking one position to the right 2 3 Keep pressing until 7 appears 2 3 INS Press 1 x to move the marking one position to the right 2 3 Keep pressing until 3 appears 2 3 ENTER Press 1 x to end input 3 2 8 1 3 3 Entering and editing symbolic values Requirements A symbolic IO field has been with S...

Page 111: ... an entry with TAB or 3 Save or cancel the entry 8 1 3 4 Entering and modifying date and time Requirements A date time input field has been enabled with SHIFT TAB or using the cursor keys Entering the date and time Use numerical and alphanumerical values to set the date and time Note When entering the date and time please note that the format is determined by the configured project language See al...

Page 112: ...ext is available for a screen object the help indicator is displayed as soon as the cursor is placed over the screen object If there is no infotext for the selected operator control object or the active screen the help indicator is hidden Procedure To view an infotext on the HMI device press SHIFT ESC HELP There are two viewing options If the cursor is positioned in a field for which infotext has ...

Page 113: ... press INS and select the character with or TAB 4 When the password is completed enable the OK button with SHIFT TAB and press ENTER Select Cancel to cancel the operation You can use the protected control objects after you completed the logon The Logon dialog can be set up by the configuration engineer via an individual operator control object In the same way the configuration engineer can set up ...

Page 114: ...tings changes to the password list are overwritten when the project is transferred again Backup and restore You can backup the password and restore it using ProSave or WinCC flexible NOTICE On restoring the currently valid password is overwritten The restored password is immediately valid 8 1 5 Close the project Procedure Proceed as follows 1 Use the corresponding operator control object to close ...

Page 115: ...ch more than one object on the screen Never touch more than one touch object at a time otherwise you may trigger unintentional actions CAUTION Do not use any pointed or sharp objects when operating the touch screen in order to avoid damage to its plastic screen membrane Operation feedback The HMI device provides optical feedback when it detects the operation of a touch object This feedback is inde...

Page 116: ...ltilingual projects You need to configure a corresponding operator control object which lets you change the language setting on the HMI device during runtime The project always starts with the language set in the previous session Requirements The relevant project language must be available on the HMI device The language changeover function must be logically linked to a configured operator control ...

Page 117: ...m the entry Screen keyboard When you touch an input object such as an IO field on the HMI device touch screen a screen keyboard appears This screen keyboard is also shown when it is necessary to enter a password to access protected functions The keyboard is automatically hidden again when input is complete Based on the configuration of the input object the system opens a screen keyboard for enteri...

Page 118: ...points decimal places in excess of the limit are ignored Empty decimal places are filled with 0 after the number is confirmed Alphanumerical values Alphanumerical values numbers and letters can be entered character by character using the alphanumerical screen keyboard Symbolic values Symbolic values are entered from a list of predefined entries using the symbolic screen keyboard Date and time You ...

Page 119: ... Enter the value again Use the and keys to move the cursor within the current value You can now edit the characters of the current value or add characters Use the key to delete the character to the left of the cursor Use the key to change the sign of the value Select to view the infotext of the IO field This button is only enabled if infotext has been configured for the IO fields 3 Select to confi...

Page 120: ...lightly from that shown in the figure above Keyboard layers The alphanumerical keyboard is organized in several layers Standard layer Shift layer Procedure You can enter numerical values character by character using the alphanumerical screen keyboard Proceed as follows 1 Touch the relevant IO field on the screen The alphanumerical screen keyboard opens and displays the current value 2 Set the valu...

Page 121: ...on is only enabled if infotext has been configured for the IO fields 3 Select to confirm your entries or cancel them with Both actions close the screen keyboard 8 2 3 4 Entering and editing symbolic values Symbolic screen keyboard When you touch a symbolic IO field on the HMI device touch screen the symbolic screen keyboard appears The keyboard is automatically hidden again when input is complete ...

Page 122: ... in the selection list by touching the entry Move the cursor to an entry in the selection list using the or keys Select to view the infotext of the symbolic IO field This button is only enabled if infotext has been configured for the symbolic IO field 3 Select to confirm your entries or cancel them with Both actions close the screen keyboard 8 2 3 5 Entering and modifying date and time Entering th...

Page 123: ...to be entered in an IO field for example Figure 8 7 Infotext for an IO field example Infotext for input objects Touch the key on the screen keyboard This key is only enabled if infotext has been configured for the input object Infotext for the current screen The configuration engineer can also provide infotext for screens However the infotext for the current screen is called up by an operator cont...

Page 124: ...ect to log off After logging off objects assigned password protection can no longer be operated to do so log on again Further information on this may be available in your plant documentation Logoff time A user logoff timeout can be set in the system If the time between any two user actions e g entering a value or changing screens exceeds this logoff time the user is automatically logged off The us...

Page 125: ... Trend View 8 2 6 1 Overview Trends Trends continuously display the current process data Trend View Trends are displayed in the Trend view A Trend view can display up to four trends simultaneously The figure below shows an example of a Trend view Ruler Trend value in the value table The appearance axes value range and labels of the Trend view can be set by the configuration engineer The configurat...

Page 126: ...ruler is available to provide an exact reading of the individual values The position of the ruler can be changed by touching and dragging it on the touch screen The configuration engineer can configure the following actions for operator controls outside the Trend display Display or hide ruler Move ruler forward Move ruler backward Further information on this may be available in your plant document...

Page 127: ...n the system in the process or on the HMI device itself A status is reported when it is received An alarm could trigger one of the following alarm events Activate Deactivate Acknowledge The configuration engineer defines which alarms must be acknowledged by the user An alarm may contain the following information Date Time Alarm text Location of fault Status Alarm class Alarm number Acknowledgement...

Page 128: ...tation Alarm buffer Alarm events are saved to an internal volatile buffer The size of this alarm buffer depends on the HMI device type 9 2 Operating alarms on the OP 73micro 9 2 1 Displaying alarms Alarm view and alarm window Alarms are indicated in the alarm view or in the alarm window on the HMI device 156 12 05 49 Alarm Engine 23 too hot Figure 9 1 Alarm view 12584 34541 45238 156 12 05 49 Alar...

Page 129: ... the next or previous alarm from the alarm view Alarm class layout The various alarm classes are identified in order to distinguish between them in the alarm view Symbol Alarm class Error empty Warning depending on the configuration User defined alarm classes System The configuration engineer can edit the alarm class symbols Additional information on this may be available in your plant documentati...

Page 130: ...ch off unit 4 close by pass stop valve 2 open pipes 12 and 53 disconnect main linkage start cooling unit 23 and acknowledge buttom ACK 3 Press or TAB to view the full alarm text 4 Press ESC HELP This closes the alarm text window Alarm indicator The alarm indicator is a graphic symbol that shows alarms to be acknowledged The following figure shows the alarm indicator The alarm indicator flashes as ...

Page 131: ...or keys 2 Press ACK Result The alarm or all alarms of the corresponding acknowledgement group are acknowledged You may find additional information about acknowledgment groups in your plant documentation See also Displaying alarms Page 128 9 2 3 Editing an Alarm Introduction The configuration engineer can assign additional functions to each alarm These functions are executed when the alarm is proce...

Page 132: ...Operating alarms on the TP 177micro 9 3 1 Displaying alarms Alarm view and alarm window Alarms are indicated in the alarm view or in the alarm window on the HMI device The layout and operation of the alarm window correspond to that of the alarm view The alarm window is independent of the process screen Depending on the configuration the alarm window appears automatically as soon as a new unacknowl...

Page 133: ...e in the alarm view Close the alarm text window with Selects the next or previous alarm from the list Scrolls one page up or down Alarm class representation The various alarm classes are identified in order to distinguish between them in the alarm view Symbol Alarm class Error empty Warning depends on the configuration User defined alarm classes System The configuration engineer can edit the alarm...

Page 134: ... be executed when the alarm indicator is touched Usually the alarm indicator is only used for error alarms Further information on this may be available in your plant documentation 9 3 2 Acknowledging an Alarm Requirements The alarm to be acknowledged is shown in the alarm window or in the alarm view Either the alarm window or the alarm view is enabled The alarm must be acknowledged Procedure Proce...

Page 135: ... Requirements The alarm to be edited is indicated in the alarm window or in the alarm view Either the alarm window or the alarm view is enabled Procedure Proceed as follows to edit an alarm 1 Select the alarm by touching it in the alarm view or alarm window 2 Touch Result The system executes the additional functions of the alarm Further information on this may be available in your plant documentat...

Page 136: ...Operating alarms 9 3 Operating alarms on the TP 177micro OP 73micro TP 177micro WinCC flexible 136 Operating Instructions 09 2007 6AV6691 1DF01 0AB0 ...

Page 137: ...Preparation CAUTION Faulty operation Always switch off the HMI device before cleaning it This will ensure that you do not trigger unintended functions when you touch the keys Use a cloth dampened with a cleaning agent to clean the equipment Only use water with a little liquid soap or a screen cleaning foam Procedure Never spray the cleaning agent directly onto the HMI device Apply it to a cloth Ne...

Page 138: ...ys open the Cleaning Screen or switch off the HMI device before you clean the touch screen while the system is running Pay attention to the end of the operating lock by the Cleaning Screen function Ignoring this instruction may lead to inadvertent wrong operation 10 1 2 Protective membrane Protective membrane A protective membrane is available for the HMI device touch screens The relevant ordering...

Page 139: ...parts Repairs A defective device must be returned to the manufacturer s site for repair The HMI device may only be repaired at the manufacturer s site Service pack A service pack can be ordered for servicing purposes It contains the following spare parts Mounting seal Mounting clamps Terminal block twin block The service pack can be ordered from your Siemens representative ...

Page 140: ...Maintenance and servicing 10 2 Servicing and spare parts OP 73micro TP 177micro WinCC flexible 140 Operating Instructions 09 2007 6AV6691 1DF01 0AB0 ...

Page 141: ...o WinCC flexible Operating Instructions 09 2007 6AV6691 1DF01 0AB0 141 Specifications 11 11 1 Dimensional drawings 11 1 1 Dimensional drawings OP 73micro 6 2 137 67 28 153 83 Figure 11 1 Overall dimensions of the HMI device ...

Page 142: ...imensional drawings OP 73micro TP 177micro WinCC flexible 142 Operating Instructions 09 2007 6AV6691 1DF01 0AB0 11 1 2 Dimensional drawings TP 177micro 212 6 2 140 156 196 44 Figure 11 2 Overall dimensions of the HMI device ...

Page 143: ...st control yes Back lighting Half Brightness Life typical LED green 100 000 h Input unit Type Membrane keyboard System keys with dedicated functions 8 Soft keys Of those freely configurable 4 4 Memory Working memory 128 KB Power supply Nominal voltage Range permissible 24 V DC 20 4 V to 28 8 V 15 20 Transients maximum permissible 35 V 500 msec Time between two transients minimum 50 s Current consu...

Page 144: ... fixation Page 30 Information on insulation tests protection class and degree of protection Page 37 11 2 2 Specifications of the TP 177micro Enclosure Weight without packing Approx 750 g Display Type LCD STN blue mode Display area active 115 18 mm x 86 38 mm 5 7 Resolution 320 x 240 pixels 240 x 320 in vertical mounting position Colors displayable 4 grades of blue Contrast control Yes Back lightin...

Page 145: ...ansients minimum 50 s Current consumption at nominal power Typical Constant current maximum Power on current surge I2t Approx 240 mA Approx 300 mA Approx 0 5 A2s Fuse internal Electronic See also Standards Certificates and Approvals Page 18 Electromagnetic compatibility Page 23 Transport and storage conditions Page 25 Mounting information Page 27 Mounting positions and fixation Page 33 Information...

Page 146: ... PIN Assignment 1 24 V DC 2 GND 24 V 11 3 2 RS485 IF 1B on OP 73micro Sub d socket 9 pin with screw lock 1 5 9 6 Figure 11 4 RS485 interface pin out PIN Assignment 1 n c 2 GND 24 V 3 Data channel B 4 RTS 5 GND 5 V 6 5 V DC 7 24 V DC out max 100 mA or 24 V DC in1 8 Data channel A 9 n c 1 Applies when power is supplied from the CPU CAUTION Power supply When the HMI device is supplied with power from...

Page 147: ...ing Instructions 09 2007 6AV6691 1DF01 0AB0 147 11 3 3 RS 485 IF 1B on TP 177micro Sub d socket 9 pin with screw lock 1 5 9 6 Figure 11 5 RS 485 interface pin assignment PIN Assignment 1 n c 2 GND 24 V 3 Data channel B 4 RTS 5 GND 5 V 6 5 V DC 7 24 V DC out max 100 mA 8 Data channel A 9 n c ...

Page 148: ...Specifications 11 3 Description of interfaces OP 73micro TP 177micro WinCC flexible 148 Operating Instructions 09 2007 6AV6691 1DF01 0AB0 ...

Page 149: ...lectronic components are highly sensitive to overvoltage and thus to discharge of static electricity These electronic components are therefore specially identified as ESD Abbreviation The following abbreviations are commonly used for electrostatic sensitive devices ESD Electrostatic Sensitive Devices ESD Electrostatic Sensitive Device as common international designation Labeling ESD modules are la...

Page 150: ... a result of overvoltage is detected immediately but may become apparent only after a longer period of operation Prevent electrostatic charge of your body before you touch the ESD Anyone who is not connected to the electrical potential of their surroundings is subjected to electrostatic charge The figure indicates the maximum electrostatic charge anyone is subjected to when contacting the material...

Page 151: ...ricity from your body if you are performing measurements on an ESD To do so touch a grounded metallic object Always use grounded measuring instruments A 2 System alarms Introduction System alarms on the HMI device provide information about internal states of the HMI device and PLC The overview below shows the causes of system alarms and how to eliminate the cause of error Depending on functionalit...

Page 152: ...ameters 20011 An error has occurred in a script that was called by the specified script Execution of the script was therefore aborted in the called script Take the system alarm that may have occurred prior to this into account In the configuration select the script that has been called directly or indirectly by the specified script Ensure that the tags used are of the allowed types Check the syste...

Page 153: ... files 70010 The application could not be started because it could not be found in the path specified or there is insufficient memory space Check if the application exists in the specified path or close other applications 70011 The system time could not be modified The error alarm only appears in connection with area pointer Date time PC Possible causes An invalid time was transferred in the job m...

Page 154: ...e calculation of the system function is not performed Check the desired calculation and correct it if necessary 70025 The value range of the tag has been exceeded in the system function The calculation of the system function is not performed Check the desired calculation and correct it if necessary 70026 No other screens are stored in the internal screen memory No other screens can be selected 700...

Page 155: ...ystem alarm is only generated when at least one e mail has been successfully sent to the queue in the meantime Check if the network connection still exists or the connection is overloaded for example due to reoccurring system alarms resulting from disruptions 70036 No SMTP server for sending e mails is configured An attempt to connect to an SMTP server has failed and it is not possible to send e m...

Page 156: ...operation the action is only carried out once 80015 This system alarm is used to report DOS or database errors to the user 80016 The logs are separated by the system function CloseAllLogs and the incoming entries exceed the defined buffer size All entries in the buffer are deleted Reconnect the logs 80017 The number of incoming events cause a buffer overflow his can be caused for example by severa...

Page 157: ...Runtime is active or not 80027 The internal Flash memory has been specified as the storage location for a log This is not permissible No values are written to this log and the log file is not created Configure Storage Card or a network path as the storage location 80028 The alarm returns a status report indicating that the logs are currently being initialized No values are logged until the alarm 8...

Page 158: ...nnectionMode to switch the specified controller to online mode although the entire system is in offline mode This changeover is not allowed The controller remains in offline mode Switch the complete system to online mode then execute the system function again 110006 The content of the project version area pointer does not match the user version configured in WinCC flexible WinCC flexible Runtime i...

Page 159: ... second script in turn has a value change that results in the call of yet a further script etc The configured functionality is not supported Check the configuration 140000 An online connection to the controller is established 140001 The online connection to the controller was shut down 140003 No tag updating or writing is executed Check the connection and if the controller is switched on Check the...

Page 160: ...module in the Control Panel using Set PG PC interface 140010 No S7 communication partner found because the controller is shut down DP T The option PG PC is the only master is not set in the Control Panel under Set PG PC interface Switch the controller on DP T If only one master is connected to the network disable PG PC is the only master in Set PG PC interface If several masters are connected to t...

Page 161: ...t the system if the system alarm persists 150001 Connection is up because the cause of the interruption has been eliminated 160000 No more data is read or written Possible causes The cable is defective The PLC does not respond is defective etc The wrong port is used for the connection System overload Ensure that the cable is plugged in the controller is operational the correct interface is being u...

Page 162: ... operation was canceled with an internal error of class 2 and error code 3 180000 A component OCX received configuration data with a version ID which is not supported Install a newer component 180001 System overload because too many actions running in parallel Not all the actions can be executed some are rejected Several remedies are available Increase the configured cycle times or basic clock Gen...

Page 163: ...0011 Possible cause 1 The value entered could not be written to the configured controller tag because the high or low limit was exceeded The system discards the entry and restores the original value Possible cause 2 The connection to the controller was interrupted Make sure that the value entered lies within the range of values of the control tags Check the connection to the PLC 190012 It is not p...

Page 164: ... in the controller does not exist is not set Change the address or set up the address in the controller 200101 Coordination is canceled because the write access to the address configured in the PLC is not possible Change the address or set the address in the controller at an area which allows write access 200102 Coordination is not carried out at the moment because the address format of the area p...

Page 165: ... and the specified port is active 220007 The connection to the specified controller is interrupted at the specified port Check if the cable is plugged in the controller is OK the correct port is used the configuration is OK interface parameters protocol settings PLC address Restart the system if the system alarm persists 220008 The communication driver cannot access or open the specified port The ...

Page 166: ...r is actually running on the destination computer Faulty authorization The configured user name and or password do not match those on the server Establish consistency When the server certificate is rejected Certificate signed by an unknown CA Either ignore this item in your project or Install a certificate that has been signed with a root certificate known to the client computer The date of the ce...

Page 167: ...e is operating in demo mode Too many tags are configured for the installed version Load an adequate authorization powerpack 240002 WinCC flexible Runtime is operating with a time limited emergency authorization Restore the full authorization 240003 Authorization failed Without authorization WinCC will run in demo mode Restart WinCC flexible Runtime or reinstall it 240004 Error while reading the em...

Page 168: ...n the alarm because it attempts to access an invalid address in the controller Check if the data area for the tag exists in the controller the configured address is correct and the value range for the tag is correct 270001 There is a device specific limit as to how many alarms may be queued for output see the operating instructions This limit has been exceeded The view no longer contains all the a...

Page 169: ... the configuration that the address has been set up in the controller 290001 An attempt has been made to assign a value to a recipe tag which is outside the value range permitted for this type The alarm can be entered in the alarm buffer for up to four more failed tags if necessary After that alarm 290004 is output Observe the value range for the tag type 290002 It is not possible to convert a val...

Page 170: ...ist Check the source for the number constant or tag value 290012 The recipe with the specified number does not exist Check the source for the number constant or tag value 290013 An attempt was made to save a data record under a data record number which already exists The action is not executed The following remedies are available Check the source for the number constant or tag value First delete t...

Page 171: ... the action 290032 While exporting data records it was detected that a file with the specified name already exists Overwrite the file or cancel the process 290033 Confirmation request before deleting data records 290040 A data record error with error code 1 that cannot be described in more detail occurred The action is canceled It is possible that the data record was not installed correctly on the...

Page 172: ... record was saved 290060 Message reporting that the specified data record memory was cleared 290061 Message reporting that clearing of data record memory was canceled due to an error 290062 The data record number is above the maximum of 65536 This data record cannot be created Select another number 290063 This occurs with the system function ExportDataRecords when the parameter Overwrite is set to...

Page 173: ...rms related to this alarm Repeat the print job if necessary 320000 The movements have already been indicated by another device The movements can no longer be controlled Deselect the movements on the other display units and select the motion control screen on the required display unit 320001 The network is too complex The faulty addresses cannot be indicated View the network in STL 320002 No diagno...

Page 174: ...with the corresponding DB number and FB number does not exist The function cannot be executed Check the parameters of the SelectUnit function and the units selected in the project 320012 The Step sequence mode dialog is no longer supported Use the ZP_STEP step sequence screen from the corresponding standard project for your project Instead of calling the Overview_Step_Sequence_Mode function call t...

Page 175: ...tandard ES Engineering System ESD Electrostatic Discharge the components and modules endangered by such ESD Electrostatic Sensitive Device GND Ground HF High Frequency HMI Human Machine Interface IEC International Electronic Commission IF Interface LED Light Emitting Diode MMC Multi Media Card MOS Metal Oxide Semiconductor MPI Multipoint Interface SIMATIC S7 MS Microsoft MTBF Mean Time Between Fai...

Page 176: ...09 2007 6AV6691 1DF01 0AB0 RxD Receive Data SELV Safety Extra Low Voltage SP Service pack STN Super Twisted Nematic Sub D Subminiature D plug TAB Tabulator TCP IP Transmission Control Protocol Internet Protocol TFT Thin Film Transistor TxD Transmit Data UL Underwriter s Laboratory ...

Page 177: ...owledging Acknowledgement of an alarm confirms that it has been noted Alarm activated Moment at which an alarm is triggered by the controller or HMI device Alarm deactivated Moment at which the initiation of an alarm is reset by the controller Alarm user specific A user specific alarm can be assigned to one of the following alarm classes Error Warning User specific alarm classes A user specific al...

Page 178: ...the controller Controller General term for devices and systems with which the HMI device communicates e g SIMATIC S7 Display duration Defines whether and how long a system alarm is displayed on the HMI device EMC Electromagnetic compatibility is the ability of electrical equipment to function properly in its electromagnetic environment without influencing this environment Engineering software Soft...

Page 179: ...evice The HMI device image contains the operating system and elements of the runtime software required to run a project Infotext Configured information on objects within a project An alarm infotext for example may contain information on the cause of the fault and troubleshooting routines IO field Enables the input or output of values on the HMI device which are transferred to the controller Notati...

Page 180: ... that HMI device Project file File which is generated based on a source file for a specific HMI device when the configuration is completed The project file is transferred to the corresponding HMI device and is used to operate and monitor plants Refer to Source file Recipe Combination of tags forming a fixed data structure The data structure configured can be assigned data on the HMI device and is ...

Page 181: ...e file it is necessary to use the same WinCC flexible version which was used to configure the project STEP 7 Programming software SIMATIC S7 SIMATIC C7 and SIMATIC WinAC controllers STEP 7 Micro WIN Programming software for controllers of the SIMATIC S7 200 series Symbolic IO field Box for the input output of a parameter Contains a list of default entries from which one can be selected System alar...

Page 182: ...3micro TP 177micro WinCC flexible 182 Operating Instructions 09 2007 6AV6691 1DF01 0AB0 Transfer mode HMI device operating mode set to transfer an executable project from the configuration computer to the HMI device ...

Page 183: ... 33 Approvals 18 22 Area pointer Configuring 64 B Backing up 95 96 98 Using ProSave 98 Using WinCC flexible 96 Backup 92 Bottom view 13 Bottom view of OP 73micro 12 C Calibrating Touch screen 85 Call sequence Characters 108 Calling Version information 75 Character input Using control keys 107 110 Characters Call sequence 108 Delete 108 Inserting 109 Cleaning agents 137 Cleaning screen 138 Locking ...

Page 184: ... Date and time 106 118 Entering 111 122 Date Time Reading from the PLC 64 Decimal places 106 118 Delay time Editing 82 Setting 76 Deleting Password 78 Device Info 74 Dialog Bootloader 46 Dialog entries Editing 72 Display 143 144 Display format 106 E EC declaration of conformity 18 Electrostatic charge 150 Enclosure 144 Entering Alphanumerical characters 107 Alphanumerical value 106 Alphanumerical ...

Page 185: ... 104 Instructions General 20 Security 17 20 Working on the cabinet 17 Interfaces 41 50 Interference Pulse shaped 23 Sinusoidal 24 L Labeling Approvals 18 EC declaration of conformity 18 Labels Explosion protection 20 Language Setting 105 116 LEDs 69 Limit value test 106 118 Lists Navigating in 104 Loader 80 Navigating in the 71 OP 73micro 71 Location of the manufacturer 22 Locking an operator cont...

Page 186: ...binations 103 Operator control components 69 70 Optical feedback 115 Overall dimensions 142 OP 73micro 141 P Password Deleting 87 Entering 86 Password 77 Assigning 77 Deleting 78 Editing 77 Password 114 Password Backing up restoring 114 Password 124 Password Backing up restoring 124 Password entry 77 Password list 114 124 Password properties 86 Password protection 73 80 PC PPI adapter 14 Pin assig...

Page 187: ...merical 118 Symbolic 121 Screen saver 76 Setting 76 87 Screens 15 Security 113 124 Security system 113 124 Selecting In the field 104 Service On the Internet 6 Service pack 139 Setting Contrast 74 Delay time 76 Screen saver 76 Settings 75 Side view 13 Side view of OP 73micro 12 Siemens PLC Protocols 16 SIMATIC S7 Communication partners 62 Configuring protocol parameters 61 Network parameters 62 So...

Page 188: ...ew 125 Value table 126 Trends Limit violation 125 Trends 125 Type of fixation 31 34 U Updating the operating system 92 Upkeep 137 Use Conditions 27 In industry 20 In residential areas 20 In the potentially explosive atmosphere 20 With additional measures 27 User data Backing up restoring 114 124 user data areas 63 Users 113 124 V Value table 126 Version Info 75 Version information Calling 75 W Wir...

Search results

Summary of Contents for SIMATIC HMI OP 73micro

Reviews:

Related manuals for SIMATIC HMI OP 73micro

Brands by name

Popular brands

Siemens SIMATIC HMI OP 73micro, Operating Instructions Manual

Search results

Summary of Contents for SIMATIC HMI OP 73micro

Reviews:

Related manuals for SIMATIC HMI OP 73micro

Brands by name

Popular brands