Hasselblad CFH User Manual Download Page 2

C  O  N  T  E  N  T  S

6

  Film Magazine 

34

Parts & Components 

35

LCD panel 

35

LCD illumination button 

35

Change up button 

35

Change down button 

35

Function selector 

35

Film plane index 

36

Darkslide key 

36

Film tab holder 

36

Magazine settings lock 

36

Databus inter face 

36

Battery 

37

Attaching and removing 

37

Magazine settings 

38

Film loading 

40

7

  General overview of H2D sensor 

unit & CFH back 

41

The control panel 

43

System overview 

45

Menu overview 

46

8

  CFH setup 

48

Using with a Hasselblad H2 

48

Using with a Hasselblad H1 

49

Using with other cameras 

50

9

  Initial General Settings and 

Preparation 

52

Setting the menu language 

52

Storage and shooting modes 

53

Using compact flash memory cards 

54

Working with an Imagebank 

55

Tethered to a computer 

56

10

 Storage working with media 

and batches 

57

Batches 

57

Navigating media and batches 

57

Creating new batches 

59

Using Instant Approval Architecture 

60

Reading and changing approval status 

61

Browsing by approval status 

62

Deleting by approval status 

62

 

Introduction 

4  

 

Parts & Components 

8  

 

1

  Quick Start 

9  

2

  Function Control & Display  14

Grip LCD 

16

Viewfinder LCD 

18

3

  Camera Body 

23

Carrying strap 

24

Rechargeable battery grip − general 

24

Battery charger 

24

Charging the battery 

25

Viewfinder screen 

27

Accessory connection 

27

PC-connector 

27

Base plate 

27

4

  Viewfinder 

28

Parts & Components 

29

Attaching and  
removing the viewfinder 

29

Eyepiece adjustment 

29

Eye cup

5

  Lenses 

30

Parts & Components 

31

Attaching a lens 

31

Removing a lens 

31

Lens cap 

31

Filters 

31

Lens shades 

31

Shutter and aperture control 

31

Depth-of-field calculation 

32

Depth-of-field / visual preview 

32

Infrared focus settings 

32

Focus aid 

32

CF adapter 

33

 

Summary of Contents for CFH

Page 1: ...22 MPix 39 MPix 22 MPix 39 MPix User Manual Language version English Manual version 2 2006 Camera firmware version 9 1 2 or later Digital back firmware version 166 or later ...

Page 2: ...computer 56 10 Storage working with media and batches 57 Batches 57 Navigating media and batches 57 Creating new batches 59 Using Instant Approval Architecture 60 Reading and changing approval status 61 Browsing by approval status 62 Deleting by approval status 62 Introduction 4 Parts Components 8 1 Quick Start 9 2 Function Control Display 14 Grip LCD 16 Viewfinder LCD 18 3 Camera Body 23 Carrying...

Page 3: ...k sensor unit 137 Equipment care service and guarantee 139 11 Overview of viewing deleting and copying images 63 Basic image browsing 63 Choosing the current batch 63 Browsing by approval status 63 Zooming in and out 64 Zooming in for more detail 64 Thumbnail views 64 Preview modes 65 Battery saver mode 67 Full screen mode 67 Overexposure indicator 67 Deleting images 68 Transferring images 68 12 M...

Page 4: ...ronicleafshutter flashsyncatallshutterspeedsto1 800s eyelineviewfinderwith100 view dotmatrixviewfinderLCD lithiumorrechargeablebatteryoptions shutterspeedsfrom 18 hours to 1 800s user customization of functions bracketing interval timer rapid access userbutton flashmeasure integraldiopteradjustmentinviewfinder zonesystemcapability time lapsephotography customizedprofilesandsoon Filmuserscantakeadvantage...

Page 5: ...RGB colour space withitsout of the boxquality andusedinFlexColoritremovesboth the need for experimenting with different colour profiles to get opti malcoloursandtheneedforselectivecolourcorrections DNGFileFormat For those familiar with Photoshop and the Adobe Camera Raw con verter the 3FR files can be converted directly into Adobe s raw image formatDNG DigitalNeGative bringingthisnewtechnologystand a...

Page 6: ...our own pace and explore the possibilities when you feel ready for the next step Results will be good fromthewordgo that sguaranteed butwhenyouwanttomakeimprovementsorworkmore efficientlyperhaps thecapabilitiesarethereforyou The supreme Hasselblad potential is there it s up to you to exploit it YournewHasselbladcameramayhavebeensuppliedinkitformorasseparateitems Thereareanumberof possiblecombination...

Page 7: ...puter system requirements H2D and CFH only Digital files naturally end up on a computer for processing Image storage and correction requires a certain minimum standard regarding computer capabilities Large images will require a high performance computer with plenty of memory advanced graphics capabilities and a recent operating system In most cases the computer should include a FireWire 800 400 con...

Page 8: ...tton 25 Battery holder 26 Flash unit 27 Viewfinder screen 28 Focus assist light 29 Mirror 30 Distance and depth of field scales 31 Focusing ring 32 Lens shade bayonet 33 Filter screw thread 34 Databus connection 35 Viewfinder release button 36 Flash unit catch 37 Viewfinder attachment hook 38 Viewfinder databus connection 39 Magazine release button 40 Flash PC socket 41 Camera strap lug 42 Lens release...

Page 9: ...bly process should take no more than sev eral minutes to complete and when the battery is charged you will be able to take simple and straight forward photographs immediately All the information is repeated later on in the man ual as well as much more in depth information under the relevant sections and headings for easier search access ...

Page 10: ... and aligning the two upper lugs with the slot slide it back into position as far as it will go Swing back the battery holder retaining lever until it clicks back into place 6 Remove the front protective cover from the camera body by keeping the lens release button depressed and rotating the cover counter clockwise until it is released 7 Remove the lens shade by turning it clockwise 8 Remove the r...

Page 11: ...be because you are holding the card back wards or upside down Experiment until you find the orienta tion that allows the card to slide in easily 18 When the card is able to drop very easily nearly all the way into the sensor unit then you are doing it right Once you have achieved this press the card firmly into place until it sinks another couple of millimeters into the sensor unit and is held fast ...

Page 12: ...gazine 26 The film will now be wound automatically by the camera to the first frame position if the camera is in active mode Otherwise activate the camera by holding down the ON OFF button for half a second 27 Fold out the magazine slide key and turn it counter clockwise 360 until it stops Fold the key back into its storage position 28 Ensure the magazine setting lock is in the forward unlocked posi...

Page 13: ... observing the changes on the LCD on the grip as well as the LCD in the viewfinder and finally to ensure the camera is at the standard setting 33 Click the ON OFF button 34 The LCD then displays the Profile screen 35 Turn either the front or rear control wheel until Standard is highlighted 36 Press the AF Load button That s it Your Hasselblad camera is now operational in fully auto matic mode In aver...

Page 14: ...tions All functions and settings on the H2 D are accessed and altered by the control buttons and wheels on and around the grip aided visually by the LCD user interface The information on the grip LCD is in menu format andhasagreatdealincommonwiththosefoundin modern computers cell phones etc It is pixel based and therefore has a greater capacity to produce user friendly symbols ...

Page 15: ... USER button User assignable function button button No function at present Shutter release button Activates camera and releases shutter FLASH CONTROL LOCK button Lock settings to avoid inadvertent change Also accesses flash settings AF button Accesses focus modes DRIVE button Accesses the various drive modes Front control wheel Accesses and changes various settings MENU button Accesses menu Illumin...

Page 16: ...ures in that option is chosen by the rear control wheel front control wheel rear control wheel Setting information The lower row on the screen displays information about the cur rentstateofthesetting Inshort theupperrowdisplayswhatyou cando andthelowerrowdisplaysthecurrentstateofsettingsor what you have done Typical camera grip display The information in brackets describes this particular example ...

Page 17: ... a few seconds to display new settings The following is a list of the various terms describing the various actions that appear in the menu on the grip LCD Enter moves screen down one level on the menu Exit moves screen back up one level on the menu Does not save any settings Off deactivates the particular function being set On activates the particular function being set Sel Select selects the chara...

Page 18: ...r speed setting 1 30 second Exposure compensation setting 0 7 EV Flash LED Warning triangle LED Metering method setting Centre weighted Focus Aid LED Exposure counter Viewfinder LCD Some examples of various viewfinder LCD screens visible with standard settings and when specific control buttons are pressed Normal screen Normal screen in AE lock state Normal screen with xposure compensation set Standar...

Page 19: ...thereby appearance of various combinations of symbols on the LCD at any time will not necessarily be the same as many of the screens illustrated in this manual To simplify the descriptions reference is often made to a main or standard screen Apart from default settings there is no ac tualstandardsettinginthenormalsenseandthereforeyoucre ateyourown standard whichofcoursecanbechangedatany time The m...

Page 20: ...L select buttons for many other settings DRIVE button SAVE ENTER D This is a triple function button It will access the drive settings screen on the LCD from the working screen See separate section for full details It also acts as the SAVE and ENTER buttons for many other settings Front control wheel E The front and rear control wheels are turned to make changes in exposure settings in the main scr...

Page 21: ...y of these buttons is particularly useful and can save you a great deal of time and effort depending on how you work You are advised to inves tigate their potential fully See under Custom settings for full details On the front of the grip there are two more control buttons plus the remote cord release port M UP button M Press this button to raise the mirror and press again to lower it toggle functi...

Page 22: ...djustment button Q Press this button to access the EV compensation screen Settings are made with either the front or rear control wheels An EV correction symbol appears on the grip and viewfinder LCD as confirmation EXP button R The EXP Exposure button accesses the exposure mode and metering method options screen Settings are made with the front and rear control wheels and the appropriate symbols ap...

Page 23: ... recorded and freelyaccessibleforserviceintervals etc The integral ergonomic grip houses the main control interface and also contains the battery holder An auxiliary shutter in the rear openingofthecamerabodyprotectsthesensorunitfromexposure duringthevariouscameraprocedures Pleasetakeextracarewhen handling the camera body without a protective cover or the sen sor unit in place to protect the auxil...

Page 24: ...back the safety collar fig 2 to ensure the hook remains in the locked position between the small protruding lugs The collar is purposely a tight fit and might need some effort to slide Rechargeable battery grip 3 4 The H2 D requires battery power for all actions Being a completely digital camera there is naturally no mechanical reserve facility It is therefore advisable to keep the reserve grip compl...

Page 25: ... the two upper lugs with the slot in the grip slide it back into position as far as it will go Swing back the battery holder retaining lever until it clicks back into place Please note if you want to use the rechargeable battery with anH1 H1Dmodel thefirmwareinthecameramustbeversion 8 2 2 or later for the battery grip to function properly Rechargeable battery grip general Thebatteryshouldbechargedf...

Page 26: ...ry is correctly oriented see the markings on the bat teries and the cassette fig 10 11 Re insert the cassette into the battery holder ensuring that it is seated properly in place and that the red button returns fully into the locked position Holding the battery holder flat against the grip and aligning the two upper lugs with the slot in the grip slide it back into position as far as it will go Swin...

Page 27: ...y SeekadvicefromanAuthorizedHasselbladServiceCenterifthe screenbecomesparticularlysoiled Rememberthatparticlesor greasymarksonthescreenmightimpairtheviewfinderimage but have no effect whatsoever on the recorded image Accessory connection 16 17 On the left hand side of the camera body are two accessory retaining screw threads M5 as well as a databus connector protected be neath a cover The screw thre...

Page 28: ...pot light metering area for accuracy in exposure estimation The in formation display located beneath the viewing frame is continu ally updated and visible and is back lit for optimum visibility This LCD also duplicates much information visible on the grip LCD for immediate checking In addition to the LCD there are four LEDs providing general warnings flash and focus information Theviewfinderalsofeat...

Page 29: ... needed to adjust the eyepiece to suit most requirements The diopter range is from 4 D to 2 5 D Eyeglass wearers can rapidly and accurately change the settings according to whether they wish to wear eyeglasses for viewing or not Personal eyepiece adjustments can be carried out by pointing the camera at the sky or similar smoothly toned area While holding the camera in your left hand you can with y...

Page 30: ...oft pleasant looking boké the visual qual ity of the out of focus areas of the image All lenses feature an electronically controlled central shutter designed to extremely fine tolerances for supreme accuracy that also provides flash syn chronization with all speeds from 32s to 1 800 s All lenses have a very rapid automatic focus capability with instant manual over ride To ensure reliable and fast au...

Page 31: ...released for removal and attachment by insert ing a thumb and index finger into the recesses and pinching in the direction of the arrows Filters Filters have a screw thread fitting 67 77 95 mm according to lens and are screwed clockwise into place As there is no rotation of the front section of the lens when focus is changed filters do not rotate either This is particularly useful when using polarizi...

Page 32: ...by depressing the STOP DOWN button while viewing the image on the viewfinder screen Infrared focus settings 9 As infrared rays form an image at a different plane to that formed by visible light the normal focus settings do not apply Proceed as follows in manual focus mode 1 Focus the lens in the conventional manner until satisfied 2 Note the distance setting against the central lens index 3 Re align ...

Page 33: ...odies This automatically expands the potential lens range for H cameras by more than a dozen different focal lengths The auto matic focusing system in the H camera can be used as a guide for manual focus setting Light is measured at full aperture with all lenses which produces aperture and shutter speed information display in the camera for manual setting With CFE lenses how ever a preset aperture ...

Page 34: ...agazine is a sophisticated semi independent unit within the modular system It has its own power supply for in dividual information storage LCD panel illumination etc Much information is transmitted and received between the magazine and the camera body so ensure the databus con nection is kept clean and not damaged in any way It is advis able to fit the magazine protective cover when storing a film m...

Page 35: ...l the time you keep the button depressed up to a maximum of 10 seconds After 10 seconds has expired you must release the pressure on the button and press again to obtain a further 10 second period of illumina tion Remember that using the illumination function very often will noticeably shorten the life of the battery in the magazine When the magazine is attached to the camera the button on the mag...

Page 36: ...moved from camera If you attempt to make an exposure when the darkslide is closed however you will receive a warning message in the viewfinder and grip LCDs The darkslide is closed Film tab holder I Holds an ID tab from the film roll pack as a reminder of the type of film loaded Don t forget to change it if you change film type Film holder key J Secures the film holder in the magazine Fold out the key ...

Page 37: ...ion After battery replacement the magazine s parameters return to the default settings Barcode 120 Data on Count up Attaching and removing the magazine 3 4 You cannot remove a magazine from the camera body if the magazine darkslide is not in place when the magazine darkslide indicator on the magazine shows white Neither can you withdraw the magazine darkslide when the magazine is not attached to t...

Page 38: ...r the button to reach the required set ting 4 The new setting will be saved automatically after a time out of five seconds 5 Return the LCD settings lock to the locked position If you use both standard and barcoded films or overridden barcoded films check that you have changed the settings accordingly Film length number of frames Both 120 and 220 films can be used 120 film will produce 8 for use with h...

Page 39: ...remaining or countdown Absence of this word implies the opposite namely count up so it denotes the number of the next frame to be used for example the figure 4 means three frames have already been exposed This information is also automatically displayed on the grip LCD and viewfinder LCD though only as a figure above a symbol To access frame counter setting 1 Ensure the magazine settings lock is in t...

Page 40: ...rn ing the film holder key clockwise 90 to lock the film holder in place and fold the key back into its stored position You might find that increased pressure on the left hand side of the film holder will more easily ensure a positive and correct position ing in the magazine If the camera is active or in standby mode the film will be wound automatically by the camera to position the first frame this fun...

Page 41: ...roved workflow are the results of such a design that featuressharedinformationvisibleontheLCDs OLEDaswell as a shared battery for example FlexColor the image processing software that is included with an H2D or CFH can take advantage of the information that is stored with each capture both for future reference and for enhanced processing to fine tune optical characteristics for example FlexColor also...

Page 42: ...all the digital aspects of camera operation from a computer using FlexColor See the separate FlexColor manual for further details As the H2D and CFH are purely electronic devices attention to power supply is vital When working untethered it is therefore important to plan either battery loading or battery replacement to ensure continued workflow Likewise image storage is limited particularly when us...

Page 43: ...sing the menus OLED screen A Displays preview images and the menu system even in bright light and from acute angles Microphone B Function currently not used MENU EXIT button C Opens and closes the menu system Also used for various other tasks EXIT button for example as you issue commands within the menu system indicated by a label beside the button on the preview screen View mode button D Steps th...

Page 44: ...amera WARNING never attempt to remove the glass filter you will probably ruin the CCD if you do so See Cleaning the CCD section for cleaning Mounting plate P This plate which has a slot just behind it fits onto the magazine retaining hook on the back Flash sync input CFH only Q Flash synch connector protected behind a rubber cover for use with a view camera Not required when an H2 is used Flash sync...

Page 45: ...ISO value shown By pressing either button the alternatives appear 100 200 400 and then back to 50 again both on the list as well as on the upper low to the left in the case of ISO value Pressing the EXIT MENU button will then confirm the new setting In the next example on the left the name of a new batch is changedbypressingacombinationoftheZoom in Zoom out SELECTION buttons as well as the navigat...

Page 46: ...ktotheoriginalfactory settings MISCELLANEOUS Setsthewaythecamera digitalbackappearstoa computer Alsodisplays firmwareversion USER INTERFACE Setsmenulanguage power down sound date time andseveralothercustom settings STORAGE SETTINGS DEFAULT APP LEVEL Assignsadefaultapproval status classification toall newimages COPY Usedforoff loadingimages fromaflashcardtoan Imagebank By using the buttons on the contr...

Page 47: ...press and hold until the delete dia log opens See MAIN MENU Delete for full details Don t forget the menu shortcuts To help you work faster the digital back provides shortcuts to some of the most commonly used menu commands that do not otherwise have a dedicated button on the front panel These are accessible by pressing and holding one of the front panel buttons for a second or so These are mentio...

Page 48: ...on the cover from the mounting support plate of the CFH CAUTION Be very careful not to touch or scratch the CCD filter surface while it is exposed Keep thecoverinaconvenientplaceasyoumustalwaysreplaceitwhenyouremoveand or store the CFH 2 Rest the mounting plate of the CFH on the magazine support hook on the camera body ensuring that they are correctly positioned The end of the support shelf is angl...

Page 49: ...surface 5 Replace the CCD filter cover by hooking the bottom edge of the cover behind the mounting plate of the CFH and then pressing the top of the cover against the back until it clicks into place Using with a Hasselblad H1 Using with a Hasselblad H1 Camera The H1 was Hasselblad s first camera specifically designed for both digital and film based photography The CFH and H2 are the next generation in...

Page 50: ...era following the instructions given in the adapter user manual 2 Carefully remove the CCD filter cover and keep it in a place where you can find it again You must always replace it when you remove and or store the CFH CAUTION be very careful not to touch or scratch the CCD filter surface while it is exposed 3 Attach the CFH directly to your adapter exactly as you would a film magazine 4 Connect the fl...

Page 51: ... the FlexColor software 2 Take light meter readings and set aperture and shutter speed as would be appropri ate for exposing film of your selected ISO rating 3 Using FlexColor set the camera back exposure time to be just slightly longer than the value to found for the camera body 4 Press the shutter release on your camera body to take the picture This will trigger the CFH computer and if connected ...

Page 52: ...eed as follows 1 Press the MENU EXIT button to open the menu 2 Press the NAVIGATOR button and to select the SETTINGS sub menu 3 Press the NAVIGATOR button to open the SETTINGS menu 4 Press the NAVIGATOR button to select the USER INTERFACE sub menu 5 Press either ZOOM button or to choose a new lan guage in this case Spanish 6 Press the MENU EXIT button again to close the menu Initial General Settin...

Page 53: ...t and cablage needed that might restrict mobility in some cases 3 Tethered Studio mode This mode enables you to connect your H2D CFH directly to a computer and to oper ate the system using Hasselblad FlexColor software and store images on a computer hard disk The main advantages with this mode are the almost limitless storage capacity and being able to work on the images with Hasselblad FlexColor ...

Page 54: ...otal number of shots you can fit on the card You can purchase additional possibly larger capacity cards and change them as each card becomes full Notethatthecameracancopythecontentsofitscompactflash cardtoanImagebank evenwhennocomputerisattached This enablesyoutobackupyourshotsandthenclearspaceonthecard tokeeponshooting Seesectionon TransferringImages Inserting a card 1 Open the CF card slot cover o...

Page 55: ...several media are mounted you must be sure to select the correct destination medium see also Working with Media and Batches Working with a Hasselblad Imagebank The Imagebank is an optional add on for your digital camera system It is essentially an external FireWire hard disk optimized for digital photography providing extensive storage space and high speed data transfer It is small light and batte...

Page 56: ... the sensor unit are disabled The sensor unit will take power from the FireWire cable if it is available not all computers supply power here notably laptops This will help conserve the battery power of the H2D CFH However you must still have a charged battery connected to the H2D the camera body requires this battery in order to operate When initiating a shot from FlexColor the computer sends a si...

Page 57: ... image will be saved in the latest created batch only You cannot select any other batch to save a new image in Navigating media and batches The camera always works with a current medium and a current batch This is the location at which the camera will save all new shots and the location in which you can browse us ing the navigator button on the front panel There are two ways of selecting the curre...

Page 58: ...ted The blue frame around the CF card symbol tells you that captured images will be saved to the CF card and not the FireWire disk This is the CurrentMedium The BATCH list The blue frame around a folder tells you that it is the CurrentBatch You work your way deeper into the menu branching off the selected item framed in blue each time you press the button to view media batch thumbnail view etc Conv...

Page 59: ...he currently selected medium shows a blue border 5 Press the zoom in button to zoom in on the currently highlighted medium 6 A list of batches on this medium now appears Each batch appears as a folder icon with a name and the date on which it was created As with the media list you can read the number of shots of each approval status that are stored in each batch 7 As with media use and to highligh...

Page 60: ...take many more pictures when shooting digitally By assigning approval levels as you work it can be much easier to sort through and select images when you get back to your computer Standard Instant Approval workflow The standard method of working with the Instant Approval Architecture is as follows 1 Take a shot 2 The camera analyzes the shot to find out if it seems to be over or underexposed If it s...

Page 61: ...status regardless of the exposure warning Be careful when assigning red status because red images may be deleted if the current storage medium becomes full Reading and changing the approval status The current approval status of each shot is indicated in two ways Inmostpreviewmodes thecurrentstatusisindicatedbyacoloureddotinthebottom right corner of the screen Eachimageisgivenanamethatindicatesitsa...

Page 62: ... See Setting the Browse Filter for a detailed procedure Deleting by approval status There are many ways to delete images including one at a time and multiple delete by batch media and or approval status When deleting several images you first pick the medium or batch from which you want to delete and then use the MAIN MENU STORAGE Delete entry to specify the status of the images to delete You can ch...

Page 63: ... ing out to the batch or media level and then zooming in on the appropriate folder See Navigating Media and Batches for complete details about how to select the current medium and or batch Browsing by approval status It is possible to set the camera to browse only images of one or more specific approval levels from the current batch You can use this for example to review all of your red status shot...

Page 64: ...utton to return to brows ing at the standard zoom level Thumbnail views Preview thumbnails are small versions of each preview sized to fit either four or nine images on the screen at once Use them to get an overview of your work so far and to help find specific shots To see the thumbnails start with the standard preview display and press the zoom out button once to see four thumbnails or twice to see...

Page 65: ...screen preview shows the preview only with no frame or settings information To cycle through the various modes press the view mode button on the front panel The order is circular as listed above Each mode is described in detail in the sub sections below Regardless of the current mode if you zoom in on the image or zoom out to the thumbnails the display reverts to showing the standard preview frame...

Page 66: ...ghts The histogram is only an indicator thast should be interpreted there are many situ ationsinwhichaquestionablehistogramwillmatchanexposurethatisperfectlyfine for the intended effect and vice versa Full details mode D In full details mode you can read a complete list of camera settings plus see the histo gram and in the background a darkened preview of the image The camera setting details are sto...

Page 67: ...set a display time out See also EntriesoftheUSERINTERFACEMenu and MakingDisplaySettings fordetailsabout these settings Full Screen Mode 1 In full screen mode you can browse your images at standard preview resolution without any distracting data surrounding them Because the current approval setting is not shown in full screen mode the approval button has no effect This will prevent you from accident...

Page 68: ...rocess See your FlexColor manual for details See also Connecting to the Computer for details about how to connect to a computer Another way to transfer images to your computer is to remove the compact flash card from the digital back and insert it into a compact flash card reader connected to a com puter See Using Compact Flash Memory Cards for details about how to remove and insert the card The H2D...

Page 69: ... menu items and use the and buttons to change the selected setting See also The Control Panel for button diagrams and descriptions Any given menu may include both entries and or sub menus Entriesaresettingsthatareavailableatthecurrentmenulevel theyshowtheircurrentset tings next to the entry name To make an entry setting use the navigator button to select the entry and then use the zoom and buttons...

Page 70: ...70 Menu structure Entries of the main menu ...

Page 71: ...tings The ISO rating can be set to 50 100 200 or 400 To set the ISO 1 Select the MAIN MENU ISO entry This is the top entry of the top menu so it will be selected by default when you enter the menu system See also Navigating the Menu System for details about how to find this setting 2 Use the or button to step through the available ISO settings until the setting you want is shown 3 Either move on to...

Page 72: ...ote that white balance settings are for your viewing convenienceonly Thesettingistemporaryforpreviewdisplay reasonsandinnowayaffectstherawfilewhichremainsneutral awaiting further processing Media The storage setting controls where your digital back will store new images and which stored images will be visible in the browse window Often you have just one type of storage media available the internal c...

Page 73: ...Green browses only green status images from the current batch These are either new shots that did not trigger an exposure warning or shots that you manually assigned to green after overriding an exposure warning Green Yellow browses green and yellow status images but does not show red status images These are probably images that you have either decided to keep or not yet checked for approval statu...

Page 74: ...74 Navigating the STORAGE settings Menu Storage Thissectiondescribesfilestorage file transference storage organi zation file classification and re lated subjects 13 ...

Page 75: ...ete all images of a specified approval status e g red from a batch or medium DELETE In this example one image is to be deleted from a batch contain ing nine images To delete a single image 1 From a preview image which is being kept use the but ton to go to the nine thumbnail in this case view 2 Use the navigator button to select the image you wish to delete When you are viewing thumbnails the selec...

Page 76: ...nu System for details about how to find this setting 2 Use to enter the Delete submenu 3 Use the or button to select A This image deletes the current image only B All red in batch deletes all red images in the current batch C All yellow red in batch deletes all yellow and red images in the current batch D All in batch deletes all images in the current batch 4 Press OK to confirm the delete to exit w...

Page 77: ...l be deleting from all batches stored on that item Notethatbotheachlistedmediumshowsasetofthreecoloured numbers in parentheses to the right of the medium name These indicate the total number of images of each approval status green yellow and red that exist on the medium For example if you see a medium that shows 18 5 3 then the medium contains a total of 26 images 18 green approved 5 yellow unclas...

Page 78: ...You are now asked to confirm the delete 7 To confirm press the button to change the status to Yes and then press the OK button to execute the delete Tocancel pressthemenubutton toexit orpressthe buttonto set the status to No and then press the OK button to cancel You now return to the main menu Either move on to another setting by using the navigator button or 8 Press the menu EXIT button to exit th...

Page 79: ...dforthepurposeofdelet ingallimagesonadisk Thisissometimesfasterthanusingthe delete function but it is not as flexible because all data from all batches will always be erased To format media 1 If you have more than one type of medium connected e g a compact flash card and Imagebank then start by select ing the medium you wish to format using the Storage entry of the main menu see also Selecting the C...

Page 80: ...edia use a FireWire cable to connect the external media to the H2D CFH and then 1 Press the MENU button 2 Press to navigate down and select the Storage dialog 3 Press and then to navigate down and select the Copy dialog Press to open the Copy dialog If you have only one disk attached then skip this step If you have more than one disk attached then press to select the From card to entry Then use th...

Page 81: ...ments by one with each new batch Following this is five letters which you can assign yourself to help make the batch easier to identify To set the letters Use and to select one of the five letters Then use the or button to step the currently selected letter up or down the alphabet until you have found the letter you want Continue working until you have set the name you want 4 Press the approve OK bu...

Page 82: ...nalysis results A typical strategy could be to as sign all shots to yellow and then review all of the shots later and promote only the best ones to green status At the same time you might demote the most doubtful shots to red status See also Using Instant Approval Architecture for complete details about working with the approval system To change the default status assigned to each new image 1 Pres...

Page 83: ...83 Menu Settings There are a number of settings grouped under the general Settings heading which are User Interface Camera Miscellaneous Default 14 Navigating the USER INTERFACE settings ...

Page 84: ...ng Instant Approval Architecture This menu entry has Volume choose between High Low and Off Key Click choose between On and Off and Exposure Warning choose between On and Off Date Time The H2D CFH has an internal clock that keeps track of the date and time This information is used to mark each shot with the date and time at which it was taken It is also used to label batches with the date on which ea...

Page 85: ... for all exposures from 1 8 sec through 1 2000sec However this setting should be changed in accordance with the time required if it exceeds 1 8 sec Times of up to 32 seconds can be set If you prefer you can connect the Flash sync input cable between the lens PC socket and the CFH which allows you to retain the default setting of 1 8 second while still being able to use exposure times longer than 1...

Page 86: ... with lens control Rollei elec tronic shut ter with lens control View camera adapter for Hasselblad H1 not available from Hassel blad Any view camera with Hasselblad H1 adapter Flash sync input cable Hasselblad CFH Connectivity diagram CFH only Navigating the CAMERA settings ...

Page 87: ...u system and keep your settings Options available for PINHOLE and FLASH SYNC Shutter Delay The normal setting is Default and cannot be changed Exposure Time This setting should be changed for cable free exposure times longer than 1 8 second ensuring that it matches the set shutter speed on the camera lens The settings range from 1 8 second to 32 seconds 1 8 second is the default setting Capture Se...

Page 88: ...TINGS sub menu 3 Press to open the SETTINGS menu 4 Use and to select CAMERA 5 Press to open the CAMERA menu 6 Press either the or button to select PINHOLE 7 Press or to select EXPOSURE TIME 8 Press either or to make an exposure time setting 9 Press to select CAPTURE SEQUENCE 10 Press to open the CAPTURE SEQUENCE menu 1 2 3 4 5 6 7 8 9 10 ...

Page 89: ...e sequence 14 Press to select COUNT 15 Press either or to make a COUNT setting This setting controls the number of exposures in the sequence 16 Press OK to confirm all the settings 17 The CFH is now ready for sequence start Note that the MENU EXIT button now diplays START instead 18 Press START to set the sequence running 19 Note that the EXIT button now displays STOP The sequence can be stopped at...

Page 90: ...itself to your computer as a mass storage device This means that it will look like a hard disk which you can navigate to open and read using the standard tools for your operating system e g the Finder in Mac OS or the File Explorer in Windows To set the interface presented by the digital back to your operat ing system 1 Select the MAIN MENU SETTINGS MISCELLANEOUS Interface entry The current settin...

Page 91: ... portant to know the serial number and current firmware revision of your digital back To find this out 1 Select MAIN MENU SETTINGS MISCELLANEOUS About See also Navigating the Menu System or details about how to find this setting 2 Press to open the About dialog which shows the serial number and firmware version 3 When you are done reading the information press the menu EXIT button to return to the MIS...

Page 92: ...se are accessible by pressing andholdingoneofthefront pan elbuttonsforasecondorso These arementionedwhereappropriate elsewhere in this manual but we summarize them here for your convenience Try to memorize these quick actions to save time and effort later To set the browse filter To delete images To toggle the over exposure indicator Press and hold until your preferred filter is indicated See also Us...

Page 93: ...and auto maticensuringconsistentlycorrectexposuresettingsevenin difficult and changeable lighting situations Light measurement is made through the lens TTL by the AE viewfinderandexposureiscontrolledmanuallyorautomat ically by the control wheels and or settings The information is visible on both the grip LCD and the viewfinder LCD A great deal of control is available ranging from 100 manual through to...

Page 94: ...native exposures to suit personal preference ExposuresaredisplayedonthegripLCDtowithin1 1 2and1 3EVtolerances de pendentonsetting Thismeansthat half stops areshowninaformthatcandiffer from more traditional displays For example the position between f 8 and f 11 is displayedasf9 5andlikewisethepositionbetween1 30sand1 60sisdisplayedas 45 Therefore a display showing f 9 5 45 simply means f 9 5 at 1 45...

Page 95: ... are controlled by the camera either partially or completely according to setting Within this mode there are four choices Please see the Appendix for P and Pv mode charts that describe the aperture and shutter speed setting combinations MANUAL EXPOSURE M 1 2 3 4 Manual mode will provide total user control of the shutter and aperture settings To set the Manual mode proceed as follows with the camer...

Page 96: ...you by turning the front control wheel and the aperture is auto matically chosen by the camera Programmed P In this mode an aperture shutter combi nation is chosen by the camera according to the EV measured metering method remains as your choice though only within pre set appropriate limitations to suit various requirements and applications Programmed variable Pv This mode is very similar to Progr...

Page 97: ...utter speed settings b The AE L button also allows the spot metering function to make tonal comparison readings and brightness range checks When the AE L button is pressed the metered area is saved as a mid grey When the spot area is then placed over another part of the scene the new area is then compared to the saved area and the difference can be read off the scale seen in the viewfinder For exampl...

Page 98: ... 2 3 4 5 The exposure compensation facility for both manual and automatic modes can be set from 5 to 5 EV in 1 3 EV increments This facility will adjust the exposures by the set amount until changed and the setting is visible above the scale in the viewfinder and as a symbol on the grip LCD To make a fixed exposure compensation setting proceed as follows with the camera in active mode 1 Press the bu...

Page 99: ...a great deal of control of how you work in the future By taking advantage of the many features available you might well find your normal practices changing for the better As all features areusercontrollable youtailorthewaythecameraworksaccord ing to your preferences Features such as the Quick adjust wheel and Profiles for exam ple do not have to be used of course but you are advised to read about t...

Page 100: ...om Options OFF From the active screen press not click the red ON OFF button for a half second All buttons except the ON OFF button remain ineffective producing minimal demand on the batteries This is the normal mode when transporting or storing the camera or where there might be a risk of inadvertently activating the camera However remove the batteries if you are going to store the camera for a per...

Page 101: ...sired The operative distance is approximately six metres from the camera Alternatively a suitable attached flash unit that has a similar facility a Metz54 70 forexample canalsobeusedinstead Thisfeaturecanbealteredinsettings seeunder Custom options AF assist light TheautofocusrangeontheHC4 120Macrolenscanbelimitedbyaspecificsetting on the camera allowing for near range far range or full range This on...

Page 102: ... need to make a new setting just rotate the focusing ring in the conventional manner As the lens barrel does not rotate in autofocus mode you can hold the focusing ring for instant manual adjustments as you would with a conventional lens However to retain the new manual focus adjustments you must maintain the pressure on the shutter release button You can instantly return to the automatic focusing...

Page 103: ... the shutter release button and then press again In camera active mode 1 Press the DRIVE button on the grip 2 Turn the front control wheel to Single 3 Press Save to store the setting Continuous In Continuous mode the camera automatically makes exposures and makes ready for the next exposure in a continuous manner as long as you maintain pressure on the shutter release In camera active mode 1 Press...

Page 104: ...normalflashsync autofocus single singledrive autoexpo sure aperture priority average metering user button None Full auto normal flash sync autofocus single single drive pro grammed exposure centre weighted metering user button None Studio normalflashsync manualfocus singledrive manualexposure spot metering user button AF drive Fill flash normalflashsync adjustedoutput 1 7EV autofocus single single dri...

Page 105: ...rom the main screen click PROFILES ON OFF button on the grip and the profile screen will appear 2 Use either the front or rear control wheel to scroll through the list and highlight the desired profile 3 Press Load AF button The camera is now set according to all the parameters stored according to the name Changing a profile name You can change a profile name except Standard at any time Proceed as fol...

Page 106: ...m from the system Some features are a little more special bracketing for example This is fairly normal practice for many photographers and the H system can provide a good deal of control and fine tuning of this particular feature The custom options are designed to work for you in the back ground ensuring security and also helping to bring down the barriers between you and capturing the image Each o...

Page 107: ...ing options Interval options Settings options Info options Custom Settings This configuration of 30 options appears with the H2 model with a film magazine attached only 28 options are available with an H2D or H2 with CFH attached See later secton for more details H2 only H2 only ...

Page 108: ...the mirror movement Normally the mirror is raised before the shutter is tripped creating a pause between the two actions to minimize camera vibration However during this pause there will be no image in the viewfinder and no light metering available for any eventual exposure change Therefore the Self timer function can be set to a sequence where the delay is followed by the mirror being raised inste...

Page 109: ... goes down Mirror remains up choice Turn the rear control wheel to choose Mirror goes down Mirror returns to its normal position and the camera is made ready for the next exposure Mirror raised Mirror remains in raised position No image is visible in the viewfinder until M UP button pressed 8 Press On AF button Note that this now reads Off and the line of text at the bottom of the screen reads Self ...

Page 110: ...s required the order in which they should be taken and by how much EV deviations there should be and the setting made accordingly The first metered exposure Manual or Auto is the EV that determines the calculations for the bracketing sequence Note the difference in operation between Single and Continuous drive settings In Single you must press the shutter release button separately for every separate...

Page 111: ...lease button to standby mode for this function press the shutter release button again full press for activation or full press the shutter release for immediate acti vation To escape from this mode press MENU then Enter DRIVE button on the Bracketing screen then Off AF button Check the lower text row on the screen for ON or OFF status The default setting is a shutter speed change in a bracketing seq...

Page 112: ...of exposures turn the rear wheel to choose the number of exposures required 2 no limit 6 In Interval duration turn the rear wheel to choose 1 second 1 hour 7 Press SAVE DRIVE button to save the setting 8 Press ENTER DRIVE button again from the Interval screen to activate the function Press On AF button Note that this now reads Off and the line of text at the bottom of the screen reads Interval on H...

Page 113: ...ss the DRIVE Enter button on the grip 4 Turn the front control wheel to access 4 1 Custom options 5 Press the DRIVE Enter button to access the choices avail able 6 Turn the front control wheel to the desired Option 7 Turn the rear control wheel to the desired Setting 8 Press Save As a shortcut to the Custom Option level press MENU and then the USER button After making any changes press the shutter...

Page 114: ...titleinstead of the number or use the BLACK figures for H2D or H2 CFH models the GREEN figures for H2 models with film magazine attached Sets which function will be immediately activated when the User button is pressed you cannot alter the setting in this mode though only use it The button has a toggle function so that by pressing it again the new setting will be de activated AE Lock button function ...

Page 115: ...n when the camera is moved the areas within the central spot are indicated by their zone values Focus aid in MF 14 15 Half press Always Off Sets how the focus aid arrowhead LED sym bols appear in the viewfinder display in manual focus mode Half press makes them visible when the shutter release button is pressed half way Always makes them visible all of the time when camera is active Off disables them...

Page 116: ...s enables the display No disables the display Show ISO 23 25 Yes No Allows the display of ISO settings on the grip LCD Yes enables the display No disables the display Bracket param in Manual 24 26 Shutter speed Aperture Selects either the shutter speed or the aperture as the parameter which changes in a bracketing sequence when in Manual exposure mode Shutter speed selects changes in shutter speed...

Page 117: ...the relevant basic information only aperture shut ter and exposure correction Date Time prints date time only the correct date and time is set through the Settings menu under Date Time Text Date prints text plus date Text Info prints text plus basic info Text prints text only that you have created in 4 2 2 Text Imprint type setting 1 Press the MENU button on the grip 2 Turn the front control wheel...

Page 118: ... and the Sel AF but ton is pressed the character highlighted in the text line lower down the screen will be deleted When an arrow in the box is highlighted the text line cursor moves along the text line in the arrow s direction moving past every character with every click on the Sel AF button to the desired position The highlighted character in the text line can then be replaced by a new character...

Page 119: ...e right of the character that is to be changed Turn the front and rear control wheels to move the selector cursor until the X symbol is highlighted 2 Press Sel AF button and the character will be erased 3 Repeated pressing of Sel will progressively erase all the char acters in the line 4 After erasing unwanted text turn the front and rear control wheels until the desired character is highlighted b...

Page 120: ... DRIVE Enter button 6 By turning the front control wheel you can move the cursor to mark the following for change hours minutes year month and day respectively By pressing the 24 h button AF you can choose between a 24 hour or 12 hour system for time 7 Turn the rear control wheel to make the changes when the cursor is correctly positioned 8 Press the Save DRIVE button to store the new setting 8 H2...

Page 121: ... control wheel to access Info 5 Press the Enter DRIVE button 6 Press the Enter DRIVE button The display now shows a list of camera components and to the right of each individual component a figure that represents the number of actions taken by that component Please note that even a completely new camera will have registered actions as these occur dur ing testing before delivery 7 Press the Next DRI...

Page 122: ...e advantage of the accuracy and certainty of the autofocus system while retaining the control inherent in manual focusing mode Aquickwaytoprogramthecustomizablebuttons and to access the Custom Option level in general is to use the short cut as follows 1 Press the MENU button 2 Then press the USER button Thisdirectlyaccessesthe Customoptions levelinthemenu where you can access the desired option fo...

Page 123: ...tua tions where flash is required Itincludesanintegralflashprimarilyintendedforfill flashusebut strong enough for simple close work Combined with an adapter and a portable unit H cameras can exploit the automatic features offered by Metz and other top names in the field for powerful and reliable solutions Wheninthestudio theHsystemiscapableofprovidingflashme tering for maximum control and security ...

Page 124: ...r camera could be damaged General When using the A or S setting together with flash the exposure requirements of the camera will dominate which might produce slow shutter speeds indoors for example requiring the use of a tripod If on the other hand you select P or Pv instead then a shutter speed of 1 60 or faster is automatically chosen by the camera enabling you to hand hold When using flash close ...

Page 125: ...n push down on the top of the unit until it clicks back into place The flash unit is automatically activated when it is in the operative position and de activated when returned to its stored position The green LED flash symbol blinks in the viewfinder when the flash unit is charging and remains stationary when fully charged The flash output can also be adjusted for optimum light balance in fill flash sit...

Page 126: ...ore trial exposures made until the information on the grip LCD is satisfactory To use flash measure 1 Press the FLASH button on the grip to access the flash option screen 2 Turn the rear control wheel until Flash measure appears 3 Press Save DRIVE button to access the flash exposure screen 4 Makepreliminaryrequiredaperturesettingbyturningthefront controlwheel 5 Press the AE L button The camera will c...

Page 127: ...rs Tripod quick coupling Support strap Camera strap Focusing screens CF adapter Proshade Flash adapter Optional Accessories Optionalaccessoriesprovidetheopportunitytoextendthecapa bilitiesofyoursystemorjusttoaddextraconveniencetosuityour way of working ...

Page 128: ... and removal of the camera The camera is firmly held in an exact and repeatable position Two integrated spirit levels make horizontal positioning of the camera easy The Tripod quick coupling H fits 1 4 and 3 8 tripod threads and has a safety catch Support strap H 3053623 Improves comfort and security with hand held photography Tripod quick coupling H 3043326 Focusing screen grid Focusing screen clea...

Page 129: ... of Terms P and Pv explanatory charts Technical specifications Equipment Care Service Guarantee Appendix This section provides an insight into the more technical aspects as well as some important reference information ...

Page 130: ...magebank or computer Half press Full press Shutter release button The shutter release button can be depressed in two different ways This distinction is referred to in the text as half press and full press positions A half press is a rapid soft press whereas a full press is a firmer and longer depression of the button IAA Instant Approval Architecture or IAA provides the user with a method of classif...

Page 131: ...ime The main screen is therefore the one you have currently created and is the one visible on the LCD when photographing except where a particular mode is in actual operation such as self timer for example TTL Through The Lens a literal description of the light measurement mechanics The advantage is that only the essential parts of the subject in front of the camera are included Accessories such a...

Page 132: ...trated by the blue curve in the diagram The effective shutter speed then becomes T1 If the lens is now closed down by one stop the amount of light appears as illustrated by the red dashed curve The effective shutter speed is now increased to T2 which is longer that T1 The result is that the exposure is not reduced by exactly one stop 1EV however but slightly less At the shorter shutter speeds the ex...

Page 133: ... 19 18 17 16 15 14 13 210 80 35 150 120 50 50 110 50 50 110 110 P mode Pv mode Average 45x37mm Centre weighted 23x19mm Spot diameter 7 5mm Light measurement system H1 Light measurement system H1 Average 45x37mm Centre weighted 23x19mm Spot diameter 7 5mm Light measurement system H1 Light measurement system H1 Average 45x37mm Centre weighted 23x19mm Spot diameter 7 5mm Light measurement system H1 L...

Page 134: ...O 100 6 x 4 5 cm actual size 55 x 41 5 mm film 49 x 36 7 mm digital Electronically controlled lens shutter with speeds ranging from 32 seconds to 1 800 TTL centre weighted system Can be used with the built in flash or a wide variety of flashes compatible with the SCA3002 Metz system using adapter SCA3902 ISO range16 to 6400 Flash output can be adjusted for fill in purposes independent of ambient light...

Page 135: ... from unit s OLED and from FlexColor on a tethered computer Li ion type 7 2 V 1850 mAh output Uses DV charge termination technique to prevent over charging 100 240 VAC 50 60 Hz input 6 0 7 9 VDC 800mA output Complete camera with 2 8 80 mm lens 153 x 131 x 213 mm 6 0 x 5 2 x 8 4 ins W x H x L Complete camera with Li Ion battery and CF card 2175 g 4lb 12oz 22 or 39 Mpixels 36 7 x 49 0 mm 66 Mbytes 8...

Page 136: ...top Down button function Stop down 6 M UP button function Mirror up 7 Control wheel direction CW 8 Flash ready exposure lock Yes 9 Lens exposure lock Yes 10 Out of range exposure lock No 11 True exposure On 12 Spot mode Normal 13 Focus aid in MF Half press 14 AF assist light Ext Flash 15 Rear wheel quick adjust Yes 16 Control lock All controls 17 Beeper On 18 Show histogram Yes 19 Interval Selftim...

Page 137: ...release the magazine 4 Clean the outside surface of IR filter by spraying it with clean compressed air see warning above first If this is not enough then use one of the procedures outlined below 5 Reattach the sensor unit to the camera immediately after cleaning to check results 6 If you still see spots on your shot after you have cleaned the outside of the infrared filter then you may have dust on e...

Page 138: ...eapply any particles removed in the first pass 5 Finally check if the IR filter has been properly cleaned either by visual inspection or by mounting the sensor unit to the camera and making a shot If further cleaning is needed repeat cleaning procedure Attaching the sensor unit Position the sensor unit retention groove onto the sensor unit support on the camera body ensuring that they are correctly ...

Page 139: ... sand and salt water spray Dust on the lens glass and focusing screen can beremovedwithablowerbrushorverysoftlensbrushifnecessary Smears on the lens glass should be treated with great caution In some cases they mayberemovedwitha high qualitylenscleaningsolutionon atissuebut becarefulnottoscratchthelensortouchanyoftheglasssurfaceswithyour fingers Ifinanydoubt donotattempttocleanlensglasssurfacesyour...

Page 140: ...f the photographers who took them All text in this manual Victor Hasselblad AB Hasselblad A S All images in this manual Jens Karlsson Hasselblad and David Jeffery Victor Hasselblad AB Hasselblad A S assumes no responsibility or liability for any errors or inaccuracies that may appear in this manual Victor Hasselblad AB Hasselblad A S assumes no responsibility or liability for loss or damage incurre...

Page 141: ...141 Victor Hasselblad AB Box 220 SE 401 23 Göteborg Sweden Hasselblad A S Hejrevej 30 DK 2400 Copenhagen Denmark Productnumbers 3013100 3013400 70360519 70360539 70360508 70360528 0806 V2 ...

Reviews: