GE CGS995EELDS Owner'S Manual Download Page 18

49-85242-1

Oven Probe

USING THE RANGE:

2YHQ3UREH

Internal food temperature is frequently used as an 
indicator of doneness, especially for roasts and poultry. 

7KH3UREHPRGHPRQLWRUVWKHLQWHUQDOIRRGWHPSHUDWXUH

and turns the oven off when the internal food 
temperature reaches the programmed temperature.
Always check the temperature at multiple locations in 
the food with a food thermometer after cooking to ensure 
that all portions of the food have reached the minimum 
safe internal temperature for that food.

Proper Probe Placement

After preparing the meat and placing it on the cooking 
pan follow these instructions for proper probe placement.

Ŷ ,QVHUWWKHSUREHLQWRWKHIRRGVRWKDWWKHWLSRIWKH

probe will rest in the center of the thickest part of 
the food. For best performance the probe should 
be fully inserted into the food. If the probe is not 
located properly, it may not accurately measure the 
temperature of the coolest portion of the food. Some 
foods, particularly small items, are not well suited for 
cooking with the probe due to their shape or size.

Ŷ 7KHSUREHVKRXOGQRWWRXFKERQHIDWRUJULVWOH

Ŷ )RUZKROHSRXOWU\LQVHUWWKHSUREHLQWRWKHWKLFNHVW

part of the breast. 

Ŷ )RUERQHOHVVURDVWVLQVHUWWKHSUREHLQWRWKHFHQWHU

of the roast. 

Ŷ )RUERQHLQKDPRUODPELQVHUWWKHSUREHLQWRWKH

center of the lowest large muscle or joint. 

Ŷ )RUFDVVHUROHVRUGLVKHVVXFKDVPHDWORDILQVHUWWKH

probe into the center of the dish.

Ŷ )RUILVKLQVHUWWKHSUREHIURPMXVWDERYHWKHJLOOLQWR

the meatiest area, parallel to the backbone.

Probe Usage

The temperature probe can only be used with Bake, 
Convection Bake, and Convection Roast.

To use the probe with preheating:

 6HOHFWWKHGHVLUHGFRRNPRGH

Bake

Convection 

Bake

, or 

Convection Roast

SDGDQGHQWHUWKH

desired cooking temperature with the number pads.

 ,QVHUWWKHSUREHLQWRWKHIRRGVHH3URSHU3UREH

3ODFHPHQW

3.  Once the oven is preheated, place the food in the 

oven and connect the probe to the probe outlet, 

PDNLQJVXUHLWLVIXOO\LQVHUWHG8VHFDXWLRQWKHRYHQ

walls and probe outlet are hot.

4.  When the probe is connected, the display will prompt 

you to enter the desired food temperature. The 
maximum internal food temperature that you can set 

LVƒ)

To use the probe without preheating:

 ,QVHUWWKHSUREHLQWRWKHIRRGVHH3URSHU3UREH

3ODFHPHQW

 3ODFHWKHIRRGLQWKHRYHQDQGFRQQHFWWKHSUREHLQWR

the probe outlet in the oven.

 3UHVVWKH

Cook Mode

SDG

Traditional Bake

Convection Bake

, or 

Convection Roast

DQG

enter the desired cooking temperature with the 

QXPEHUSDGV3UHVV

Options

 and select 

Probe

 then 

follow the display prompts to enter the desired food 
temperature.

Probe Care Guidelines

Ŷ 8VHRISUREHVRWKHUWKDQWKHRQHSURYLGHGZLWKWKLV

product may result in damage to the probe outlet.

Ŷ 8VHWKHKDQGOHVRIWKHSUREHDQGSOXJZKHQLQVHUWLQJ

and removing them from the meat and outlet

Ŷ 7RDYRLGGDPDJLQJ\RXUSUREHGRQRWXVHWRQJVWR

pull on the cable when removing it.

Ŷ 7RDYRLGEUHDNLQJWKHSUREHPDNHVXUHIRRGLV

completely defrosted before inserting the probe.

Ŷ 7RSUHYHQWSRVVLEOHEXUQVGRQRWXQSOXJWKHSUREH

from the outlet until the oven has cooled.

Ŷ 1HYHUOHDYHWKHSUREHLQVLGHWKHRYHQGXULQJDVHOIRU

steam clean cycle.

Ŷ 'RQRWVWRUHWKHSUREHLQWKHRYHQ

WARNING

 Consuming undercooked food can result in foodborne illness. Use probe according to 

the following instructions to ensure all portions of the food reach minimum safe cooking temperatures. 
Recommendations for minimum safe food temperatures can be found at 
www.foodsafety.gov or www.IsItDoneYet.gov.

Summary of Contents for CGS995EELDS

Page 1: ...AFETY INFORMATION 3 USING THE RANGE In Case of a Power Failure 8 Surface Burners 8 Griddle 10 Oven Controls 11 Options 12 Settings 12 Sabbath Mode 14 Oven Racks 15 Aluminum Foil and Oven Liners 16 Cookware 16 Cooking Modes 16 Oven Air Vents 17 Oven Probe 18 Cooking Guide 19 CARE AND CLEANING Range Exterior 20 Range Interior 21 Cooktop 22 Door 24 Oven Probe 24 Oven Light 25 Oven Door 26 TROUBLESHOO...

Page 2: ...into every GE Appliances product and we think you will too Among other things registration of your appliance ensures that we can deliver important product information and warranty details when you need them Register your GE appliance now online Helpful websites and phone numbers are available in the Consumer Support section of this Owner s Manual You may also mail in the pre printed registration c...

Page 3: ...ecured to the anti tip device properly WARNING If the information in this manual is not followed exactly a fire or explosion may result causing property damage personal injury or death Do not store or use gasoline or other flammable vapors and liquids in the vicinity of this or any other appliance WHAT TO DO IF YOU SMELL GAS Ŷ R QRW WU WR OLJKW DQ DSSOLDQFH Ŷ R QRW WRXFK DQ HOHFWULFDO VZLWFK GR QR...

Page 4: ...WFKLQJ RU LPSDFWLQJ JODVV GRRUV cooktops or control panels Doing so may lead to glass breakage Do not cook on a product with broken glass Shock fire or cuts may occur Ŷ R QRW OHDYH FKLOGUHQ DORQH RU XQDWWHQGHG LQ DQ area where an appliance is in use They should never be allowed to climb sit or stand on any part of the appliance Ŷ CAUTION Do not store items of interest to children in cabinets above...

Page 5: ...n fire that could spread to surrounding cabinets Ŷ 1HYHU OHDYH RLO XQDWWHQGHG ZKLOH IU LQJ I DOORZHG to heat beyond its smoking point oil may ignite resulting in fire that may spread to surrounding FDELQHWV 8VH D GHHS IDW WKHUPRPHWHU ZKHQHYHU possible to monitor oil temperature Ŷ 7R DYRLG RLO VSLOORYHU DQG ILUH XVH WKH PLQLPXP amount of oil when using a shallow pan frying and avoid cooking frozen ...

Page 6: ...iven off during the self cleaning cycle of any range Move birds to another well ventilated room SAFETY INFORMATION IMPORTANT SAFETY INFORMATION READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE READ AND SAVE THESE INSTRUCTIONS WARNING OVEN SAFETY INSTRUCTIONS WARNING NEVER cover any slots holes or passages in the oven bottom or cover an entire rack with materials such as aluminum foil or oven liner...

Page 7: ...HFW WKH HTXLSPHQW LQWR DQ RXWOHW RQ D FLUFXLW different from that to which the receiver is connected Ŷ RQVXOW WKH GHDOHU RU DQ H SHULHQFHG UDGLR 79 technician for help b accept any interference received including interference that may cause undesired operation of the device Note that any changes or modifications to the wireless communication device installed on this oven that are not expressly app...

Page 8: ...s turned to LITE all burners will spark Sparking will continue as long as the knob remains at LITE Once gas is ignited turn the knob to adjust the flame size Automatic Reignition on some models The burners on this range will automatically relight if the flame goes out Using the Surface Burners NOTES Ŷ R QRW RSHUDWH WKH EXUQHU IRU DQ H WHQGHG SHULRG RI time without cookware on the grate The finish ...

Page 9: ...noxide levels above allowable standards This could be hazardous to your health 8VH D IODW ERWWRPHG ZRN Do not use stove top grills Top of Range Cookware Aluminum Medium weight cookware is recommended because it heats quickly and evenly Most foods brown HYHQO LQ DQ DOXPLQXP VNLOOHW 8VH VDXFHSDQV ZLWK WLJKW fitting lids when cooking with minimum amounts of water Stainless Steel This metal alone has ...

Page 10: ... SUHKHDW RXU JULGGOH E VHWWLQJ ERWK FHQWHU EXUQHUV WR IRU PLQXWHV before placing food on the griddle For models with a reversible griddle preheat your griddle by setting your center EXUQHU WR L IRU PLQXWHV EHIRUH SODFLQJ IRRG RQ WKH JULGGOH 2QFH WKH JULGGOH LV SUHKHDWHG WXUQ WKH NQRE RQ WKH EXUQHU V WR WKH FRRN VHWWLQJ RXWOLQHG LQ WKH WDEOH WARNING Fire Hazard Ŷ 8VH FDUH ZKHQ FRRNLQJ JUHDV IRRGV 6...

Page 11: ...rogram the time in KRXUV DQG PLQXWHV 3UHVV WKH Start pad The timer countdown is complete To turn the timer off press the Timer pad 8 Remote Enable Allows you to control your oven remotely The oven must be connected to WiFi before Remote Enable can be activated For instructions on how to connect your oven see WKH L L RQQHFW 5HPRWH QDEOH VHFWLRQ XQGHU Settings in this manual 9 Oven Light on some mod...

Page 12: ...nvection Bake and Convection Roast Settings The Options and Settings pads open up more detailed menus in the display that allow access to additional functions For each you select the function in the display using the associated number pad You can exit at any time by pressing the Options or Settings pad again WiFi Connect and Remote Enable Your oven is designed to provide you with two way communica...

Page 13: ...ct Bluetooth Select Pair and follow the corresponding instructions included with the mating Chef Connect enabled product The range will cancel pairing mode after two minutes if no mating device is detected Select Remove to confirm product is paired or to un pair from UDQJH 7KH 3UHFLVLRQ RRNLQJ 3UREH FDQ DOVR EH SDLUHG using the Bluetooth feature Auto Conv Auto Conversion When using Convection Bake...

Page 14: ... D GRXEOH RYHQ XQLW XVH WKH 1 through 5 number pads to select a different preset cooking temperature and press Start Enter 2 Since no feedback is given during temperature change an oven thermometer can be used to confirm temperature changes Starting a Timed Bake 3UHVV WKH Bake pad I WKH GHVLUHG WHPSHUDWXUH LV XVH WKH 6 through 0 number pads to select a cooking time If a cooking WHPSHUDWXUH RWKHU W...

Page 15: ...XSSRUWV NOTE Remove unused racks when using the oven for faster preheat improved efficiency and optimal cooking performance Extension Racks on some models Extension racks have a frame that locks into the rack supports on both sides Once the frame is locked into place always use the upper front rail to pull the rack out to its full extension position when placing or removing cookware If extension r...

Page 16: ...These modes are described below Refer to the Cooking Guide section for rack position and other recommendations for specific modes and foods Bake The bake mode is for baking and roasting When preparing baked goods such as cakes cookies and pastries always preheat the oven first To use this mode press the Bake pad enter a temperature with the number pads and then press Start Enter Warm Warm mode is ...

Page 17: ...mode is designed for cooking cakes breads cookies and similar foods on a single rack This mode is designed to provide lighter top browning and better volume Some foods may require slightly longer cook times relative to when cooked in the traditional bake PRGH 3UHVV Options and select Baked Goods than follow any display prompts to access this mode Convection Bake Multi Rack The Convection Bake mode...

Page 18: ...ing 6HOHFW WKH GHVLUHG FRRN PRGH Bake Convection Bake or Convection Roast SDG DQG HQWHU WKH desired cooking temperature with the number pads QVHUW WKH SUREH LQWR WKH IRRG VHH 3URSHU 3UREH 3ODFHPHQW 3 Once the oven is preheated place the food in the oven and connect the probe to the probe outlet PDNLQJ VXUH LW LV IXOO LQVHUWHG 8VH FDXWLRQ WKH RYHQ walls and probe outlet are hot 4 When the probe is ...

Page 19: ...des Broil skin side down first Watch food closely when broiling For best performance when broiling center food below the broil heater or burner Boneless chicken breasts Broil Low Bake Lower 2 0RYH IRRG GRZQ IRU PRUH GRQHQHVV OHVV VHDULQJ DQG XS IRU JUHDWHU VHDULQJ EURZQLQJ ZKHQ EURLOLQJ RU EHVW SHUIRUPDQFH ZKHQ EURLOLQJ center food below the broil element or burner Whole turkey Bake Convection Roa...

Page 20: ...nd basting liquids containing acids may cause discoloration and should be wiped up immediately Let hot surfaces cool then clean and rinse Painted Surfaces 3DLQWHG VXUIDFHV LQFOXGH WKH VLGHV RI WKH UDQJH DQG WKH door top of control panel and the drawer front Clean these with soap and water or a vinegar and water solution Do not use commercial oven cleaners cleaning powders steel wool or harsh abras...

Page 21: ...of this manual before using the Self Clean Mode Self Clean uses very high temperatures to clean the oven interior For a moderately soiled oven run a 3 hour self clean cycle For a heavily soiled oven run D KRXU VHOI FOHDQ F FOH 2QO VHOI FOHDQ EODFN UDFNV and grates may remain in the oven during the self clean F FOH OO RWKHU LWHPV LQFOXGLQJ QLFNHO SODWHG VLOYHU UDFNV VKRXOG EH UHPRYHG I QLFNHO SODWH...

Page 22: ... bad spillovers which could clog the burner openings Lift burners off when cool Wash with hot soapy water Rinse with clean water For more stubborn stains use a brush with plastic bristles NOTE Do not use steel wool or scouring pads to clean the burner parts as these may clog the openings Never wash burner heads in your dishwasher as dishwasher Doing so may cause them to discolor The ports in the b...

Page 23: ... clean your grates in the oven if your grates have rubber bumpers Doing so will destroy the rubber bumpers and may affect the function of your surface burners 3RUFHODLQ FRDWHG JUDWHV PD JUDGXDOO GXOO LI FRQWLQXDOO exposed to self clean temperatures I RXU RYHQ LV HTXLSSHG ZLWK VHOI FOHDQ EODFN UDFNV it is recommended to follow the instructions for placing grates on racks If your oven is equipped wi...

Page 24: ...Surfaces on some models Do not use a steel wool pad it will scratch the surface To clean the stainless steel surface use warm sudsy water or a stainless steel cleaner or polish Always wipe the surface in the direction of the grain Follow the cleaner instructions for cleaning the stainless steel surface To inquire about purchasing cleaning products including stainless steel appliance cleaner or pol...

Page 25: ...use or circuit breaker panel Let the bulb cool completely before removing it For your safety do not touch a hot bulb with a damp cloth If you do the bulb may break To remove 7XUQ WKH JODVV FRYHU FRXQWHUFORFNZLVH WXUQ XQWLO WKH tabs of the glass cover clear the grooves of the socket and pull the cover off Remove the bulb To replace 3XW LQ D QHZ ZDWW DSSOLDQFH EXOE 3ODFH WKH WDEV RI the glass cover ...

Page 26: ...H FDYLW DQG down to the locked position 5 Close the oven door Removal position 3XOO KLQJH ORFNV XS WR XQORFN 3XVK KLQJH ORFNV GRZQ WR lock Rest notch on bottom edge of hinge slot Notch Bottom edge of slot Hinge arm Lift Off Upper Oven Door The door is very heavy Be careful when removing and lifting the door Do not lift door by the handle To Remove the Door XOO RSHQ WKH GRRU 2 Lift up on the hinge ...

Page 27: ...sing aluminum foil on broil pan wrap tightly and add slits conforming to those in the pan to allow grease to drain Oven temperature too hot or too cold Oven temperature needs adjustment See the Cooking Modes section Oven and or display appears not to work A fuse in your home may be blown or the circuit breaker tripped Replace the fuse or reset the circuit breaker Oven controls improperly set 6HH W...

Page 28: ...he oven to cool below the locking temperature LOCK DOOR flashes in the display The self clean cycle has been selected but the door is not closed Close the oven door F and a number or letter flash in the display You have a function error code 3UHVV WKH Cancel Off pad Allow the oven to cool for one KRXU 3XW WKH RYHQ EDFN LQWR RSHUDWLRQ I WKH IXQFWLRQ FRGH UHSHDWV GLVFRQQHFW DOO SRZHU WR WKH RYHQ IRU...

Page 29: ...t Gas to the oven burners may have been shut off The oven gas shut off is located on the gas regulator near the gas line attachment to your range Locate it and flip the lever My oven door glass appears to be tinted or have a rainbow color The inner oven glass is coated with a heat barrier to reflect the heat back into the oven to prevent heat loss and keep the outer door cool while baking 7KLV LV ...

Page 30: ...ted Warranty Any implied warranties including the implied warranties of merchantability or fitness for a particular purpose are limited to one year or the shortest period allowed by law This warranty is extended to the original purchaser and any succeeding owner for products purchased for home use ZLWKLQ WKH 86 I WKH SURGXFW LV ORFDWHG LQ DQ DUHD ZKHUH VHUYLFH E D SSOLDQFHV XWKRUL HG 6HUYLFHU LV Q...

Page 31: ...tion The following products and more are available Accessories Accessories Nickel Flat Rack Reinforced Nickel Flat Rack Self Clean Flat Rack Nickel Extension Rack Self Clean Extension Rack URLOHU 3DQ ô ó ò Roasting Rack Accessory Cooktop Center Grate Nonstick Aluminum Griddle Reversible Cast Iron Griddle Cleaning Supplies LWUX6KLQH 6WDLQOHVV 6WHHO LSHV 6WDLQOHVV 6WHHO 3ROLVKLQJ ORWK CERAMA BRYTE B...

Page 32: ... WKDW DUH DYDLODEOH ZKLOH RXU warranty is still in effect You can purchase it on line anytime GE Appliances Services will still be there after your ZDUUDQW H SLUHV Q WKH 86 GEAppliances com extended warranty RU FDOO GXULQJ QRUPDO EXVLQHVV KRXUV Remote Connectivity RU DVVLVWDQFH ZLWK ZLUHOHVV QHWZRUN FRQQHFWLYLW IRU PRGHOV ZLWK UHPRWH HQDEOH visit our website at GEAppliances com connected home smar...

Page 33: ... 3 USO DE LA COCINA En Caso de Corte de Corriente 8 Quemadores 8 Plancha 10 Controles del Horno 11 Options Opciones 12 Settings Configuraciones 12 Modo Sabático 14 Estantes del Horno 15 Papel de Aluminio y Cobertores del Horno 16 Utensilios 16 Modos de Cocción 16 Ventilaciones de Aire del Horno 17 Sonda del Horno 18 Guía de Cocción 19 CUIDADO Y LIMPIEZA Cocina Exterior 20 Cocina Interior 21 Placa ...

Page 34: ... creemos que usted también Entre otras cosas el registro de su electrodoméstico asegura que podamos entregarle información importante del producto y detalles de la garantía cuando los necesite Registre su electrodoméstico GE ahora a través de Internet Sitios Web y números telefónicos útiles están disponibles en la sección de Soporte para el Consumidor de este Manual del Propietario También puede e...

Page 35: ...das las instrucciones de seguridad antes de utilizar este producto No seguir estas instrucciones puede generar un incendio una descarga eléctrica lesiones corporales o la muerte LEA Y GUARDE ESTAS INSTRUCCIONES INFORMACIÓN IMPORTANTE DE SEGURIDAD LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ESTE ELECTRODOMÉSTICO INFORMACIÓN DE SEGURIDAD ADVERTENCIA Si la información de este manual no se sigue exactam...

Page 36: ...on un vidrio roto Es posible que se produzcan descargas incendio o cortes Ŷ 1R GHMH D ORV QLxRV VRORV R IXHUD GH VX UDGLR GH DWHQFLyQ en el área donde el electrodoméstico se encuentre en uso Nunca se les deberá permitir trepar sentarse o pararse sobre ninguna parte del electrodoméstico Ŷ ADVERTENCIA No coloque artículos de interés para los niños sobre los gabinetes que están sobre un horno si los ...

Page 37: ...nando una pérdida de gas y riesgo de incendio Ŷ O LQKDELOLWDU HO ORTXHR GHO RQWURO GH DV HQ DOJXQRV PRGHORV DVHJ UHVH GH TXH ORV FRQWUROHV GH VXSHUILFLH VH HQFXHQWUHQ HQ OD SRVLFLyQ 2 SDJDGR VWR evitará que haya un flujo de gas no intencional desde los quemadores Ŷ 1R XVH SDSHO GH DOXPLQLR SDUD FXEULU UHMLOODV FXDOTXLHU parte de la cocina Si se hace esto se podrá producir envenenamiento con monóxi...

Page 38: ...tar dañar ni mover la junta Ŷ IMPORTANTE La salud de algunas aves es extremadamente sensible a los humos emitidos durante el ciclo de limpieza automática de cualquier cocina Coloque las aves en otra habitación bien ventilada ADVERTENCIA INSTRUCCIONES DE SEGURIDAD ADVERTENCIA NUNCA cubra ninguna ranura agujeros o pasajes en el fondo del horno ni cubra un estante entero con materiales tales como pap...

Page 39: ...corriente al que se encuentra conectado el receptor Ŷ 3DUD VROLFLWDU D XGD FRQVXOWH FRQ HO SURYHHGRU PLQRULVWD R D XQ WpFQLFR H SHULPHQWDGR GH UDGLR 79 b tolerar cualquier interferencia recibida incluyendo las interferencias que puedan provocar un funcionamiento no deseado del dispositivo Observe que todos los cambios o modificaciones sobre el dispositivo de comunicación inalámbrico instalado en e...

Page 40: ...na sobre la parrilla El acabado de la parrilla se puede resquebrajar si no hay un utensilio de cocina que absorba el calor Ŷ No intente desensamblar un quemador mientras otro quemador está encendido Es posible que se produzca una descarga eléctrica lo cual podría hacer que vuelque un utensilio de cocina caliente Ŷ Asegúrese de que los quemadores y las parrillas estén fríos antes de colocar la mano...

Page 41: ...ios de esmalte DMR FLHUWDV FRQGLFLRQHV HO HVPDOWH de algunos utensilios de cocina se pueden derretir Siga las recomendaciones sobre métodos de cocción del fabricante de utensilios de cocina Vidrio Existen dos tipos de utensilios de cocina de vidrio aquellos para uso con el horno únicamente y aquellos para OD FRFFLyQ HQ OD SDUWH VXSHULRU GH OD FRFLQD FDFHURODV FDIp WHWHUDV RV FRQGXFWRUHV GH YLGULR ...

Page 42: ...s en 4 durante entre 5 y 10 minutos antes de colocar comida sobre la plancha En los modelos con plancha reversible precaliente esta última FRQILJXUDQGR DPERV TXHPDGRUHV FHQWUDOHV HQ L OWR GXUDQWH HQWUH PLQXWRV DQWHV GH FRORFDU FRPLGD VREUH OD SODQFKD 8QD YH SUHFDOHQWDGD OD SODQFKD JLUH OD SHULOOD GHO TXHPDGRU HV KDVWD OD FRQILJXUDFLyQ GH FRFFLyQ UHVDOWDGD HQ OD WDEOD ADVERTENCIA Riesgo de Incendio...

Page 43: ...uenta regresiva del temporizador se completó Para apagar el temporizador presione la tecla Timer Temporizador 8 Remote Enable Acceso Remoto en algunos modelos Le permite controlar el horno de forma remota El horno deberá estar conectado a la UHG L L DQWHV GH TXH 5HPRWH QDEOH FFHVR 5HPRWR sea activado Para acceder a instrucciones sobre cómo FRQHFWDU HO KRUQR FRQVXOWH OD VHFFLyQ L L RQQHFW 5HPRWH QD...

Page 44: ...odos de Cocción La sonda sólo puede ser usada FRQ ODV IXQFLRQHV DNH RUQHDU RQYHFWLRQ DNH RUQHDU SRU RQYHFFLyQ RQYHFWLRQ 5RDVW RUDU SRU RQYHFFLyQ Settings Configuraciones DV WHFODV 2SWLRQV 2SFLRQHV 6HWWLQJV RQILJXUDFLRQHV DEUHQ PHQ V PiV GHWDOODGRV HQ OD SDQWDOOD ORV FXDOHV SHUPLWHQ acceso a funciones adicionales Para cada uno seleccione la función en la pantalla a través de la tecla numérica asoci...

Page 45: ... el producto de emparejamiento permitido por Chef Connect La cocina cancelará el modo de emparejamiento luego de dos minutos si no es detectado ningún dispositivo para emparejar Seleccione Remove Retirar para confirmar que el producto está emparejado o para desemparejar el mismo de su cocina La Sonda de Cocción de Precisión WDPELpQ SXHGH VHU HPSDUHMDGD XVDQGR OD IXQFLyQ OXHWRRWK Auto Conv Conversi...

Page 46: ...V QXPpULFDV GH 1 a 5 para seleccionar una temperatura de cocción actual diferente y presione Start Enter Iniciar Ingresar 2 Debido a que no hay ninguna indicación durante el cambio de temperatura se puede usar un termómetro para horno para confirmar los cambios de temperatura Inicie un Horneado por Tiempo 1 Presione la tecla Bake Hornear 2 Si la temperatura deseada es de 350ºF use las teclas numér...

Page 47: ... los estantes en desuso al usar el horno para un precalentamiento más rápido mayor eficiencia y un rendimiento óptimo de la cocción Estantes Extensibles en algunos modelos Los estantes extensibles cuentan con una estructura que se EORTXHD HQ ORV VRSRUWHV GH ORV HVWDQWHV D DPERV ODGRV 8QD vez que la estructura está bloqueada en su lugar siempre use el riel frontal superior para empujar hacia afuera...

Page 48: ... acceder a recomendaciones para comidas específicas consulte la sección de la Guía de Cocción Recuerde que es posible que su nuevo horno funcione de manera diferente que aquel que está reemplazando Bake Hornear El modo de horneado es utilizado para hornear y dorar Al preparar comidas horneadas tales como tartas galletas y masas siempre precaliente el horno primero Para usar este modo presione la t...

Page 49: ...V 3URGXFWRV RUQHDGRV IXH GLVHxDGR para cocinar tortas panes galletas y comidas similares en un solo estante Este modo fue diseñado para brindar un dorado superior más leve y un mejor volumen Algunas comidas podrán requerir tiempos de cocción más prolongados en relación a cuando se cocina en el modo de horneado tradicional Presione la tecla Options Opciones y seleccione Baked Goods Productos Hornea...

Page 50: ...FDGR LQVHUWH OD VRQGD MXVWR DUULED GH OD agalla en la zona más carnosa paralela a columna Uso de la Sonda La sonda de temperatura sólo puede ser usada con las IXQFLRQHV DNH RUQHDU RQYHFWLRQ DNH RUQHDU SRU RQYHFFLyQ RQYHFWLRQ 5RDVW RUDU SRU RQYHFFLyQ Para usar la sonda con precalentamiento RQILJXUH HO PRGR GH FRFFLyQ GHVHDGR Hornear Hornear por Convección o Dorar por Convección H LQJUHVH OD tempera...

Page 51: ...te atención a la comida al asarla Para un mejor rendimiento centre la comida debajo del elemento que emite calor para asar o del quemador Hornear Dorado por Convección DNH Convection Roast Inferior 2 8VH XQD ROOD FKDWD WDO FRPR XQD ROOD SDUD DVDU No se requiere precalentarla Ave Pollo entero Hornear Dorado por Convección Inferior 2 8VH XQD ROOD FKDWD WDO FRPR XQD ROOD SDUD DVDU Pechugas patas musl...

Page 52: ...erán limpiar de inmediato Deje que las superficies calientes se enfríen y luego limpie y enjuague Superficies pintadas Las superficies pintadas incluyen los lados de la cocina y la puerta la parte superior del panel de control y el frente del cajón Límpielas con jabón y agua o con una solución de agua y vinagre No utilice limpiadores de horno comerciales polvos limpiadores esponjillas de acero o a...

Page 53: ...R XVD temperaturas muy altas para limpiar el interior del horno Para un horno moderadamente sucio use un ciclo de limpieza automática de 3 horas Sólo los estantes del horno de limpieza DXWRPiWLFD QHJURV ODV UHMLOODV SRGUiQ SHUPDQHFHU HQ HO horno durante el ciclo de limpieza automática Todos los GHPiV tWHPV LQFOX HQGR ORV HVWDQWHV QLTXHODGRV SODWHDGRV GHEHUiQ VHU UHWLUDGRV 6L ORV HVWDQWHV QLTXHODGR...

Page 54: ... limpia Para eliminar las manchas más rebeldes use un cepillo con cerda plástica NOTA No use lana de acero ni estropajos para limpiar las partes del quemador ya que podrán bloquear las aberturas Nunca lave las cabezas de los quemadores en el lavavajillas Esto podrá hacer que se descoloren Las hendiduras de las cabezas de los quemadores se deben mantener limpias en todo momento para obtener una lla...

Page 55: ... de porcelana se podrán volver gradualmente ásperas si son expuestas de forma continua a las temperaturas de limpieza automática Si su horno está equipado con estantes de limpieza automática QHJURV VH UHFRPLHQGD VHJXLU ODV LQVWUXFFLRQHV SDUD OD colocación de parrillas en los estantes Si su horno está equipado con estantes niquelados se recomienda seguir las instrucciones para la colocación de reji...

Page 56: ...ble en algunos modelos No use virutas de acero éstas dañarán la superficie Para limpiar la superficie de acero inoxidable use agua tibia con jabón o un limpiador o pulidor para acero inoxidable Siempre limpie la superficie en la dirección del veteado Siga las instrucciones del limpiador para limpiar la superficie de acero inoxidable Para realizar consultas sobre la adquisición de productos incluye...

Page 57: ...anuras de la ficha Dé a la tapa de vidrio un cuarto de giro en dirección de las agujas del reloj NOTA Ŷ DV OiPSDUDV SDUD electrodoméstico de 40 watts son más pequeñas que las lámparas hogareñas de 40 watts Ŷ 9XHOYD D FRQHFWDU HO horno una vez que la lámpara nueva esté instalada Ŷ 3DUD XQD PHMRU iluminación dentro del horno limpie la tapa del vidrio en forma frecuente utilizando una tela húmeda Est...

Page 58: ... Cierre la puerta del horno Posición de retiro Empuje los bloqueos de las bisagras hacia arriba para desbloquearlos Empuje trabas de la bisagra hacia abajo para bloquear Apoye la abertura en el extremo inferior de la ranura de la bisagra Abertura Empuje el bloqueo de la bisagra hacia arriba hasta que quede bloqueado UD R GH OD ELVDJUD Levante la Puerta del Horno Superior La puerta es muy pesada Te...

Page 59: ...quellos en la olla para permitir que la grasa sea drenada La temperatura del horno es demasiado caliente o demasiado fría La temperatura del horno debe ser ajustada Consulte la sección Modos de Cocción El horno y o la pantalla parecen no estar funcionando Es posible que un fusible de su hogar se haya quemado o que el disyuntor se haya desconectado Reemplace el fusible o reinicie el disyuntor Contr...

Page 60: ...ff Cancelar Apagar Espere a que el horno se enfríe por debajo de la temperatura de bloqueo TRABA DE LA PUERTA titila en la pantalla El ciclo de limpieza automática fue seleccionado pero la puerta no está cerrada Cierre la puerta del horno XQ Q PHUR o letra titila en la pantalla Tiene un código de error de función Presione la tecla Cancel Off Cancelar Apagar Permita que el horno se enfríe durante u...

Page 61: ...ar y asar no Es posible que los quemadores de gas del horno hayan sido apagados El apagado del gas del horno está ubicado en el regulador de gas cerca GH OD DGKHUHQFLD GH OD WXEHUtD GH JDV D OD FRFLQD 8ELTXH OD PLVPD Gp vuelta la palanca La puerta de vidrio del horno parece estar teñida o tener un color arcoíris El vidrio del horno interno está cubierto con una barrera de calor que refleja este úl...

Page 62: ...HSDUDU R UHHPSOD DU ODV lámparas excepto las lámparas LED GARANTÍA Garantía de la Cocina a Gas de GE Appliances EXCLUSIÓN DE GARANTÍAS IMPLÍCITAS Su única y exclusiva alternativa es la reparación del producto como se indica en la Garantía Limitada Las garantías implícitas incluyendo garantías implícitas de comerciabilidad o conveniencia sobre un propósito particular se limitan a un año o al períod...

Page 63: ...les Accesorios Accesorios Estante Plano de Níquel Estante Plano Reforzado de Níquel Estante Plano con Limpieza Automática Estante Extensible de Níquel Estante Extensible con Limpieza Automática 2OOD SDUD VDU ô ó ò Accesorio del Estante para Dorar Rejilla Central de la Superficie de Cocción Plancha de Aluminio No Adherente Plancha de Hierro Forjado Reversible Suministros de Limpieza Limpiadores de ...

Page 64: ...ntía aún está vigente La puede adquirir en cualquier momento a través de Internet Los servicios de GE Appliances aún estarán allí cuando su garantía caduque Q 88 GEAppliances com extended warranty o comuníquese al 800 626 2224 durante el horario de atención comercial Conectividad Remota 3DUD VROLFLWDU DVLVWHQFLD SDUD OD FRQHFWLYLGDG GH UHG LQDOiPEULFD SDUD PRGHORV FRQ DFFHVR UHPRWR visite nuestro ...

Reviews: