background image

3. Assembly of components

GE 300

10

3.2/0617

3. Assembly of components

Remove housing cover

Remove the housing cover

ATTENTION: Exchanging cards

Exchanging the cards may only be carried out while the power is switched off!

NOTE: Remove screws

In case a protection against contact has been fixed with screws (

see page 14

), these screws have to be

removed before lifting the cover. 

 

GE 300

Attention

OBSERVE PRECAUTIONS FOR HANDLING
OF ELECTROSTATIC SENSITIVE DEVICES!

Achtung: Darf nur durch geschultes Personal geöffnet werden

#VVGPVKG/CICNNGGPIGQRGPFYQTFGPFQQTIGMYCNKƂEGGTFRGTUQPGGN

#VVGPVKQP/C[QPN[DGQRGPGFD[SWCNKƂGFRGTUQPU

Attenzione: Darf nur durch geschultes Personal geöffnet werden

Attention: Seul ie personnel qualife est autorise a l ouvrir!

Atencion: Darf nur durch geschultes Personal geöffnet werden

Press here to remove the housing cover

Содержание GE 300

Страница 1: ...GE 300 MANUAL VERSION 3 2 0617 PRODUCT MANUAL ENGLISH...

Страница 2: ...er for errors and problems which result from problems or malfunctioning of the transmission path Caution This is a Class A product standard EN 55022 In a domestic environment this product may cause ra...

Страница 3: ...ion diagram GE 300 GEZ 300 GEI 300 15 Connection diagram GE 300WR 16 Connection to the network 17 Connection subscriber cards 17 Connection of input output cards 18 5 Configuration CCT 800 20 Configur...

Страница 4: ...and actions which will allow an error free operation Also this box will warn you if a certain configuration option or entered value could lead to a malfunction of the application or a loss of data NO...

Страница 5: ...scribes mounting of the hardware and start up of the Intercom Server subscriber cards and input output cards Information about the interface cards and Intercom terminals can be found in the respective...

Страница 6: ...music or alarm Two inputs for floating contacts Two relay outputs Configuration via Ethernet or RS 232 The following section introduces the respective features and benefits of the available variants o...

Страница 7: ...power supply unit possible e g PA60W24V GE 300WR Illustration of GE 300WR Delivery without power supply unit DC UPS applications Wide range input 20 36 VDC NOTES Power supply of the subscribers For an...

Страница 8: ...0WR Basic housing expansion housing GEZ 300 Basic housing interface housing GEI 300 Basic expansion interface housing GE 300 30 W 16 32 12 28 GE 300 60 W 70 W 20 36 20 32 GE 300WR 30 W 16 32 12 28 1 P...

Страница 9: ...ners or barriers via floating relay contacts depending on type Interface cards By means of interface cards external systems such as telephones PCs or mobile radios can be connected and integrated Conn...

Страница 10: ...crews have to be removed before lifting the cover GE 300 Attention OBSERVE PRECAUTIONS FOR HANDLING OF ELECTROSTATIC SENSITIVE DEVICES Achtung Darf nur durch geschultes Personal ge ffnet werden VVGPVK...

Страница 11: ...6E 5 5 G3 TEL 5 5 G3 IF 5 5 G3 LAN 1 together 1 1 G3 IAX 5 5 G8 IAX 2 G8 VOIPSERV 2 2 3 G8 VOIPREC 4 24 G8 V24 PRO 2 G8 SELCALL 3 12 G8 CNET E1 1 21 G8 CNET W 1 21 G8 AUD 2 G3 S0 I 2 G8 TEL4 1 1 Only...

Страница 12: ...300 or if an expansion housing GEZ 300 is connected there to the expansion plug of the GEZ 300 see page 15 Remove the plugin unhinge lever of the plug in cards 1 Press in the pin at one side with a f...

Страница 13: ...max 120 mm 4 7 inch 110 cm 43 3 inch 140 cm 55 1 inch 290 mm 11 4 inch 306 mm 12 1 inch 180 mm 7 1 inch 206 mm 8 1 inch 24 VAC supply Analogue Digital Analogue Snap ferrite Snap ferrite min 120 mm 4 7...

Страница 14: ...er with protection against contact Place the cover on the Intercom Server and press the cover into its holder The cover remains in position due to the plug connection Insert the supplied screws into t...

Страница 15: ...ain unused 24 VAC 24 VAC 30V 1 6 2 7 3 8 4 9 5 10 GE 300 A A B B A C B D GEI 200 GEZ 300 GEI 300 GEI 300 G3 GED 4 G3 16A G3 GET G3 16A 4 G3 GET 4 G3 GET 4 G3 GET 4 G3 GET 4 G3 GET 4 G3 GET 4 Status LE...

Страница 16: ...7 3 8 4 9 5 10 GE 300WR A A B B A C B D GEI 200 GEZ 300 GEI 300 GEI 300 G3 GED 4 G3 16A G3 GET G3 16A 4 G3 GET 4 G3 GET 4 G3 GET 4 G3 GET 4 G3 GET 4 G3 GET 4 Status LED Status LED Connection for DC p...

Страница 17: ...Server is carried out via the Uplink socket of the G3 GEM see page 17 4 wire subscriber cards G3 GET 4 Overview 4 wire subscriber card G3 GET 4 LED1 Uplink Slot 1 Slot 2 Slot 3 Slot 4 Slot 5 GE 300 G...

Страница 18: ...the inputs Only FLOATING CONTACTS like e g relay contacts contactors keys or switches may be connected A A B B A A B B blue green Status subscriber card Subscriber 1 Subscriber 1 Subscriber 2 Subscrib...

Страница 19: ...ing 3 2 0617 19 Output card G3 16A Overview output card G3 16A Input card G3 16E Overview input card G3 16E Status LEDs for S1 S8 Status indication output card Status LEDs for IN1 IN8 Status indicatio...

Страница 20: ...is cable is connected to the 9 way D Submin socket on the motherboard G3 GEM see page 15 This cable can be purchased at an electric outfitter or ordered under the type X KAB CCT NC not connected NOTES...

Страница 21: ...r Cards The following dialogue appears Dialogue New Intercom Server 2 In the server area right click and select add Intercom Server 3 Activate the radio button GE 300 4 In the field Server ID enter th...

Страница 22: ...k and Downlink select the Ethernet operation mode of the RJ45 ports Additional settings NOTE Intercom Server must be connected to the computer To change the server ID of an existing Intercom Server th...

Страница 23: ...jitter ad justment At a bad Internet connection or missing QoS mechanisms this can lead to a reduced speech quality If the speech transmission at the start of conversations is faulty the time in the d...

Страница 24: ...b General Generation In this drop down list select the entry 2 2nd generation of the GE 300 Power Supply W In this drop down list select either the entry 60 or 70 according to the used power supply un...

Страница 25: ...cation cable 0 6 0 8 mm 135 73 Ohm km 1 500 m 1 400 m 800 m The indicated line length is valid for standard stations without additional ext loudspeaker With these line lengths max the volume level 9 d...

Страница 26: ...may not be higher than 90 nF Stations without display power supply stations amplifiers IP stations The maximum line length of Cat 5 cables may not surpass 100m e g from switch to the ET 908A Maximum c...

Страница 27: ...ame numerical sequence e g 110 in housing no 1 and 1101 in housing no 11 Slot Subscriber cards with 4 subscribers Subscriber cards with 8 subscribers 1 101 104 101 108 2 105 108 109 116 3 109 112 117...

Страница 28: ...ercom Servers connected via LAN G3 LAN max 8 connections max 8 conversations LAN via G3 GEM max 4 connections max 2 conversations When networking to Intercom Servers GE 800 with PRO 800 1 1 G8 LAN WAN...

Страница 29: ...ng package approx 1 500 g 3 31 lbs Mounting wall mounting Relay outputs max switching capacity 60 W 62 5 VA max switching current 2 A max switching voltage 60 VDC 40 VAC Music input max 800 mVrms at 1...

Страница 30: ...no power consumption with cards see corresponding datasheet Operating temperature range 0 C to 50 C 32 F to 122 F Storage temperature range 30 C to 60 C 22 F to 140 F Relative humidity 20 to 80 non c...

Страница 31: ...ation for the connected power supply The GEZ 300 has no own ON OFF switch it is switched with the ON OFF switch of the basic housing GE 300 Subscriber cards For further information about LED positions...

Страница 32: ...thm the card is working correctly LED is permanently off no power or hardware fault LED is permanently on waiting for connection to the main processor during initialization or reset LED blinking fast...

Страница 33: ...GE 300 Technical Support 3 2 0617 33 Technical Support For more information about our products and services visit www commend com...

Отзывы: