background image

Form: 995 704 336 (12.08 GB, F)

 

Specifications subject to change without notice

Changements sans préavis

Makita U.S.A., Inc.

14930 Northam Street
La Mirada, 
CA 90638-5753

Makita Canada Inc.

DOLMAR Division 

1950 Forbes Street

Whitby, Ontario

Canada, L1N 7B7

Summary of Contents for DPC6430

Page 1: ... du présent manuel d instructions et de sécurité Une utilisation incorrecte de la découpeuse peut entraîner des blessures graves Conservez avec soin ce manuel Les gaz d échappement émis par ce produit contiennent des produits chimiques connus par l Etat de Californie pour provoquer le cancer des défauts de naissance ou autres dommages de reproduction Lisez et comprenez ce manuel DPC6430 6431 6440 ...

Page 2: ...t part or malfunction of authorized parts due to use of non authorized parts OWNER S WARRANTY RESPONSIBILITIES As the engine owner you are responsible for the performance of the required maintenance listed in your owner s manual MAKITA recommends that you retain all receipts covering maintenance on your engine but MAKITA cannot deny warranty solely for the lack of receipts or for your failure to e...

Page 3: ...construction and high reliability Maintenance free electronic ignition hermetically sealed to protect against dust and moisture Vibration damping with the MAKITA2 mass system D2M for tireless working even when guiding the Power Cut by hand Five stage air filter system for reliable working even under very dusty conditions Two options for mounting the cutter attachment Either cen trally for good bal...

Page 4: ...d circular saw blades or any kind of wood cutting blades Combination Start Stop I O switch choke Starting procedure Press decompression valve Engine manual start Stop engine Warning Kickback Fuel and oil mixture First aid Recycling Do not touch hot surfaces Read instruction manual and follow the warning and safety precautions Particular care and caution Forbidden Wear helmet and eye respiratory an...

Page 5: ...r the influence of alcohol drugs medica tion or other substances which may impair vision dexterity or judgement A fire extinguisher must be available in the immediate vicinity when working in easily inflammable vegetation or when it has not rained for a long time danger of fire Asbestos and other materials that can release toxins may be cut only with the necessary safety precautions and after noti...

Page 6: ...sparks Fuel cannot be stored for an unlimited period of time Buy only as much as will be consumed in the near future When making up the gasoline oil mixture always put the oil in the mixing container first and then the gasoline Use only approved and marked containers for the transport and storage of fuel Keep fuel away from children Putting into operation Do not work on your own There must be some...

Page 7: ...foot in the rear handle and grasptheotherhandlefirmly withthumbandfingers Otherstarting methods are not allowed WhenstartingthePowerCutitmustbewellsupportedandsecurely held The cutting disc must not be touching anything If the cutting disc is new test it by running it at least 60 seconds at topspeed Whendoingthis makesurethatnopersonsorbodyparts are in the extended swing range of the disc in case ...

Page 8: ... Power Cut unattended Use the Power Cut at high speed as far as possible see Tech nical Data Only use the Power Cut during good light and visibility periods Be aware of slippery or wet areas and of ice and snow risk of slipping Never work on unstable surfaces Make sure that there are no obstacles in the working area risk of stumbling Always ensure that you have a safe footing Never cut above your ...

Page 9: ... Instead always cut shallow around the whole piece Worn discs have a smaller diameter than new discs so that at the same engine speed they have a lower effective circumfer ential speed and therefore do not cut as well Cut I beams and L bars in steps see Figure 21 Cut bands and plates like pipes along the wide side with a long cut Whencuttingmaterialunderstress supportedmaterialormate rial in struc...

Page 10: ...it with the engine on or the disc moving Carry the unit only by the tubular middle handle with the cut ting disc pointing behind you 26 Avoid touching the exhaust muffler burn hazard When moving the Power Cut over longer distances use a wheelbarrow or wagon When transporting the Power Cut in a vehicle make sure it is securely positioned in such a way that no fuel can leak out Always remove the cut...

Page 11: ...KITA spares accessories or cutting discs increases the risk of accident We cannot accept any respon sibility for accidents or damage occurring in association with the use of cutting discs or accessories other than original MAKITA First aid For the event of a possible accident please make sure that a firstaidkitisalwaysimmediatelyavailablecloseby Immediately replace any items used from the first ai...

Page 12: ...ting disc lb 21 38 21 82 21 6 22 04 DPC6430 6440 DPC6431 6441 DPC7330 7340 DPC7331 7341 Displacement cu in cm3 4 9 81 4 9 81 Bore in mm 2 05 52 2 05 52 Stroke in mm 1 49 38 1 49 38 Max power hp kW 6 2 4 5 6 2 4 5 Max torque Nm 5 2 5 2 Idling speed 1 min 2 500 2 500 Clutch engagement speed 1 min 3 800 3 800 Engine speed limitation 1 min 9 350 145 9 350 145 Max spindle speed 1 min 4 300 3 750 Sound ...

Page 13: ...k with handle 14 Decompression valve 15 Starter grip 16 Air intake 17 Combination Start Stop I O switch choke 18 Stop knob for halfway throttle 19 Safety locking button 20 Throttle lever 21 Tank cap fuel 22 Starter housing with starter 23 Cutting disc 24 Disc bolt 25 Spring washer 26 Hold opening 1 24 25 23 2 3 4 5 6 7 8 26 15 16 17 18 19 20 9 10 21 22 12 11 13 14 Serial number Year of manufacture...

Page 14: ...cutting disc is installed so it turns in the right direction if a direction is marked on the disc Putting into operation CAUTION Always turn off the engine and pull off the spark plug cap before doing any work on the Power Cut Always wear protective gloves CAUTION Start the Power Cut only after complete assembly and inspection Sequence For the the following work use the assembly tools included wit...

Page 15: ... off the engine and disconnect the spark plug cap NOTE When using a protective hood for a maximum disk diam eter of 300 mm 12 always shorten hose 15 to 180 mm 7 To do this unscrew sleeve 16 and carefully pull tube 15 off coupling 17 and cut to 180 mm Then push the tube end back over the coupling and tighten the sleeve all the way Install the water connection as shown in figure Push clamp 22 around...

Page 16: ...ou can use fuel with a higher octane value This will not affect the engine In order to obtain an optimum engine output and to protect your health and the environment use unleaded fuel only To lubricate the engine use a synthetic oil for two stroke air cooled engines quality grade JASO FC or ISO EGD which has to be added to the fuel Gasoline 50 1 The correct mixture ratio 50 1 WhenusingMAKITAsynthe...

Page 17: ...engine oil 50 1 is available in the following sizes to suit your individual requirements 2 6 floz order number T 00745 6 4 floz order number T 00739 NOTE For preparing the fuel oil mixture first mix the entire oil quantity with half of the fuel required then add the remaining fuel Shake the finished mixture thoroughly before pouring it into the Power Cut tank Caution Open the tank cap carefully as...

Page 18: ...e a good footing and place the Power Cut on the ground in such a way that the cutting disc is not touching anything 3 meters Move the protective hood 3 into the proper position for the work you intend to do see illustration Grasp the grip 2 The hood 3 can swing in both ways within its range of motion Caution Alwaysmakesurethatthestraightouteredgeoftheimpactplate 4 and the edge of the hood are para...

Page 19: ...rst audible ignition Caution Do not pull out the starter cable more than approx 50 cm and lead it back by hand Depress decompression valve 5 again Put the combination switch 6 in position I Keep pulling the starter cable until the engine catches As soon as the engine is running press the throttle 9 to release the half throttle lock 7 allowing the engine to idle Warm starting As described under Col...

Page 20: ...he following steps must be carried out Start the engine and run it until it is warm about 3 5 minutes Adjust the carburetor with the screwdriver 1 Order No 944 340 001 included with the Power Cut It has a lug that helps with adjustment Readjust the idling speed If the cut off disc is still turning when the engine is running unscrew the adjusting screw of the throttle valve 2 until the cut off disc...

Page 21: ...by a MAKITA service center before being used again SERVICE Unscrew the screws 8 and remove the crankcase housing cover 9 Remove the old belt 10 or belt pieces NOTE The illustration shows the V belt for models DPC6430 DPC7341 Clean out the inside of the drive arm with a brush Put in a new V belt NOTE Reassemble the crankcase housing cover 9 side piece 6 and cover 4 in the reverse order To tighten t...

Page 22: ...ed parts NOTE To install the cutting wheel see Mounting the cutting wheel Cleaning changing the air filter Turn the cover lock 11 counterclockwise to release it and carefully remove the filter cover 12 There is a gasket 15 between the filter cover 12 and the hood 14 Remove screws 13 and take off the cover 14 Clean the gasket 15 with a brush and check for damage Take the pre filter foam 17 out of t...

Page 23: ...rface Replace the air filter insert every 100 operating hours Replace it immediately if there is a drop in power drop in speed or smoke in the exhaust Before installing the filter system check the intake opening to make sure no dirt particles have fallen in If they have remove them CAUTION Turn off the engine before cleaning the air filter Never clean out the air filter with compressed air Do not ...

Page 24: ...of the open ing Empty fuel tank Use a wire hook to pull the suction out of the tank opening for replacement Caution Do not allow fuel to come into contact with skin Replacing the spark plug Caution Do not touch the spark plug or plug cap if the engine is running high voltage Switch off the engine before starting any maintenance work A hot engine can cause burns Wear protective gloves The spark plu...

Page 25: ... by the arrow Holdingthecabledruminyourlefthand straightenoutthetwistin the cable with your right hand pull the cable tight and hold Release the cable drum The drum s spring force will now wind the cable around the drum Repeat three times The starter grip must be upright on the starter housing NOTE With the cable pulled all the way out it must still be possible to turn the pulley another 1 4 turn ...

Page 26: ...g CAREFUL the spring can pop out If it does it can be put back in as shown in the diagram observe the direction of rotation Before installing the new return spring 4 in the starter hous ing grease it lightly with multipurpose grease Order No 944 360 000 Then position it and press it until the tabs 5 engage in the slots Do not grease the cable drum 2 or bearing journal Screw in bolt 3 but do not ti...

Page 27: ...8 to lever out the stop pin 9 as shown in the illustration until the protective hood 11 can be turned NOTE The turn stop 7 is deactivated when the stop pin 8 is removed This permits the hood 11 to be turned farther than the turn stop 7 Unscrew the grip 10 and turn the protective hood 11 as shown in the illustration Disengage the V belt 12 and remove the cutting attach ment NOTE The illustration sh...

Page 28: ...sure the disc turns in the right direction 16 17 18 19 20 Replacing cleaning the spark arrester screen The spark arrester screen should be checked and cleaned regularly Models without catalytic converter Loosen the 2 screws 19 and remove the spark arrester screen 20 Models with catalytic converter DPC6440 6441 7340 7341 Unscrew and remove screws 21 Remove the front housing section of the muffler 2...

Page 29: ... to the trolley and Power Cut are very fast and simple Mains pressure water system 6 The mains pressure water system is designed to be mounted on the Power Cut It can be used with or without the trolley but is especially suitable for applications involving hand held stationarycutting Thewaterlinehasafast releaseconnection and can be fed either from a mains supply or from a pressure tank 7 The wate...

Page 30: ...l dealer He will also have the spare part lists to determine the required spare part numbers and will be constantly informed about the latest improvements and spare part innovations Please bear in mind that if parts other than original MAKITA spare parts are used this will automatically invalidate the MAKITA product guarantee We will furthermore not accept any liability damages arising from the us...

Page 31: ...arantee All repairs covered by the guarantee must be performed by a MAKITA service center Malfunction System Observation Cause Cutting disc does not start turning Clutch Engine runs Damage to clutch Cutting disc runs in idle Carburetor Cutting disc runs Incorrect idle speed clutch blocked clutch Engine does not start or Ignition system Ignition spark Malfunction in fuel supply system com only with...

Page 32: ... from the spare parts list Use only original MAKITA parts For repairs and replacement of other parts see your MAKITA service center 32 31 29 30 22 28 20 DPC6430 6431 6440 6441 DPC7330 7331 7340 7341 DPC8131 8132 ...

Page 33: ...rburetor 19 394 174 140 1 Spark arrester screen cpl 20 394 174 340 1 Spark arrester screen cpl for models with catalytic converter Accessories not delivered with the Power Cut Diamond cutting disc 22 966 221 021 1 Concrete Standard dia 300 20 mm 12 0 8 22 966 321 020 1 Concrete DiaDuran dia 300 20 mm 12 0 8 22 966 221 011 1 Asphalt Standard dia 300 20 mm 12 0 8 22 966 321 010 1 Asphalt DiaDuran di...

Page 34: ...is fonctionnement de pièces autorisées dû à l utilisation de pièces non autori sées RESPONSABILITÉS DE GARANTIE DU PROPRIÉTAIRE En tant que propriétaire de la machine vous êtes tenu responsable de l exécution de la maintenance requise indiquée dans le manuel du propriétaire MAKITA recommande de conserver toutes les quittances couvrant l entretien de votre machine car MAKITA ne peut pas refuser la ...

Page 35: ...n protégé hermétiquement contre la poussière et l humidité amortissement des vibrations selon le système 2 masses MAKITA D2M garantissant un travail sans fatigue même pour un appareil portatif Système de filtre à air à cinq niveaux pour un fonctionnement fiable même en cas d important dégagement de poussiè res deuxpossibilitésdemontagedudisqueàdécouper enposition moyenne pour le balancement optima...

Page 36: ...is Commutateur combiné Marche Arrêt E S starter Démarrage Appuyer sur la soupape de décompression Démarrer le moteur Arrêter le moteur Attention Rebond kickback Mélange carburant Premier secours Recyclage Ne touchez pas les surfaces chaudes Lire instructions d emploi et suivre les consignes de sécurité et d avertissement Danger et attention particulirs Interdit Porter un casque une protection pour...

Page 37: ...pport à des tiers Ne jamais travailler sous l effet de l alcool de drogues de mé dicaments ou d autres substances risquant d affecter la vue l aptitude ou les réflexes Avoir un extincteur sous la main en cas de travaux dans un végétation facilement inflammable ou par temps de sécheresse Danger d incendie Le découpage de l amiante ou de substances susceptibles de dégager des gaz toxiques ne doit êt...

Page 38: ... de projection des étincelles du disque à découper Les carburants ne peuvent pas être stockés infiniment N ache ter que la quantité nécessaire couvrant un temps de marche prévisible Lorsquevouseffectuezlemélangeessence huile remplird abord l huile et ensuite l essence dans le bac de mélange Ne transporter et ne stocker le carburant que dans des nourrices agrées et portant les indications nécessair...

Page 39: ...ructions indiquées dans la notice d emploi 13 Poser toujours le peid droit gauche la poignéeetentourerlapoignéeaveclepouce D autrestechniques de lancement ne sont pas autorisées Lorsdelamiseenroute lamachinedoitêtresolidementmaintenue et supportée Pour cela le disque à découper doit être libre Si le disque à découper est neuf il doit être testé avant le premier découpage au moins pendant 60 second...

Page 40: ...sans aucune surveillance Faire fonctionner la découpeuse si possible à haut régime cf Caractéristiques techniques Netravaillerquesousdebonnes conditionsdevisibilitéetd éclai rage Faireparticulièrementattentionenprésencedesolglissant d humidité de glace et de neige danger de glissade Ne jamais travailler sur un fondement instable Faire attention aux obstacles dans la zone de travail risque de trébu...

Page 41: ...coupésencoupant verticalement Manipuler les tubes de grand diamètre comme les barres massives Pour éviter de tenir de travers et pour un meilleur contrôle du découpage ne pas laisser le disque trop pénétrer dans le matériau Toujours tronçonner à plat tout autour Les disques à découper usées de faible diamètre ont au même régimemoinsdevitessepériphériqueetcoupentparconséquent moins bien Tronçonner ...

Page 42: ...que le moteur ou le disque est en marche Ne porter la découpeuse que par la poignée étrier Le disque à découper est orienté vers l arrière 26 Ne jamais entrer en contact avec le pot d échappement risque de brûlure Utiliser une brouette ou un chariot pour le transport sur une distance assez longue Si la découpeuse est transportée par un véhicule automobile s assurer que celle ci soit dans une posit...

Page 43: ... n étant pas d origine MAKITA il faut s attendre à un risque d accident important MAKITA ne pourra être tenu responsable en cas d accidents ou de dommages avec des disques à découper ou accessoires n étant pas d origine Premier secours On devra toujours disposer sur le lieu de travail d une boîte de secours pour le cas d un éventuel accident Les produits prélevés doivent immédiatement être remplac...

Page 44: ...des sans disque lb 21 38 21 82 21 6 22 04 Cylindrée cu in cm3 4 9 81 4 9 81 Alésage in mm 2 05 52 2 05 52 Course in mm 1 49 38 1 49 38 Puissance max hp kW 6 2 4 5 6 2 4 5 Couple max Nm 5 2 5 2 Vitesse de rotation à vide 1 min 2 500 2 500 Vitesse de rotation d embrayage 1 min 3 800 3 800 Régime d étranglement 1 min 9 350 145 9 350 145 Régime nominal de broche 1 min 4 300 4 300 Niveau sonore à l ore...

Page 45: ... 15 Poignée de lancement 16 Orifice d aspiration d air 17 Commutateur combiné Marche Arrêt E S starter 18 Bouton d arrêt pour mi gaz 19 Bouton de blocage pour mi gaz 20 Levier d accélération 21 Couvercle du réservoir à essence 22 Boîtier du démarreur avec dispositif de lancement 23 Disque à découper 24 Vis de fixation du disque à découper 25 Disque de contrainte 26 Ouverture de contre support 1 24...

Page 46: ...tation Observer le sens de rotation du disque à découper si mar qué sur celui ci MISE EN ROUTE ATTENTION Pour tout travail effectué sur la découpeuse il est impératif de mettre le moteur hors tension de retirer la fiche de la bougie et de porter des gants de protection ATTENTION La découpeuse ne peut être mise en marche qu après le montage complet Schématique Pour les travaux suivants utilisez l o...

Page 47: ...tre le moteur hors tension et de retirer la cosse de bougie pendant tous les travaux effectués sur la tron çonneuse ATTENTION Il est obligatoire de réduire le tuyau 15 à 180 mm 7 en cas d utilisation d un capot de protection pour un diamètre de disque maximal de 300 mm 12 Pour cela desserrer l écrou raccord 16 retirer le tuyau 15 du raccord 17 avec précaution et le raccourcir à 180 mm Ensuite réap...

Page 48: ...n degré d octane minimum de 87 R M 2 Si un tel type de carburant n était pas disponible on peut aussi utiliser un carburant d un degré d octane plus élevé Le moteur n en subit aucun dommage Pour un fonctionnement optimal ainsi que pour la protec tion de la santé et de l environnement utilisez toujours un carburant sans plomb Le graissage du moteur est réalisé par une huile moteur à deux temps synt...

Page 49: ...deux temps de MAKITA 50 1 peut être livrée selon les besoins dans des bidons aux contenances suivantes 2 6 flz N de commande T 00745 6 4 flz N de commande T 00739 REMARQUE Pour fabriquer le mélange essence huile il faut toujours mélanger préalablement le volume d huile prévu dans la moitié du volume d essence puis y ajouter le volume d essencerestant Avantdeverserlemélangedansl appareil bien le mé...

Page 50: ...ère à ce que le dispositif de découpage ne soit tourné dans votre direction 3 mètres Mettre le capot de protection 3 en position optimale cf Figure en fonction de l utilisation faite Prendrelapoignée 2 lecapotdeprotection 3 peutêtreorienté à l intérieur des butées dans les deux sens de la flèche Attention S assurer absolument que le bord extérieur rectiligne de la tôle de butée 4 et le bord du cap...

Page 51: ...etirer le cordon de lancement de plus de 50 cm et le ramener lentement à la main Renfoncer la soupape de décompression 5 Pousser le commutateur combiné 6 en position I Tirer à nouveau le cordon de lancement jusq à ce que le moteur tourne Dès que le moteur tourne actionner le levier de gaz 9 pour que le bouton de blocage 7 ressorte et pour que le moteur tourne au ralenti Démarrage à chaud Comme déc...

Page 52: ...suivantessontnécessairespourunréglage correct du régime de ralenti Démarrez le moteur et laissez le tourner jusqu à ce qu il soit chaud env 3 à 5 min Utiliser le tournevis 1 réf 944 340 001 Il possède un talon soudé servant au réglage Corrigez le réglage du régime de ralenti Si le disque à découper tourne avec le moteur dévissez la vis de butée 2 du papillon du carburateur jusqu à ce que le disque...

Page 53: ...te remise en marche SERVICE Desserrer les vis 8 et enlever le couvercle du carter d em brayage 9 Enlever l ancienne courroie 10 ou les restes de courroie NOTE Le dessin montre la courroie trapézoïdale des modè les DPC6430 DPC7341 Nettoyer l intérieur du bras de transmission au moyen d un pinceau Mettre en place une nouvelle courroie NOTE Montageducouvercleducarter moteur 9 del entretoise latérale ...

Page 54: ... remplacer le filtre à air Tourner le verrouillage du couvercle 11 dans le sens inverse des aiguilles et retirer avec précaution le couvercle du filtre 12 Un joint 15 se trouve entre le couvercle du filtre 12 et le capot 14 Dévisser les vis 13 et retirer le capot 14 Nettoyer le joint 15 avec un pinceau et vérifier s il n est pas endommagé Nettoyer le pré filtre mousse 17 du couvercle du filtre Ret...

Page 55: ... et la frapper avec précaution contre un support propre Remplacer la cartouche de filtre à air toutes les 100 heures de service La remplacer immédiatement en cas de perte de puissance de baisse de régime ou de dégagement d épaisse fumée dans les gaz d échappement Avant de monter le système de filtrage contrôler si aucune poussière n est tombée dans l orifice d aspiration Les enlever si besoin est ...

Page 56: ...rer la crépine d aspiration à travers la bouche du réservoir au moyen d un crochet en fil métallique Attention Eviter tout contact du carburant avec la peau Remplacement de bougie ATTENTION Les bougies d allumage ou la fiche de la bougie ne doivent pas être touchés le moteur en marche haute tension N effectuer des travaux de maintenance que si le moteur est arrêté Risque de brûlure lorsque le mote...

Page 57: ...ur d enroulement avec le cordon dans le sens de la flèche Tenir le tambour d enroulement de la main gauche démêler le cordon de la main droite tendre et tenir le cordon Lâcher le tambour Par l effet de ressort le cordon s enroule sur le tambour Répéter trois fois l opération La poignée de lancement doit être maintenant verticale au niveau du carter du démarreur INDICATION Si la corde de lancement ...

Page 58: ...ATTENTION le ressort de rappel peut sauter Une fois enlevé le ressort de rappel peut être réinséré comme suit respecter le sens de rotation Graisser légèrement le nouveau ressort de rappel 4 avant de le monter dans le carter du démarreur avec de la graisse multi usage réf 944 360 000 puis remettre le ressort de rappel 4 en place et le presser légèrement de façon à ce que les éclisses 5 s enclenche...

Page 59: ...Desserrer la vis de tension 3 dans le sens inverse des aiguilles jusqu à ce que l extrémité de la vis 4 soit visible dans la fente Dévisser et enlever la vis détail X uniquement sur le modèle DPC8132 Dévisser les écrous 5 et enlever le couvercle 6 Retirer le boulon de butée 8 en le levant avec la clé univer selle 9 comme montré sur la figure jusqu à ce que le capot de protection 11 puisse être tou...

Page 60: ...r le sens de rotation du disque à découper si indiqué sur le disque à découper 16 17 18 19 20 Changement nettoyage du pare étincelles Il faut vérifier et nettoyer régulièrement le pare étincelles Modèles sans catalyseur Desserrer les 2 vis 19 et enlever le pare étencelles 20 Remontez le pare étincelles et serrez la vis Modèles avec catalyseur DPC6440 6441 7340 7341 Desserrer et dévisser les vis 21...

Page 61: ...La conduite d eau au réseau réservoir 6 La conduite d eau sous pression est conçue pour être montée sur la découpeuse Celle ci peut être utilisée en relation avec le chariot de guidage La conduite d eau sous pression convient particulièrement lorsque vous travaillez avec la découpeuse de manière stationnaire Au moyen d un accouplement de rupture rapide l eau peut être alimentée soit au moyen du ré...

Page 62: ...qui ne sont pas d origine de MAKITA vous perdez tout droit à la garantie de l organisation MAKITA Au cas où des pièces non d origine provoqueraient de détériorations nous n assurerons pas les frais qui en découleraient Généralités Découpeuse dans Nettoyer l extérieur et vérifier si elle n est pas détériorée l ensemble En cas de détériorations faire effectuer immédiatement les réparations par un sp...

Page 63: ...ent carburateur silencieux bouché tuyau être mis en cause d échappement des gaz dans le cylindre est bouché pare étincelles bouché Garantie MAKITA garantit un qualité irréprochable et supporte les frais pour une amélioration par remplacement des pièces défectueuses dans le cas de défauts de matériel ou de fabrication qui se présentent dans le délai de garantie après le jour de vente Veuillez noter...

Page 64: ...ange N utilisez que des pièces de rechange d origine MAKITA Pour les réparations et la rechange pour d autres pièces votre atelier spécialisé MAKITA est compétent 32 31 29 30 22 28 20 DPC6430 6431 6440 6441 DPC7330 7331 7340 7341 DPC8131 8132 ...

Page 65: ...Béton Standard diam 300 20 mm 12 0 8 22 966 321 020 1 Béton DiaDuran diam 300 20 mm 12 0 8 22 966 221 011 1 Asphalte Standard diam 300 20 mm 12 0 8 22 966 321 010 1 Asphalte DiaDuran diam 300 20 mm 12 0 8 22 966 241 021 1 Béton Standard diam 350 20 mm 14 0 8 22 966 341 020 1 Béton DiaDuran diam 350 20 mm 14 0 8 22 966 241 011 1 Asphalte Standard diam 350 20 mm 14 0 8 22 966 341 010 1 Asphalte DiaD...

Page 66: ...66 ...

Page 67: ...67 ...

Page 68: ... GB F Specifications subject to change without notice Changements sans préavis Makita U S A Inc 14930 Northam Street La Mirada CA 90638 5753 Makita Canada Inc DOLMAR Division 1950 Forbes Street Whitby Ontario Canada L1N 7B7 ...

Reviews: